Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0G02607g2.284ON68868835270.0
Suva_9.1042.284ON80538413461e-175
TDEL0G021502.284ON66131613311e-175
YIL095W (PRK1)2.284ON81031713261e-172
Kwal_27.115422.284ON79137913231e-172
NDAI0B035602.284ON75635613161e-172
Smik_9.842.284ON80839013201e-172
KAFR0H033302.284ON36932112721e-170
Skud_9.782.284ON80932413041e-169
NCAS0G038102.284ON66131212891e-169
KAFR0J013702.284ON78032412961e-168
KLTH0G10318g2.284ON79044212951e-168
KLLA0E08405g2.284ON77731712921e-168
NCAS0B062602.284ON72331512851e-167
ADL217W2.284ON75031312821e-167
SAKL0E07722g2.284ON79131512701e-164
NDAI0G006402.284ON62131512471e-163
ZYRO0A01848g2.284ON70436312501e-162
TBLA0B059302.284ON71731312371e-160
TPHA0C033802.284ON69732412291e-159
Skud_14.3092.284ON63935312171e-158
Ecym_33232.284ON74831712141e-156
Suva_14.3272.284ON63230812031e-156
YNL020C (ARK1)2.284ON63831412041e-156
Smik_14.3112.284ON63731412031e-156
Kpol_1003.352.284ON71332012081e-156
KNAG0H020202.284ON59231111681e-152
Kpol_1039.332.284ON70132011261e-144
CAGL0J03432g2.284ON62231110951e-140
TBLA0B069402.284ON144331711391e-139
KNAG0A054302.284ON78832410741e-135
TPHA0D015402.284ON70732210371e-131
KNAG0J008203.273ON10913227842e-90
KLLA0F18612g3.273ON8143747692e-90
KLTH0C07260g3.273ON9013167716e-90
SAKL0D03234g3.273ON8583167652e-89
Ecym_26503.273ON8943937654e-89
KNAG0H012203.273ON9133837664e-89
Kwal_27.109453.273ON9353957657e-89
KAFR0A010403.273ON9123257621e-88
NDAI0A057003.273ON11573287703e-88
Kpol_1052.223.273ON11013657665e-88
CAGL0H10208g3.273ON10273237628e-88
NCAS0A105903.273ON10953187641e-87
Kpol_251.43.273ON8383187476e-87
KAFR0C004303.273ON9493227492e-86
TDEL0D035203.273ON10493517532e-86
TBLA0E025903.273ON10613167499e-86
ZYRO0E06864g3.273ON11153537456e-85
TPHA0A040303.273ON10543287401e-84
Smik_2.1913.273ON11083477393e-84
Suva_4.2973.273ON11073477385e-84
YBR059C (AKL1)3.273ON11083477361e-83
Skud_2.1793.273ON10903197332e-83
AGR027C3.273ON9613137221e-82
TPHA0M011203.273ON7883107113e-82
TBLA0I019303.273ON13613547294e-82
KLTH0H03080g6.262ON3463352432e-21
Kwal_56.242746.262ON3463362352e-20
TDEL0A067506.262ON3723402327e-20
Suva_16.706.262ON3643392291e-19
Skud_16.426.262ON3643332272e-19
Smik_10.1471.271ON14783052282e-18
Kpol_1037.206.31ON7042742272e-18
Kpol_1023.266.31ON7392712243e-18
SAKL0A03344g6.262ON3643512183e-18
ACL006W6.31ON7082862244e-18
KNAG0E008506.31ON7112752234e-18
CAGL0K08514g2.479ON14892202254e-18
YJL095W (BCK1)1.271ON14782822245e-18
Ecym_30356.31ON7402762226e-18
CAGL0J11638g6.31ON7462752217e-18
CAGL0L03520g1.271ON14473202221e-17
TPHA0J004206.31ON7072742191e-17
SAKL0H06754g8.668ON8841952201e-17
Smik_6.4416.262ON3643332141e-17
ZYRO0D05500g7.86ON12621792201e-17
Ecym_21536.262ON3633472141e-17
TDEL0G043806.31ON7222742192e-17
KNAG0F002901.52ON11252942202e-17
YPL236C (ENV7)6.262ON3643232122e-17
KAFR0D012207.86ON10551962182e-17
Kpol_431.92.479ON15521992182e-17
Skud_10.1191.271ON14812822174e-17
Suva_13.1636.31ON7052752154e-17
NCAS0D021006.31ON7262742154e-17
NCAS0A094701.271ON15152242164e-17
YDR507C (GIN4)1.52ON11422902165e-17
Smik_13.1596.31ON7052752145e-17
CAGL0M02299g8.668ON8932022155e-17
KNAG0F001701.24ON5432032126e-17
Skud_13.1546.31ON7052752137e-17
NDAI0C026806.31ON7502752138e-17
ZYRO0E07876g6.262ON3693362088e-17
ZYRO0C07480g6.31ON7742742138e-17
YMR001C (CDC5)6.31ON7052752129e-17
ZYRO0F07194g8.668ON9381982121e-16
KLLA0F14190g1.271ON13382562131e-16
TBLA0A047207.86ON12621822121e-16
ABL034W2.479ON14252002121e-16
KAFR0G026906.31ON7132762111e-16
KNAG0D048107.86ON14401832121e-16
NDAI0G054701.271ON15552792122e-16
Kwal_26.73551.271ON14462792112e-16
Suva_6.1691.271ON14842272112e-16
TPHA0G016308.668ON8712012102e-16
Kpol_1072.198.668ON8962862102e-16
TBLA0A071501.52ON13912952112e-16
NCAS0C016708.668ON8962032102e-16
ZYRO0F18062g1.24ON4712052053e-16
TPHA0I009201.271ON14342802093e-16
KLLA0C06138g6.31ON7082822074e-16
Suva_2.6871.52ON11282962084e-16
Suva_16.1608.668ON9182862074e-16
Kwal_26.87518.668ON8482862074e-16
Kpol_1065.36.222ON3762882007e-16
TBLA0C029401.271ON16432822068e-16
KAFR0C014403.92ON10952872058e-16
KLTH0C10912g6.31ON6972752048e-16
Kwal_26.71547.86ON12131802051e-15
Kwal_56.224766.31ON6972752031e-15
Kpol_463.81.271ON14472792041e-15
TPHA0F024306.31ON7982792031e-15
KLTH0D03454g1.271ON14332792041e-15
KAFR0A014201.271ON13982822041e-15
KAFR0A050906.31ON6682592021e-15
KAFR0D049505.406ON10082432031e-15
TBLA0B004906.31ON7872752021e-15
YDR523C (SPS1)1.24ON4902002001e-15
KLLA0C01650g1.52ON11122932031e-15
NDAI0H024707.86ON14111832032e-15
Skud_4.7831.52ON11352962032e-15
TPHA0G032002.479ON15342002032e-15
TDEL0H036407.86ON12371882022e-15
TDEL0C067801.24ON4682131992e-15
Smik_4.7891.52ON11362962022e-15
NDAI0F045201.24ON4891981992e-15
NCAS0C041208.140ON9152612012e-15
TDEL0A025502.479ON13691992022e-15
KLLA0F11319g8.668ON8431952012e-15
KLTH0F16676g5.406ON8783012003e-15
TPHA0H026307.86ON13671832003e-15
SAKL0E01584g6.31ON6952761993e-15
ZYRO0G15290g1.271ON14872822004e-15
Smik_4.8031.24ON4902001974e-15
NCAS0A053706.341ON15082981994e-15
Ecym_73922.479ON14342001995e-15
Suva_2.7031.24ON4851961965e-15
KLTH0D11044g8.668ON8492031986e-15
CAGL0F00913g7.86ON12061831986e-15
KNAG0B017801.271ON15802281986e-15
KLTH0D02486g7.86ON12231801986e-15
NCAS0A002801.24ON5351981957e-15
SAKL0D05522g1.271ON14742391987e-15
Skud_4.7971.24ON4851961947e-15
SAKL0D12628g1.507ON8182331968e-15
TDEL0D014001.271ON14292821978e-15
Ecym_10581.52ON11642941978e-15
TPHA0E038501.24ON4822011949e-15
KLTH0F01672g1.52ON11642861969e-15
Kpol_1040.207.86ON12971801961e-14
NDAI0I002506.371ON8973011951e-14
Ecym_60406.371ON8963001951e-14
KNAG0K023703.60ON8832041951e-14
KLLA0F07623g7.86ON12291931951e-14
AFR696C1.52ON11423001951e-14
KAFR0D041001.52ON11172941951e-14
Ecym_63441.271ON13972911951e-14
CAGL0I07513g3.92ON10763701942e-14
YCR073C (SSK22)6.341ON13312881952e-14
Skud_3.1656.371ON7162871932e-14
KNAG0F029006.31ON6493031932e-14
TBLA0E022907.86ON13001841942e-14
AFL101C6.222ON3672711892e-14
Sklu_YGOB_Anc_2.4962.496ON6192281922e-14
Ecym_24058.668ON8551971932e-14
AFR092W1.271ON14232911942e-14
NCAS0A055706.371ON9182941932e-14
Skud_1.447.86ON13561801932e-14
Kwal_55.215455.406ON8652931923e-14
KAFR0D033902.496ON7982521923e-14
Kpol_2002.241.24ON4872001903e-14
Ecym_10301.24ON4402751893e-14
Suva_15.2975.406ON10742471923e-14
Kpol_1044.37.86ON9321771923e-14
YHL007C (STE20)2.496ON9392761923e-14
TBLA0A035705.406ON9752021913e-14
Kwal_26.78612.496ON9552741913e-14
NDAI0K021002.496ON9092331914e-14
CAGL0C03509g6.371ON8952961914e-14
YCR091W (KIN82)6.371ON7202971904e-14
Skud_4.7643.92ON7563011904e-14
TBLA0B082503.92ON13472161914e-14
Suva_1.507.86ON13601801915e-14
Suva_15.1247.86ON11061871905e-14
Skud_16.1328.668ON9242821905e-14
CAGL0L11550g5.406ON10721961905e-14
TBLA0I011502.479ON17452341915e-14
ACR133C8.668ON8512031905e-14
TDEL0D053203.92ON10572881905e-14
TDEL0A061408.668ON8612001896e-14
Ecym_55055.406ON10032011897e-14
TDEL0A078606.371ON8372971897e-14
KAFR0H025108.668ON8791991897e-14
TBLA0I024006.341ON17303091897e-14
Skud_15.1127.86ON11013021897e-14
Smik_15.1227.86ON11011871897e-14
Suva_11.1232.479ON15262121897e-14
YOL045W (PSK2)7.86ON11011871897e-14
Smik_1.507.86ON13571801898e-14
YAL017W (PSK1)7.86ON13561801898e-14
KAFR0G012001.24ON5071931868e-14
NDAI0E023908.668ON8831951888e-14
NDAI0F013406.262ON4061541858e-14
Skud_8.392.496ON9232761888e-14
Smik_1.793.177ON9742471888e-14
NCAS0F015807.86ON13821831898e-14
TBLA0F002406.371ON12482961888e-14
NDAI0G034508.141ON9483391889e-14
KAFR0K007007.86ON13811841889e-14
YPL150W8.668ON9012881889e-14
TBLA0B085203.60ON9342701881e-13
YDR490C (PKH1)3.92ON7662941871e-13
Kwal_27.100041.507ON7352441871e-13
AER264C6.341ON14832821881e-13
KNAG0D002106.371ON8332981871e-13
NCAS0C049403.92ON11162821871e-13
Smik_4.7673.92ON7582951871e-13
KLLA0A07403g3.60ON8791811871e-13
SAKL0C01716g1.52ON12152971871e-13
NDAI0K023906.371ON8862961871e-13
KNAG0B053502.496ON8362451861e-13
KLLA0C08525g6.341ON15512951871e-13
Suva_3.1106.341ON13762941871e-13
KAFR0C045906.341ON14683031871e-13
KNAG0J016708.668ON10092021861e-13
TBLA0I002802.496ON13162731861e-13
SAKL0B09856g7.86ON12741871861e-13
Smik_8.422.496ON9392741862e-13
CAGL0K02167g8.140ON11622821862e-13
TDEL0C064901.52ON11532951852e-13
Smik_6.3478.668ON9172861852e-13
Smik_3.1896.371ON7192931842e-13
Kpol_1031.105.406ON11271931852e-13
KLTH0C02662g1.507ON7752441852e-13
NCAS0B086001.52ON11172721852e-13
YAR019C (CDC15)3.177ON9742471852e-13
Ecym_35253.60ON8181721842e-13
TDEL0A027202.496ON9152851842e-13
NCAS0I004707.86ON10821941842e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G02607g
         (688 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...  1363   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   523   e-175
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   517   e-175
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   515   e-172
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   514   e-172
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   511   e-172
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   513   e-172
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   494   e-170
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   506   e-169
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   501   e-169
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   503   e-168
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   503   e-168
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   502   e-168
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   499   e-167
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   498   e-167
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   493   e-164
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    484   e-163
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   486   e-162
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   481   e-160
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   478   e-159
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   473   e-158
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   472   e-156
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   468   e-156
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   468   e-156
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   468   e-156
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   469   e-156
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   454   e-152
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   438   e-144
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   426   e-140
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   443   e-139
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   418   e-135
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   404   e-131
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   306   2e-90
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   300   2e-90
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   301   6e-90
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   299   2e-89
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   299   4e-89
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   299   4e-89
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   299   7e-89
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   298   1e-88
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   301   3e-88
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   299   5e-88
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   298   8e-88
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   298   1e-87
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   292   6e-87
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   293   2e-86
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   294   2e-86
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   293   9e-86
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   291   6e-85
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   289   1e-84
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   289   3e-84
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   288   5e-84
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   288   1e-83
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   286   2e-83
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   282   1e-82
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   278   3e-82
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   285   4e-82
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    98   2e-21
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    95   2e-20
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    94   7e-20
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    93   1e-19
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    92   2e-19
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    92   2e-18
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    92   2e-18
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    91   3e-18
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    89   3e-18
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    91   4e-18
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    91   4e-18
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    91   4e-18
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    91   5e-18
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    90   6e-18
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    90   7e-18
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    90   1e-17
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    89   1e-17
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    89   1e-17
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    87   1e-17
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    89   1e-17
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    87   1e-17
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    89   2e-17
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    89   2e-17
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    86   2e-17
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    89   2e-17
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    89   2e-17
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    88   4e-17
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    87   4e-17
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      87   4e-17
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    88   4e-17
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    88   5e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    87   5e-17
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    87   5e-17
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    86   6e-17
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    87   7e-17
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    87   8e-17
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    85   8e-17
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    87   8e-17
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    86   9e-17
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    86   1e-16
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    87   1e-16
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    86   1e-16
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    86   1e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    86   1e-16
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    86   1e-16
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    86   2e-16
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    86   2e-16
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    86   2e-16
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    86   2e-16
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    86   2e-16
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    86   2e-16
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    86   2e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    84   3e-16
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    85   3e-16
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    84   4e-16
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    85   4e-16
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    84   4e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    84   4e-16
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    82   7e-16
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    84   8e-16
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    84   8e-16
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    83   8e-16
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    84   1e-15
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    83   1e-15
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    83   1e-15
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    83   1e-15
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    83   1e-15
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    83   1e-15
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             82   1e-15
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    83   1e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    82   1e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    82   1e-15
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    83   1e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    83   2e-15
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    83   2e-15
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    83   2e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    82   2e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    81   2e-15
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    82   2e-15
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    81   2e-15
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    82   2e-15
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    82   2e-15
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    82   2e-15
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    82   3e-15
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    82   3e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    81   3e-15
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    82   4e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    80   4e-15
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    81   4e-15
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    81   5e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    80   5e-15
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    81   6e-15
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    81   6e-15
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    81   6e-15
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    81   6e-15
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        80   7e-15
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    81   7e-15
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    79   7e-15
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    80   8e-15
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    80   8e-15
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    80   8e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    79   9e-15
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    80   9e-15
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    80   1e-14
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    80   1e-14
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    80   1e-14
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    80   1e-14
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    80   1e-14
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    80   1e-14
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    80   1e-14
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    80   1e-14
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    79   2e-14
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    80   2e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    79   2e-14
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               79   2e-14
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    79   2e-14
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    77   2e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    79   2e-14
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    79   2e-14
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    79   2e-14
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    79   2e-14
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    79   2e-14
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    79   3e-14
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    79   3e-14
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    78   3e-14
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    77   3e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    79   3e-14
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    79   3e-14
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    79   3e-14
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    78   3e-14
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    78   3e-14
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    78   4e-14
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    78   4e-14
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    78   4e-14
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    78   4e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    78   4e-14
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    78   5e-14
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    78   5e-14
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    78   5e-14
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    78   5e-14
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    78   5e-14
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    78   5e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    78   5e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    77   6e-14
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    77   7e-14
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    77   7e-14
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    77   7e-14
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    77   7e-14
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    77   7e-14
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    77   7e-14
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    77   7e-14
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    77   7e-14
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    77   8e-14
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    77   8e-14
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    76   8e-14
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    77   8e-14
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    76   8e-14
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    77   8e-14
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    77   8e-14
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    77   8e-14
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    77   8e-14
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     77   9e-14
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    77   9e-14
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    77   9e-14
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    77   1e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    77   1e-13
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    77   1e-13
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    77   1e-13
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    77   1e-13
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    77   1e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    77   1e-13
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    77   1e-13
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    77   1e-13
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    77   1e-13
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    76   1e-13
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    77   1e-13
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    77   1e-13
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    77   1e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    76   1e-13
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    76   1e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    76   1e-13
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    76   2e-13
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    76   2e-13
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    76   2e-13
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    76   2e-13
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    75   2e-13
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    76   2e-13
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    76   2e-13
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    76   2e-13
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    76   2e-13
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    75   2e-13
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    75   2e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       75   2e-13
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    76   2e-13
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    75   3e-13
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    75   3e-13
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    75   3e-13
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    75   3e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    75   3e-13
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    74   3e-13
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     73   3e-13
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    74   3e-13
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    75   3e-13
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    75   3e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    75   3e-13
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    74   3e-13
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    74   3e-13
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    75   4e-13
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    75   4e-13
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    75   4e-13
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    75   4e-13
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    75   4e-13
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    75   4e-13
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    75   4e-13
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    75   5e-13
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    75   5e-13
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      75   5e-13
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    74   5e-13
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    74   6e-13
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    75   6e-13
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    74   6e-13
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    74   7e-13
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    74   7e-13
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    73   7e-13
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    74   7e-13
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    72   7e-13
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    74   7e-13
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    74   8e-13
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    74   8e-13
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    74   8e-13
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    74   8e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    74   8e-13
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    74   9e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    74   9e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    74   9e-13
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     74   9e-13
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    74   1e-12
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    74   1e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    74   1e-12
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    74   1e-12
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    74   1e-12
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    73   1e-12
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    74   1e-12
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    74   1e-12
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    73   1e-12
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    73   1e-12
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    73   1e-12
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    73   1e-12
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    72   1e-12
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    73   2e-12
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    72   2e-12
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    73   2e-12
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    73   2e-12
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    73   2e-12
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    71   2e-12
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    73   2e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    71   2e-12
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    73   2e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    73   2e-12
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    72   2e-12
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    73   2e-12
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    73   2e-12
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    73   2e-12
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    73   2e-12
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    73   2e-12
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    73   2e-12
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    73   2e-12
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    72   2e-12
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    72   2e-12
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    72   2e-12
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     72   2e-12
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    72   2e-12
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    72   2e-12
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    72   2e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    72   3e-12
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    71   3e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    72   3e-12
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    72   3e-12
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    72   3e-12
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    72   3e-12
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    72   3e-12
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     72   3e-12
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    72   3e-12
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    71   3e-12
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    72   3e-12
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    72   3e-12
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    72   3e-12
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    72   4e-12
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    71   4e-12
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    72   4e-12
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    72   4e-12
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    72   4e-12
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    72   4e-12
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    72   4e-12
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    72   4e-12
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    72   4e-12
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    72   4e-12
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    72   4e-12
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    71   4e-12
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    70   4e-12
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    71   4e-12
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    70   5e-12
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    71   5e-12
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    71   5e-12
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    70   5e-12
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    71   5e-12
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    71   5e-12
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    71   5e-12
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    71   6e-12
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    71   6e-12
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    71   6e-12
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    71   6e-12
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    71   7e-12
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    71   7e-12
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    71   7e-12
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    71   7e-12
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    70   7e-12
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    71   7e-12
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    71   7e-12
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    71   7e-12
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    70   8e-12
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    70   8e-12
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    69   9e-12
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    69   9e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    69   1e-11
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    69   1e-11
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    69   1e-11
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    70   1e-11
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    69   1e-11
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    69   2e-11
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    70   2e-11
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    70   2e-11
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    68   2e-11
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    69   2e-11
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    69   2e-11
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    70   2e-11
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    69   2e-11
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    69   2e-11
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    69   2e-11
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    68   2e-11
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    69   2e-11
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    69   2e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    69   2e-11
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    69   2e-11
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    68   2e-11
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       68   2e-11
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    69   2e-11
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    69   2e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    69   2e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    69   2e-11
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    68   2e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    69   2e-11
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    68   2e-11
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    69   3e-11
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    69   3e-11
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    69   3e-11
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    69   3e-11
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    69   3e-11
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    68   3e-11
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    68   3e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    69   3e-11
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               68   3e-11
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    69   4e-11
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    69   4e-11
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    68   4e-11
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    69   4e-11
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    68   4e-11
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    68   5e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    68   5e-11
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    68   5e-11
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    68   5e-11
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    67   5e-11
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    67   5e-11
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    68   6e-11
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    67   6e-11
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    67   6e-11
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    68   6e-11
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    67   6e-11
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    67   6e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    68   6e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    67   6e-11
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    67   7e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     67   7e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    68   7e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    68   7e-11
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    67   7e-11
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    67   7e-11
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    67   8e-11
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    67   8e-11
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    67   8e-11
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    67   8e-11
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    67   8e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     67   8e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              67   9e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    66   9e-11
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    67   9e-11
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    67   1e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    67   1e-10
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    67   1e-10
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    67   1e-10
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    67   1e-10
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    66   1e-10
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    67   1e-10
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    67   1e-10
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    66   1e-10
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    67   1e-10
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    66   1e-10
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    66   1e-10
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               65   1e-10
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    65   2e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    66   2e-10
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    66   2e-10
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    66   2e-10
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    67   2e-10
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    66   2e-10
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    67   2e-10
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    66   2e-10
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    65   2e-10
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    66   2e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    65   2e-10
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    67   2e-10
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    66   2e-10
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    66   2e-10
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    66   2e-10
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    66   2e-10
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    66   2e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    66   2e-10
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    66   2e-10
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    66   2e-10
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    66   2e-10
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    66   2e-10
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    65   2e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    66   2e-10
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    65   2e-10
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    65   2e-10
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    65   2e-10
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              66   2e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    65   2e-10
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    65   3e-10
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    65   3e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    65   3e-10
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    66   3e-10
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    65   3e-10
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    65   3e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    64   3e-10
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    66   3e-10
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    64   3e-10
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    65   3e-10
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              65   3e-10
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    65   4e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    64   4e-10
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    65   4e-10
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     64   4e-10
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    65   4e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    64   4e-10
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    65   4e-10
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    65   4e-10
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    65   4e-10
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               65   4e-10
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    65   4e-10
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    64   4e-10
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    65   5e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    64   5e-10
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    64   5e-10
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    65   5e-10
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    65   5e-10
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    65   6e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    64   6e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    64   6e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    64   6e-10
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    63   6e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    64   6e-10
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    64   7e-10
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    64   7e-10
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    64   7e-10
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    64   7e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    64   7e-10
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    64   7e-10
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    64   7e-10
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    64   7e-10
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    63   7e-10
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    64   8e-10
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    63   8e-10
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    64   8e-10
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    64   8e-10
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    64   9e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    64   9e-10
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    63   9e-10
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    63   9e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    64   9e-10
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    64   9e-10
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    64   9e-10
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    64   9e-10
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    64   9e-10
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    63   9e-10
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               64   9e-10
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    64   1e-09
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    64   1e-09
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    63   1e-09
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    63   1e-09
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    63   1e-09
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    64   1e-09
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    64   1e-09
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               63   1e-09
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     64   1e-09
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    64   1e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    64   1e-09
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    64   1e-09
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    64   1e-09
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    62   1e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    62   1e-09
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    63   1e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    62   1e-09
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     63   1e-09
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    63   1e-09
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    63   1e-09
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    63   1e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    63   1e-09
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    62   2e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    63   2e-09
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    62   2e-09
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    63   2e-09
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    63   2e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    62   2e-09
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    63   2e-09
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    63   2e-09
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    63   2e-09
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    62   2e-09
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    63   2e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    63   2e-09
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    63   2e-09
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    62   2e-09
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    63   2e-09
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    63   2e-09
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    63   2e-09
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    62   2e-09
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    62   2e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    63   2e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    62   2e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    63   2e-09
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    62   2e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    62   2e-09
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    63   2e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    62   2e-09
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    62   2e-09
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     62   2e-09
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    63   2e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    62   2e-09
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    62   2e-09
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    62   2e-09
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    62   3e-09
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    62   3e-09
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    62   3e-09
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    62   3e-09
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    62   3e-09
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    62   3e-09
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    62   3e-09
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    62   3e-09
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    62   3e-09
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    62   3e-09
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    61   3e-09
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              62   3e-09
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    61   3e-09
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    62   3e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    62   3e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               62   3e-09
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    62   3e-09
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    62   3e-09
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    62   3e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    62   3e-09
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    62   3e-09
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    62   3e-09
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    62   3e-09
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    62   3e-09
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    62   3e-09
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    62   4e-09
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    62   4e-09
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    62   4e-09
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    62   4e-09
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    62   4e-09
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    62   4e-09
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    62   4e-09
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    62   4e-09
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    61   4e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               62   4e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     61   4e-09
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    61   4e-09
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    62   4e-09
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    62   5e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    61   5e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    61   5e-09
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    61   5e-09
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    60   5e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    62   5e-09
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    61   5e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    61   5e-09
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    62   5e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    61   6e-09
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    62   6e-09
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    62   6e-09
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               60   6e-09
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    62   6e-09
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    61   6e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    61   6e-09
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    60   6e-09
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    60   7e-09
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    61   7e-09
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    61   7e-09
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    61   7e-09
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    61   7e-09
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    60   7e-09
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    60   7e-09
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    61   7e-09
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    61   7e-09
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    61   7e-09
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    61   8e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    60   8e-09
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    60   8e-09
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    60   8e-09
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    61   8e-09
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    60   8e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    60   8e-09
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    61   9e-09
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    60   9e-09
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    61   9e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    60   9e-09
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    61   9e-09
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    60   9e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    60   1e-08
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    60   1e-08
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    60   1e-08
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    60   1e-08
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    60   1e-08
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    60   1e-08
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    60   1e-08
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    60   1e-08
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    60   1e-08
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    60   1e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    60   1e-08
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    60   1e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    59   1e-08
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    60   1e-08
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    60   1e-08
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    60   1e-08
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    60   1e-08
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    60   1e-08
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    60   1e-08
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    60   1e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    60   1e-08
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    59   2e-08
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    60   2e-08
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    60   2e-08
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    60   2e-08
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    59   2e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    59   2e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    59   2e-08
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    60   2e-08
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    60   2e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   2e-08
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    60   2e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    60   2e-08
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    60   2e-08
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    60   2e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    60   2e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    59   2e-08
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    59   2e-08
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    60   2e-08
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    59   2e-08
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    59   2e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    59   2e-08
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    59   2e-08
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    59   2e-08
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    59   2e-08
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    59   2e-08
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    59   2e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    60   2e-08
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    60   2e-08
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    59   2e-08
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    59   2e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    60   2e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    59   2e-08
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    59   2e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    59   2e-08
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    59   3e-08
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    59   3e-08
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    59   3e-08
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    59   3e-08
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    59   3e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    59   3e-08
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    59   3e-08
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    59   3e-08
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    59   3e-08
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     59   3e-08
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     59   3e-08
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    59   3e-08
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    59   3e-08
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    59   3e-08
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    59   3e-08
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    59   3e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    59   3e-08
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    59   3e-08
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    59   3e-08
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    59   3e-08
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    58   4e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    59   4e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    59   4e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    57   4e-08
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    59   4e-08
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    59   4e-08
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    59   4e-08
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    59   4e-08
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    58   4e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    59   4e-08
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    59   4e-08
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    58   4e-08
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    59   4e-08
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    58   4e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    57   4e-08
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    59   4e-08
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    59   4e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    57   4e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    59   4e-08
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    58   5e-08
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    59   5e-08
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    58   5e-08
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    59   5e-08
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    58   5e-08
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    58   5e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    59   5e-08
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    58   5e-08
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    58   5e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    58   5e-08
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    58   5e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    58   5e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    58   5e-08
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    58   5e-08
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    58   6e-08
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    58   6e-08
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     57   6e-08
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    58   6e-08
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    58   6e-08
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    58   6e-08
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    58   6e-08
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    58   6e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    57   6e-08
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              58   7e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    58   7e-08
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    58   7e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    58   7e-08
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    58   7e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    57   7e-08
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    58   7e-08
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    58   7e-08
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    57   8e-08
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    57   8e-08
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    57   8e-08
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    57   8e-08
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    57   8e-08
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    58   8e-08
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    57   8e-08
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    57   8e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    57   9e-08
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    57   9e-08
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    58   9e-08
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    57   9e-08
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    57   9e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    57   1e-07
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    57   1e-07
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    57   1e-07
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    57   1e-07
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    57   1e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    56   1e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    57   1e-07
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    56   1e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    56   1e-07
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    57   1e-07
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    57   1e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    57   1e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    57   1e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    56   1e-07
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              55   1e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    57   1e-07
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    57   1e-07
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    57   1e-07
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    57   1e-07
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    57   1e-07
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    57   1e-07
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    56   1e-07
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    57   1e-07
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    57   1e-07
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    57   2e-07
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    56   2e-07
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    57   2e-07
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    57   2e-07
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    57   2e-07
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    57   2e-07
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    56   2e-07
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    57   2e-07
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    57   2e-07
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    56   2e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    57   2e-07
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    57   2e-07
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    57   2e-07
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    56   2e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    55   2e-07
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    56   2e-07
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    56   2e-07
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    56   2e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    56   2e-07
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    56   2e-07
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    56   2e-07
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    56   2e-07
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    56   2e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    56   2e-07
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    56   2e-07
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    56   2e-07
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    56   2e-07
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    56   2e-07
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    56   2e-07
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    56   2e-07
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    56   2e-07
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    55   3e-07
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    56   3e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    55   3e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    55   3e-07
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    55   3e-07
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    56   3e-07
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     55   3e-07
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    55   3e-07
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    56   3e-07
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    55   3e-07
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    55   3e-07
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    56   3e-07
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    56   3e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    54   3e-07
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    56   3e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    54   3e-07
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    56   3e-07
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    55   3e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    55   3e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    55   3e-07
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    55   3e-07
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    55   3e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    55   3e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    55   3e-07
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    55   4e-07
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    55   4e-07
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    55   4e-07
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    56   4e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    55   4e-07
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    55   4e-07
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    55   4e-07
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    55   4e-07
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    56   4e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    53   4e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    55   4e-07
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    55   4e-07
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    55   4e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    55   4e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    54   4e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    55   4e-07
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    55   4e-07
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    54   4e-07
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    55   4e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    55   4e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    55   4e-07
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    55   4e-07
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    55   4e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    55   4e-07
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    55   5e-07
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    55   5e-07
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    55   5e-07
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    55   5e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    55   5e-07
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    55   5e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    55   5e-07
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    54   5e-07
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    55   5e-07
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     55   5e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    54   6e-07
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     55   6e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   6e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    54   6e-07
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    54   6e-07
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    55   6e-07
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    55   6e-07
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    55   7e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    55   7e-07
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    55   7e-07
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    54   7e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    54   7e-07
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    54   7e-07
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    54   7e-07
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    55   7e-07
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    54   7e-07
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    54   8e-07
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    54   8e-07
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    54   8e-07
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    54   8e-07
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    54   8e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              54   8e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    54   9e-07
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    54   9e-07
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    54   1e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    54   1e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    54   1e-06
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    54   1e-06
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    54   1e-06
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    54   1e-06
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    54   1e-06
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              54   1e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    54   1e-06
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    54   1e-06
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    53   1e-06
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    54   1e-06
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    54   1e-06
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    54   1e-06
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    54   1e-06
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    54   1e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    54   1e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    53   1e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    54   1e-06
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    54   1e-06
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    53   2e-06
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    53   2e-06
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    54   2e-06
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    53   2e-06
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    54   2e-06
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    52   2e-06
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    54   2e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    54   2e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    53   2e-06
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    52   2e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    53   2e-06
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    53   2e-06
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    53   2e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    53   2e-06
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    53   2e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     53   2e-06
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    53   2e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    53   2e-06
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    53   2e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    53   2e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    53   2e-06
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    53   2e-06
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    53   2e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    53   2e-06
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    52   2e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    52   2e-06
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    53   2e-06
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    53   2e-06
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    53   2e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    53   2e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    53   2e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    53   2e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    53   2e-06
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    52   2e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    53   2e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    53   2e-06
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    53   2e-06
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    52   2e-06
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    53   2e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    53   2e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    53   2e-06
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    52   2e-06
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    52   2e-06
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    53   3e-06
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    53   3e-06
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    52   3e-06
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    52   3e-06
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    52   3e-06
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    53   3e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               52   3e-06
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    52   3e-06
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             53   3e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    53   3e-06
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    52   3e-06
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    52   3e-06
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    52   3e-06
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    52   3e-06
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    52   3e-06
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    52   3e-06
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    52   4e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    52   4e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    52   4e-06
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    52   4e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    52   4e-06
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    52   4e-06
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    52   4e-06
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    52   4e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    52   4e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    52   4e-06
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    52   4e-06
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              52   4e-06
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    52   4e-06
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    51   4e-06
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    52   4e-06
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    52   4e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              52   4e-06
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    52   4e-06
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    52   4e-06
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    52   4e-06
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    52   4e-06
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    52   4e-06
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    52   4e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    52   4e-06
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    51   4e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    52   5e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    52   5e-06
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    52   5e-06
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    52   5e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    52   5e-06
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    52   5e-06
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    51   5e-06
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    52   5e-06
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    52   5e-06
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    52   5e-06
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    52   5e-06
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    51   5e-06
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    52   5e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    52   5e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    52   5e-06
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    52   5e-06
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    51   5e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    52   5e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    52   5e-06
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    52   5e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    52   5e-06
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    51   5e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    52   5e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    52   6e-06
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    52   6e-06
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    52   6e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    52   6e-06
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    51   6e-06
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    51   6e-06
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    51   6e-06
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    51   6e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    52   6e-06
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    50   6e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    52   6e-06
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    51   6e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    52   6e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    50   6e-06
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    51   6e-06
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    50   7e-06
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    51   7e-06
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    51   7e-06
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    51   7e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    51   7e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    51   7e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    51   7e-06
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    50   7e-06
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    51   7e-06
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    51   7e-06
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    51   7e-06
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    51   8e-06
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     51   8e-06
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    51   8e-06
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    50   8e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    51   8e-06
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    51   8e-06
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    51   8e-06
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    51   8e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    51   8e-06
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    51   9e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    51   9e-06
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    50   9e-06
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               51   9e-06
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    50   9e-06
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    50   9e-06
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    51   9e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    51   9e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    51   9e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    51   9e-06
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    51   9e-06
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    51   1e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    51   1e-05
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    51   1e-05
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     51   1e-05
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    51   1e-05
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    50   1e-05
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    51   1e-05
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     50   1e-05
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    50   1e-05
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    51   1e-05
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       51   1e-05
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    50   1e-05
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    50   1e-05
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    49   1e-05
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    50   1e-05
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    51   1e-05
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    50   1e-05
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    50   1e-05
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    50   1e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    50   1e-05
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    50   1e-05
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    50   1e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    50   1e-05
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    50   1e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    50   1e-05
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    50   1e-05
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    50   1e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    50   1e-05
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              50   1e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    50   1e-05
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    49   1e-05
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    50   1e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    50   1e-05
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    50   2e-05
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    50   2e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    50   2e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    50   2e-05
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    50   2e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    50   2e-05
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    50   2e-05
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    49   2e-05
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    49   2e-05
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    50   2e-05
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    50   2e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    50   2e-05
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    50   2e-05
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    50   2e-05
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    50   2e-05
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    49   2e-05
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    50   2e-05
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    50   2e-05
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    50   2e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    50   2e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    50   2e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    50   2e-05
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               50   2e-05
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    49   2e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    50   2e-05
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    50   2e-05
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    49   2e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    50   2e-05
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    50   2e-05
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    50   2e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    50   2e-05
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    49   2e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    50   2e-05
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    49   2e-05
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    49   2e-05
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    50   2e-05
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    50   2e-05
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    49   2e-05
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    49   2e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    49   2e-05
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    50   2e-05
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    49   2e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    49   3e-05
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    49   3e-05
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    49   3e-05
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    49   3e-05
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    49   3e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    49   3e-05
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    49   3e-05
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    49   3e-05
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    49   3e-05
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    49   3e-05
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    49   3e-05
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    49   3e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    49   3e-05
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    49   3e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    49   3e-05
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    49   3e-05
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    49   3e-05
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    49   3e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    49   3e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    49   3e-05
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    49   3e-05
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    49   3e-05
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    49   3e-05
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    49   3e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    49   3e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    49   3e-05
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    49   3e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     49   3e-05
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    49   4e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    49   4e-05
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    49   4e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    49   4e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    49   4e-05
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    49   4e-05
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    49   4e-05
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    49   4e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    49   4e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    49   4e-05
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    49   4e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    49   4e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    49   4e-05
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    48   4e-05
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    49   4e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    49   4e-05
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      49   5e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    48   5e-05
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    49   5e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    49   5e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    49   5e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    49   5e-05
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    49   5e-05
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    49   5e-05
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    49   5e-05
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    48   5e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    49   5e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    48   5e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    49   5e-05
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    48   6e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    48   6e-05
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    48   6e-05
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    48   6e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    48   6e-05
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    48   6e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    48   6e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    48   6e-05
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    48   6e-05
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    48   6e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    47   6e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    48   6e-05
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    48   7e-05
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    48   7e-05
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      48   7e-05
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    48   7e-05
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    47   7e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    48   7e-05
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    48   7e-05
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    47   7e-05
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    45   7e-05
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    47   7e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     47   7e-05
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    47   7e-05
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    48   7e-05
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     47   7e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    48   8e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    48   8e-05
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    47   8e-05
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    47   8e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    48   8e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    48   8e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    47   8e-05
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    48   9e-05
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    48   9e-05
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    48   9e-05
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    48   9e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    47   9e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    47   9e-05
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    48   9e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    48   1e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    48   1e-04
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    48   1e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               48   1e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    47   1e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    47   1e-04
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    47   1e-04
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    47   1e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    47   1e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    47   1e-04
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    47   1e-04
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    47   1e-04
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    47   1e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    47   1e-04
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    47   1e-04
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    47   1e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    47   1e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    47   1e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    47   1e-04
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    47   1e-04
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    47   1e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    47   1e-04
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    47   1e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    47   1e-04
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    47   1e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    47   1e-04
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    47   1e-04
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    47   1e-04
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    47   1e-04
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    46   1e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    47   1e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    47   1e-04
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    47   1e-04
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    47   2e-04
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    47   2e-04
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    47   2e-04
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    46   2e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    47   2e-04
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    47   2e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    47   2e-04
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    47   2e-04
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    47   2e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    47   2e-04
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    46   2e-04
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    46   2e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    47   2e-04
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    47   2e-04
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     47   2e-04
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    46   2e-04
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    47   2e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    47   2e-04
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    47   2e-04
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    47   2e-04
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    47   2e-04
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    46   2e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    47   2e-04
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    47   2e-04
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    46   2e-04
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    47   2e-04
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    46   2e-04
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    47   2e-04
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    46   2e-04
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    46   2e-04
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    47   2e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    46   2e-04
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    47   2e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    46   2e-04
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    46   2e-04
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    46   2e-04
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    46   2e-04
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     46   3e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    46   3e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    46   3e-04
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    46   3e-04
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    46   3e-04
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    46   3e-04
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    46   3e-04
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    46   3e-04
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       46   3e-04
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    46   3e-04
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    46   3e-04
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    46   3e-04
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    45   3e-04
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    45   3e-04
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    46   3e-04
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    46   3e-04
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    46   3e-04
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    46   3e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    46   3e-04
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    45   3e-04
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    45   3e-04
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    45   3e-04
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    45   4e-04
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    45   4e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    45   4e-04
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    45   4e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    45   4e-04
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    45   4e-04
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    45   4e-04
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    45   4e-04
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    45   4e-04
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    45   5e-04
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    45   5e-04
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    45   5e-04
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    45   5e-04
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    45   5e-04
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    45   5e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    45   5e-04
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    45   5e-04
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    45   5e-04
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    45   5e-04
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    45   5e-04
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    45   5e-04
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    45   5e-04
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    45   6e-04
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    45   6e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    45   6e-04
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    45   6e-04
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    45   6e-04
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    45   6e-04
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    45   6e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    44   7e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    45   7e-04
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    44   7e-04
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    45   7e-04
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    45   7e-04
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    45   7e-04
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    45   7e-04
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    44   7e-04
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    45   8e-04
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    45   8e-04
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      45   8e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   8e-04
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    44   8e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    45   8e-04
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    44   8e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    44   8e-04
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    44   8e-04
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 44   8e-04
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    44   8e-04
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    44   8e-04
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    45   9e-04
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    44   9e-04
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    44   9e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    44   0.001
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    44   0.001
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    44   0.001
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    44   0.001
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    44   0.001
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    44   0.001
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    44   0.001
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    44   0.001
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    44   0.001
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    44   0.001
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    44   0.001
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    44   0.001
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    44   0.001
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    44   0.001
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    44   0.001
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    44   0.001
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    44   0.001
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    44   0.001
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    44   0.001
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    44   0.001
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    43   0.001
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    44   0.001
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    44   0.001
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    44   0.001
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    44   0.001
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    44   0.001
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    44   0.001
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    43   0.001
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    44   0.002
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    43   0.002
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    44   0.002
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    43   0.002
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    43   0.002
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    43   0.002
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    44   0.002
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    44   0.002
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    43   0.002
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    43   0.002
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    44   0.002
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    44   0.002
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    44   0.002
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    43   0.002
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    43   0.002
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    43   0.002
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    44   0.002
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    43   0.002
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    43   0.002
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    43   0.002
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    43   0.002
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    43   0.002
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    43   0.002
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    43   0.002
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    42   0.002
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    43   0.002
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    43   0.002
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    43   0.002
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    43   0.003
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    43   0.003
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    43   0.003
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    43   0.003
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    43   0.003
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    43   0.003
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    43   0.003
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    42   0.003
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    43   0.003
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    43   0.003
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    42   0.003
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    43   0.003
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    43   0.003
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    42   0.003
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    42   0.003
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    42   0.003
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    42   0.004
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    42   0.004
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    42   0.004
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    42   0.004
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    42   0.004
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    42   0.005
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    42   0.005
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    42   0.005
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    42   0.005
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    42   0.005
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    42   0.005
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    41   0.006
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    42   0.006
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    42   0.006
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    42   0.006
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    41   0.006
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    42   0.006
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    41   0.006
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    42   0.006
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    42   0.006
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    41   0.007
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    41   0.007
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    42   0.007
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               41   0.007
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    42   0.008
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    41   0.008
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    41   0.008
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     41   0.008
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    41   0.008
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    41   0.008
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    41   0.008
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    41   0.008
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    41   0.008
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    40   0.009
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    41   0.009
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    41   0.010
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    40   0.010
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    41   0.010
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    40   0.010
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    41   0.011
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    40   0.012
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    41   0.012
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    40   0.012
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    40   0.012
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    40   0.013
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    41   0.014
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    40   0.014
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    40   0.014
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    40   0.015
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    40   0.016
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    40   0.016
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    40   0.016
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    40   0.017
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    40   0.017
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    40   0.018
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    40   0.019
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    40   0.019
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    40   0.021
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    39   0.022
TPHA0J01160 Chr10 (268613..269905) [1293 bp, 430 aa] {ON} Anc_3....    40   0.025
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    39   0.028
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    39   0.029
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    39   0.029
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    39   0.032
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    39   0.032
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    39   0.033
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    39   0.034
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    39   0.034
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    39   0.036
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    39   0.037
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    39   0.037
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    39   0.038
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    39   0.043
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    39   0.047
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               39   0.047
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    39   0.050
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    39   0.050
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    39   0.051
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    39   0.053
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    39   0.054
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    39   0.054
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    39   0.055
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    38   0.056
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    39   0.056
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    38   0.057
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    38   0.061
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    39   0.062
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    38   0.062
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    38   0.065
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    38   0.065
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    38   0.067
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    39   0.070
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    37   0.071
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    38   0.074
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    38   0.077
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    38   0.077
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    38   0.078
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               38   0.080
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    38   0.081
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    38   0.081
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    38   0.082
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    38   0.085
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    38   0.086
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    38   0.089
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    38   0.094
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    38   0.094
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    38   0.097
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.098
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    37   0.100
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    38   0.100
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    38   0.10 
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    38   0.10 
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    38   0.10 
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    38   0.11 
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    38   0.12 
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    38   0.12 
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    37   0.12 
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    37   0.12 
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    37   0.12 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    37   0.13 
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    37   0.14 
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    37   0.14 
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    37   0.15 
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    37   0.16 
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    37   0.17 
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    37   0.18 
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    37   0.18 
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    37   0.18 
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    37   0.18 
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    37   0.19 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    37   0.20 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    37   0.21 
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    37   0.21 
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    37   0.21 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    37   0.21 
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      37   0.22 
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    37   0.22 
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    37   0.23 
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    37   0.23 
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    37   0.23 
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    37   0.23 
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    37   0.24 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    36   0.25 
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    36   0.26 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    37   0.27 
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    36   0.28 
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    37   0.28 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    36   0.30 
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    36   0.31 
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    36   0.32 
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     36   0.32 
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    36   0.32 
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    36   0.33 
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    36   0.33 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    36   0.34 
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    36   0.35 
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    36   0.35 
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    35   0.36 
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    36   0.36 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    35   0.43 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    35   0.44 
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    36   0.47 
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    35   0.52 
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    35   0.53 
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    35   0.58 
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    35   0.58 
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    35   0.61 
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    35   0.62 
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    35   0.66 
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    35   0.73 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    35   0.73 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               35   0.73 
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    35   0.83 
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    35   0.84 
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    35   0.85 
ZYRO0C08844g Chr3 complement(670280..672112) [1833 bp, 610 aa] {...    35   0.85 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    35   0.94 
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    35   1.0  
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    35   1.1  
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    34   1.1  
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      34   1.2  
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    34   1.2  
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    34   1.2  
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    34   1.3  
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    34   1.3  
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    34   1.3  
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    34   1.3  
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    34   1.4  
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    34   1.4  
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    34   1.4  
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    34   1.4  
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    34   1.4  
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    34   1.4  
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    34   1.4  
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    34   1.5  
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    34   1.5  
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    33   1.5  
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    34   1.6  
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               33   1.7  
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    34   1.8  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    34   1.9  
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    33   1.9  
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    33   2.1  
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    33   2.1  
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    33   2.3  
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    33   2.3  
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    33   2.4  
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    33   2.5  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    33   2.6  
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    33   2.6  
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    33   2.7  
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    33   2.8  
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    33   2.9  
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    33   2.9  
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    33   3.2  
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    33   3.2  
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    33   3.2  
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    33   3.4  
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    33   3.6  
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    33   3.7  
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    33   3.7  
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    33   4.0  
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    32   4.2  
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     32   4.4  
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    32   4.4  
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    32   4.6  
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    32   5.6  
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    32   5.9  
NCAS0C04510 Chr3 (923888..925393) [1506 bp, 501 aa] {ON} Anc_3.34      32   7.4  
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    32   7.7  

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score = 1363 bits (3527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/688 (96%), Positives = 663/688 (96%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 NVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQADNLSNPMIKPMPIAQRPTFSG 360
           NVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQADNLSNPMIKPMPIAQRPTFSG
Sbjct: 301 NVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQADNLSNPMIKPMPIAQRPTFSG 360

Query: 361 NGMVNNNRTLPTVMVSNNVIGNGSQVWDNSKPPEPQPIPQSRSFVKSSTLIGAPLSKSWG 420
           NGMVNNNRTLPTVMVSNNVIGNGSQVWDNSKPPEPQPIPQSRSFVKSSTLIGAPLSKSWG
Sbjct: 361 NGMVNNNRTLPTVMVSNNVIGNGSQVWDNSKPPEPQPIPQSRSFVKSSTLIGAPLSKSWG 420

Query: 421 HNEFNFGSISNSPSVFQGAIVPAANQLQNKDSSHQPKPSGMMKKNEQLQVTSTFASSPNT 480
           HNEFNFGSISNSPSVFQGAIVPAANQLQNKDSSHQPKPSGMMKKNEQLQVTSTFASSPNT
Sbjct: 421 HNEFNFGSISNSPSVFQGAIVPAANQLQNKDSSHQPKPSGMMKKNEQLQVTSTFASSPNT 480

Query: 481 RTRTNSQGSSLYIPTSSEYRTRHVHTGDNNXXXXXXXXXXXXXIAVQRSPSSRSDGSDFR 540
           RTRTNSQGSSLYIPTSSEYRTRHVHTGDNN             IAVQRSPSSRSDGSDFR
Sbjct: 481 RTRTNSQGSSLYIPTSSEYRTRHVHTGDNNSLKSSKLDSDKLDIAVQRSPSSRSDGSDFR 540

Query: 541 LPLNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDELSSTGTNIPKVTPDSPVL 600
           LPLNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDELSSTGTNIPKVTPDSPVL
Sbjct: 541 LPLNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDELSSTGTNIPKVTPDSPVL 600

Query: 601 ADLIDFNDVPTIRIPSDKNQLSKSGXXXXXXXXXXXXLRSNKKISTLSALRLEPKQNDRI 660
           ADLIDFNDVPTIRIPSDKNQLSKSG            LRSNKKISTLSALRLEPKQNDRI
Sbjct: 601 ADLIDFNDVPTIRIPSDKNQLSKSGKIKPAPPPKPKKLRSNKKISTLSALRLEPKQNDRI 660

Query: 661 TSDATDVLMHLNVDDLEEDFKRRFPSAV 688
           TSDATDVLMHLNVDDLEEDFKRRFPSAV
Sbjct: 661 TSDATDVLMHLNVDDLEEDFKRRFPSAV 688

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  523 bits (1346), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 260/384 (67%), Positives = 294/384 (76%), Gaps = 15/384 (3%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MN P++     GT LTVG+H  KI+KYLTSGGFAQ+Y+ EI     ++ +N+ACLKRV V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK  LN LRAEVDAMKLL NNKHVVSYIDSHA +S  N   YEVF+LMEYCE GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRL+NRL E EILDIM QT QGIA MHAL PPL+HRDIKIENVL+S  G+YKVCDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSGVIRPP+N QE  YVQHDI+ NTTAQYR PEM+DLYRGLPIDEK+DIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AILHAR+Q+PSFP YSDRLKNLI+ ML E PS RPN+CQVLEEVSR+Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 NVPCPIRNFYLLRAMEKVKL----STEIDY-PQLQL---QKLRNAQADNLSNPMIKPMP- 351
           N PCPIRNFYLLRAM +       ST + Y P  QL   Q  +N QA     P I P+  
Sbjct: 300 NRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQA----MPNIVPLSN 355

Query: 352 IAQRPTF-SGNGMVNNNRTLPTVM 374
           I   P   S +  VNNN  +  ++
Sbjct: 356 IKTTPNLDSASNFVNNNNKMEAML 379

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 86/162 (53%), Gaps = 11/162 (6%)

Query: 530 PSSRSDGSDFRLPLNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDELSSTGTN 589
           PS +S  SD    +N + EK++SIQ RV +LL+N   +   KSA GYGKYTD   +  TN
Sbjct: 652 PSLKSSNSD----INIDQEKKESIQRRVHNLLNNSEDSLSYKSASGYGKYTD-TEAESTN 706

Query: 590 IPKVTPDSPVLADLIDFNDVPTIRIPSDKNQLSKSGXXXXXXXXXXXXLRSNKKI-STLS 648
                  +P+  +   FN+  +    +D    SK              L    KI +T  
Sbjct: 707 RQSSVRITPITEE--RFNNYHSSNTMNDHTS-SKDKPKSRPPRPPPKPLHLRTKIHNTRC 763

Query: 649 ALRLEPKQ--NDRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
           +  L+ ++   +RI+S+AT+ ++ +NVD+LE DF++RFPS V
Sbjct: 764 SSNLQSRKPPMERISSEATETIVDVNVDELEADFRKRFPSKV 805

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  517 bits (1331), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 242/316 (76%), Positives = 266/316 (84%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQPE+   N GT LTVG+H  K++ YLTSGGFAQ+Y+ EI     F  SNVACLKRV V
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAMKLL NNKHVVSYIDSHA +S   +G+YEVFLLMEYC GGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQ TQGIA MHAL PPL+HRDIKIENVL+S  G YKVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V GVIRPP+N QE  YVQHD++KNTTAQYR PEM+DLYRG PIDEK+DIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AILH+RFQFP+ P YSDRLK LI+ ML E+P  RPNVCQVLE+VSRMQ
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 NVPCPIRNFYLLRAME 316
            + CP+RNFYLLRAME
Sbjct: 301 GIQCPVRNFYLLRAME 316

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  515 bits (1326), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 239/317 (75%), Positives = 264/317 (83%), Gaps = 1/317 (0%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MN P++     GT LTVG+H  KI+KYLTSGGFAQ+Y  EI     ++ +N+ACLKRV V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           P K  LN LRAEVDAMKLL NNKHVVSYIDSHA RS  N   YEVF+LME+CE GGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQT QGI  MHAL PPL+HRDIKIENVL+S  G+YKVCDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSGVIRPPRN QE  YVQHDI+ NTTAQYR PEM+DLYRGLPIDEK+DIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE  ILHAR+Q+PSFP YSDRLKNLI+ ML E PS RPN+CQVLEEVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 NVPCPIRNFYLLRAMEK 317
           N PCPIRNFYLLRAM +
Sbjct: 300 NKPCPIRNFYLLRAMNQ 316

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 81/150 (54%), Gaps = 9/150 (6%)

Query: 543 LNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTD---ELSSTGTNIPKVTPDSPV 599
           +N N EK++SIQ RV +LL +       KSA GYGKYTD   E S+  +++ ++TP +  
Sbjct: 666 VNINQEKKESIQRRVHNLLKSSDDPVTYKSASGYGKYTDIGTETSNRHSSV-RITPITEE 724

Query: 600 LADLIDFNDVPTIRIPSDKNQLSKSGXXXXXXXXXXXXLRSN-KKISTLSALRLEPKQND 658
                  + V  I+  S+     K              LR+  +KI   S L+ +    +
Sbjct: 725 KFKKTLKDGVLDIKTKSN----GKDKSRPPRPPPKPLHLRTEIQKIRNFSRLQSKKLPIE 780

Query: 659 RITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
           RI+S+AT+ ++ +NVDDLE DF++RFPS V
Sbjct: 781 RISSEATETIVDVNVDDLEADFRKRFPSKV 810

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  514 bits (1323), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 248/379 (65%), Positives = 290/379 (76%), Gaps = 13/379 (3%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP       GT LTVG+H  +I+KYLTSGGFA IY+ EI      +  NVACLKRV V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN+LRAEVDAMKLL  NKHVVSYIDSHA +S   DG+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRLTE E+L IMS  TQGIA MHAL+PPL+HRDIKIENVL+S    +KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V GVIRPP+N QE  YVQ+DI+KNTTAQYR PEM+DLYRG PI+EK+DIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK+G+ AILH+RFQFP++P YSDRLKNLI  ML E+P+ RPN+CQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPIRNFYLLRAM---EKVKLSTEIDYPQLQL-QKLRNAQADNLSNPMIKPMPIAQRP 356
           NVPCP+RNFYLLR+M   ++     +  +P +++   L   + D  + P++ P   AQ  
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQSS 360

Query: 357 ------TFSG---NGMVNN 366
                 TF G   NG +NN
Sbjct: 361 ALRTSKTFDGAAMNGSINN 379

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 78/165 (47%), Gaps = 34/165 (20%)

Query: 543 LNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTD----ELSSTGTNIPKVTPDSP 598
           L+ +S+ R SIQ RVQ+LL +   + VKKSA GYG+ ++    E     T  P V    P
Sbjct: 642 LSGSSDARSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKEDKESPEQFTGKPAVAEARP 701

Query: 599 VLADL---------IDFNDVPTIRIPSDKNQLSKSGXXXXXXXXXXXX------LRSNKK 643
           +   +         ++F+ +    +P+ KN  +K                    L++++ 
Sbjct: 702 IKRTVVPPPKRYSSVEFSSI----VPTAKNTTAKDIEQPIRVHHKPKRPTKPPHLKADRI 757

Query: 644 ISTLSALRLEPKQNDRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
           I   S+      +N R +SD       L +++LE+DF+RRFPSAV
Sbjct: 758 IKHGSST----TENPRHSSD-------LEIEELEKDFQRRFPSAV 791

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  511 bits (1316), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 249/356 (69%), Positives = 286/356 (80%), Gaps = 10/356 (2%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP +     GT LTVGTH   I KYLTSGGFAQIYAVEI  +  ++ SNVACLKRV V
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           P K  LN LRAEVDAMKLL NN+HVVSYIDS+A +S  N+G+YEV LLMEYCEGGGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MN+RLQNRL+E EIL+I+SQT QG+A MHAL P LLHRDIKIENVL S  G +K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V G IRPPRNQQEL YVQHDI+KNTTAQYRCPEMLDLYRGLPIDEK+DIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AILH++FQ+P+FP YSDRLKNLI+ ML E+P+ RPN+C++LEE+S +Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 NVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQ----KLRNAQADNLSNPMIKPMPI 352
            VPCPI+NFYL+RA +   L+ +I   QLQ Q    K+  AQ     N   + MPI
Sbjct: 301 GVPCPIQNFYLIRAQQ---LANQI---QLQRQTTVPKIATAQPIQQLNARTQTMPI 350

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 25/31 (80%)

Query: 658 DRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
           +RI+S AT+ L+ L+VD LE DF++RFPS +
Sbjct: 723 ERISSTATEQLVTLDVDTLERDFRKRFPSTL 753

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  513 bits (1320), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 254/390 (65%), Positives = 292/390 (74%), Gaps = 13/390 (3%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MN P++     GT LTVG+H  KI+KYLTSGGFAQ+Y  EI     +  +N+ACLKRV V
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK  LN LRAEVDAMKLL NNKHVVSYIDSHA +S  N   YEVF+LME+CE GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQT QGIA MHAL PPL+HRDIKIENVL+S  G+YKVCDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSGVIRPPRN QE  YVQHDI+ NTTAQYR PEM+DLYRGLPIDEK+DIWALG+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE  ILHAR+Q+P FP YSDRLKNLI+ ML E PS RPN+CQVLEEVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 NVPCPIRNFYLLRAM-EKVKLSTE---IDYPQLQLQKLRNAQADNLSNPMIKPMPIAQRP 356
             PCPIRNFYLLRAM +  +L++E   + Y  +  QK   AQ      P+   +P++   
Sbjct: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKY--VPTQKFLPAQGLQSMKPISNMIPVSHVR 357

Query: 357 TFSGNGMVNNNRTLPTVMVSNNVIGNGSQV 386
           T        N  TLP  +  NN+     Q+
Sbjct: 358 T------TPNLSTLPRSIDDNNMTDVTKQI 381

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 79/149 (53%), Gaps = 7/149 (4%)

Query: 543 LNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTD---ELSSTGTNIPKVTPDSPV 599
           +N N EK++SIQ RV +LL +       KSA GYGKYTD   E S+  +++ ++TP +  
Sbjct: 664 ININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSV-RITPITEE 722

Query: 600 LADLIDFNDVPTIRIPSDKNQLSKSGXXXXXXXXXXXXLRSNKKISTLSALRLEPKQNDR 659
                + N +   +   +    S+              +   +K+ + S L      ++R
Sbjct: 723 KFKSRNKNGLSNNKTKDNDRHKSRPPRPPPKPLHLRAEI---QKVRSSSRLHSGELSSER 779

Query: 660 ITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
           I+SDAT+ ++ +NVDDLE DF++RFPS V
Sbjct: 780 ISSDATETIVEVNVDDLEADFRKRFPSKV 808

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  494 bits (1272), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 234/321 (72%), Positives = 270/321 (84%), Gaps = 1/321 (0%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP++D  + GT L VG+H V+I+KY+TSGGFAQIY VEI     F  SN+ACLKRV V
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAMKLL NNKHVVSYIDSHA++S  N+G+YEVFLLMEYCE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRLTE E+L I SQ  QGIA MHAL PPLLHRDIKIENVL+SK   YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSG+IRPP N QEL YVQHD++KNTTAQYR PEM+D YRGLPIDEK+DIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEK-LGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRM 299
           YYTTPFEK  GE AIL AR+++P+FP YS+RLK+LI +ML E+P  RPN+ QV+EE+S+M
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QNVPCPIRNFYLLRAMEKVKL 320
           QNVPCPI NFYL+   +K K+
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKM 321

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  506 bits (1304), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 237/324 (73%), Positives = 267/324 (82%), Gaps = 2/324 (0%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MN P++   + GT LTVG+H  KI+KYLTSGGFAQ+Y  EI     ++ +N ACLKRV V
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK  LN LRAEVDAMKLL NNKHVVSYIDSHA +S  N   YEVF+LME+CE GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQ+RL E EIL+IMSQT QGIA MH L PPL+HRDIKIENVL+S  G+YKVCDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSGVIRPPRN QE  YVQHDI+ NTTAQYR PEM+DLYR  PIDEK+DIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AILH+R+Q+PSFP YSDRLK LI  ML E PS RPN+CQVLEEVSR+Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 NVPCPIRNFYLLRAM-EKVKLSTE 323
           N PCPIRNFYLLRAM +  +L++E
Sbjct: 300 NEPCPIRNFYLLRAMGQNAQLASE 323

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 85/160 (53%), Gaps = 13/160 (8%)

Query: 533 RSDGSDFRLPLNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTD---ELSSTGTN 589
           +SD SD    ++     ++SIQ RV +LL+N       KSA GYGKYTD   E S+  ++
Sbjct: 659 KSDSSD----IDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSS 714

Query: 590 IPKVTPDSPVLADLIDFNDVPTIRIPSDKNQLSKSGXXXXXXXXXXXXLRSN-KKISTLS 648
           + ++TP +        + +  T++  + +N   KS             LR+  +     S
Sbjct: 715 V-RITPITE--GKFNKYYNSGTLKGETSRNDKHKS--RPPRPPPKPLHLRTEIQNTRNFS 769

Query: 649 ALRLEPKQNDRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
            L+    Q +RI+S+AT+ ++ +NVDDLE DF++RFPS V
Sbjct: 770 RLQSRQPQMERISSEATETIVDVNVDDLEADFRKRFPSKV 809

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  501 bits (1289), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 236/312 (75%), Positives = 257/312 (82%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP++     GT LTVG+H V+++KYLTSGGFAQIY V+I     F  +NVACLKRV V
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVD MKLL NN HVVSYIDSHA +   N+G+YEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQ RL E EIL+IMSQ TQGIA MHAL PPLLHRDIKIENVLL+  G YKVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V G+IRPP N QE+ YVQHDIMKNTTAQYR PEM+DLYRGLPIDEK+DIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AILHA FQFP++P YSDRLK LI  ML E PS RPN  QVLEEVS MQ
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 NVPCPIRNFYLL 312
           NV CPI NFYL+
Sbjct: 301 NVQCPIPNFYLM 312

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  503 bits (1296), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 234/324 (72%), Positives = 270/324 (83%), Gaps = 1/324 (0%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MN P+++    G  LTVG+H  K++KYLTSGG+AQ+Y VEI     +  SN+ACLKRV V
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAMKLL NN+HVVSYIDSHA++S   +G YEVF+LME+CE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MN+RLQ+RLTE EIL IMS T+QGIA MH L P LLHRDIKIENVL+S+   YKVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V G++RPP+NQQE  +V HDIMKNTTAQYR PEMLDL +GLPI+EK+DIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEK-LGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRM 299
           YYTTPFEK  GE AIL ARFQ+PS+P YSDRLKNLI+ ML ++PSDRPNVCQVLEEVSR+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QNVPCPIRNFYLLRAMEKVKLSTE 323
           Q +PCPIRNFYLLRAME  K + E
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIE 324

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 75/151 (49%), Gaps = 28/151 (18%)

Query: 546 NSEKRKSIQLRVQHLLDNMSSNEVK--KSAQGYGKYTD------ELSSTGTNIPKVTPDS 597
           N E + SIQ RVQ LL N   N     ++A GYGKYTD      E+S T + + +    +
Sbjct: 649 NREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQFNQST 708

Query: 598 PVLADLIDFNDVPTIRIPSDKNQLSKSGXXXXXXXXXXXXLRSNKKISTLSALRLEPKQN 657
             LA L      P +  P  ++ L  +                  K + LS+    P  +
Sbjct: 709 AALASLSGKRKKPPV--PYKRDSLKPTPPA---------------KPAFLSS---RPVAS 748

Query: 658 DRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
            R++S+ATD+L+ L+VDD+E+D +RRFPS V
Sbjct: 749 SRVSSNATDMLVDLSVDDIEKDIRRRFPSTV 779

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  503 bits (1295), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 256/442 (57%), Positives = 307/442 (69%), Gaps = 39/442 (8%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQ   D    GT+LTVG+H  +I+KYLTSGGFA IY  EI    L + + +ACLKRV V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN+LRAEVDAMKLL  N+HVVSYIDSHA +S  +DG+YEVFLLMEYC GGGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E E+L I S  TQGIA MHAL PPL+HRDIKIENVL+S    +KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V GVIRPP+N QE  YVQHDI+KNTTAQYR PEM+DLYRG PI+EK+DIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK+GE AILH+RFQFPS+P YSD LK+LI  ML E+P+ RPN+CQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPIRNFYLLRAME--------KVKLSTEIDYPQLQLQKLRNAQADNLSN---PMIKP 349
             PCP+RNFY+ RAM+        K+K       P+L         A+N+ N    M   
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQQPKIKFDHSASQPKLD-------SANNIINVPFKMSHN 353

Query: 350 MPIAQRPTFSG-------NGMVNNNRTLPTVMVSNNVIGN------GSQVWDNSKPPEPQ 396
            P+    TF+G       NG +   + LP   VS++          G++   + + P  Q
Sbjct: 354 QPLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQ 413

Query: 397 P--------IPQSRSFVKSSTL 410
           P        + +S++F  +STL
Sbjct: 414 PPISHDFNRLGRSQTFTPTSTL 435

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 64/150 (42%), Gaps = 14/150 (9%)

Query: 550 RKSIQLRVQHLLDNMSSNEVKKSAQGYGKYT--DELSSTGTNIPKVTPDSPVLADLIDFN 607
           R SIQ RVQ LL N   + VKK+A GYG  +  DE +   + +   T    V        
Sbjct: 644 RSSIQKRVQDLLKNSQDSPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTA--- 700

Query: 608 DVPTIRIPSDKNQ--LSKSGXXXXXXXXXXXXLRSNKKISTLSALRLEPKQNDRITSDA- 664
             P +  P+ +N   + K+G             R           +    + D+I  +A 
Sbjct: 701 STPKVLSPAKRNSSVVIKAGQQVSKDAEEVPSSRKPAPPKPKRPKKPSHLKADKIIKEAE 760

Query: 665 TDVLMH------LNVDDLEEDFKRRFPSAV 688
           T    H      + +D+LE+DFKRRFPSAV
Sbjct: 761 TSAYEHSVDISDIEIDELEKDFKRRFPSAV 790

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  502 bits (1292), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/317 (72%), Positives = 264/317 (83%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP++++   GT L VG+H VK+LKYL SGGFA +Y+VEI         NVACLKRV V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVD+MK L  NK +VSYIDSHAT+SP N G YEV+LLMEYC GGGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQ +QG+A MHAL PPL+HRDIKIENVLLSK   +K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSGVIR PRN +E  YVQ+DIMKNTTAQYRCPEM+DLYRGLPIDEK+DIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AIL ++F+FP++P YSDR+KNLI  MLR  P  RPN+CQV+EEVSR+Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 NVPCPIRNFYLLRAMEK 317
            +PCPI+NFYLLR M+K
Sbjct: 301 GIPCPIKNFYLLRMMDK 317

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  499 bits (1285), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 261/315 (82%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP +     GT LTVG+H  KI+KYLTSGGFAQIY  EI  +  +N S  ACLKRV V
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK  LN LRAEVDAMKLL NN+HVVSYIDSHA RS    G YEVFLLMEYC+GGGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRLTE EIL+I+SQT QG++ MHAL P L+HRDIKIENVL+S  G +K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V   IRPPRN QEL YVQHD++KNTTAQYR PEMLDLYRGLPI+EK+DIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AILH+R+Q+P+FP Y+D+LKNLI++ L E PS RPN+CQ+LEE+SR+Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 NVPCPIRNFYLLRAM 315
            +PCPI NFYL R +
Sbjct: 301 GIPCPINNFYLSRTI 315

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 70/149 (46%), Gaps = 24/149 (16%)

Query: 547 SEKRKSIQLRVQHLLDNMSSN-EVKKSAQGYGKYTDE------LSSTGTNIPKVTPDSPV 599
           S +R+SIQ RV+ LL+         K+A GYGKYTD       +   G  IP  TP +  
Sbjct: 592 STQRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGRIP--TPTNKR 649

Query: 600 LADLIDFNDVPTIRIPSDKNQLSKSGXXXXXXXXXXXXLRSNKKISTLSALRLEPKQNDR 659
            + +I              N +++              LR           ++ P  ++R
Sbjct: 650 YSSVI-------------INPVTEPISIRPSPPPKPKHLRPIPPPKPTRLSKIYP--DER 694

Query: 660 ITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
           I+S AT+ +++L+V+ LE+DFKRRFPS +
Sbjct: 695 ISSTATERIVNLDVESLEKDFKRRFPSRI 723

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  498 bits (1282), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 228/313 (72%), Positives = 261/313 (83%), Gaps = 1/313 (0%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQ   D +  G  LTVG+H VKI++YLTSGGFAQIY+ E+LS G   GS +ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAMK+L  ++HVVSYIDSHA +SP +DGTYEV+LLMEYC  GGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MN+RLQ RL+E E+L IMS   QGI  MHALVPPL+HRDIKIENVL+S  G +KVCDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSGVIRPP+N  E  YVQHDI+KNTTAQYR PEM+DLYR LP+DEK+DIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           Y+TTPFEK+GE AIL A+FQFPS+P Y+DRLKNLI  ML EHP  RPN+CQVLEEVSR+Q
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 NVPCPIRNFYLLR 313
            VPCP+ NFYL R
Sbjct: 300 GVPCPLPNFYLER 312

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  493 bits (1270), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 229/315 (72%), Positives = 266/315 (84%), Gaps = 1/315 (0%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           M+QP L+    GT LTVG+H  +I+KYLTSGGFA IY+ EI S    N S++ACLKRV V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI-SPPDPNSSSIACLKRVLV 59

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAMKLL  +K VVSYIDSHA +S  N+G+YEVFLLMEYC  GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E E+L IMSQ +QG+A MHAL PPL+HRDIKIENVL+S+ G +KVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V GVIRPP+N QEL YVQHDI+KNTTAQYR PEM+DLYRGLP+DEK+DIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AILH++FQFP++P YSD+LKNLI ++LRE+P  RPN+CQ+L EVSR+Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 NVPCPIRNFYLLRAM 315
            VPCP++NFYL R M
Sbjct: 300 GVPCPVKNFYLERKM 314

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 72/159 (45%), Gaps = 12/159 (7%)

Query: 541 LPLNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTD---------ELSSTGTNIP 591
           + ++ N E R SIQ RV  LL N   + V+K+A  +G+++           +S    ++ 
Sbjct: 634 IKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAADHTISDKVIDVH 693

Query: 592 KVTPDSPVL--ADLIDFNDVPTIRIPSDKNQLSKSGXXXXXXXXXXXXLRSNKKISTLSA 649
            VT  SPV+  A L   +   T+  P+ K+                   +   K   L  
Sbjct: 694 NVT-SSPVVQKATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLKV 752

Query: 650 LRLEPKQNDRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
             L   +  R ++ A  +   +++DDLEEDFK+R+PSA+
Sbjct: 753 KNLVIPKKGRYSNRANTLSDEVDIDDLEEDFKKRYPSAI 791

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  484 bits (1247), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 226/315 (71%), Positives = 261/315 (82%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP++   + GT L+VG+H  +I+KYLTSGGFAQ+Y  EI  +  F  S++ CLKRV V
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAMKLL NN HVVSYIDSHA +  TN G+YEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EILDIMSQ +QG+A MHAL PPLLHRDIKIENVLL+  G YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V G+IRPP N QE  YVQHDIMKNTTAQYR PEM++L +GLPI+EK+DIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AILHA FQFP+FP+YSDR+K+LI+  L   PS RPN+ Q+LEEVS++Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 NVPCPIRNFYLLRAM 315
           NVPCPI +FYL R +
Sbjct: 301 NVPCPIPDFYLQRKL 315

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  486 bits (1250), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 232/363 (63%), Positives = 267/363 (73%), Gaps = 5/363 (1%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MN PE+     GT L+VGTH  KILKY+ SGGFAQ+Y+ E+       G+N  CLKRV +
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           P+K  LN LRAEV+AMKLL  +KHVV YIDSHA RS   +GTYEVFLLME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQ TQGIA MHAL PPL+HRDIKIENVL+S  G YKVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSG IRPPRN QE  +VQHDI+KNTTAQYR PEM+DLYR   IDEK+DIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK G+ AILH+R+QF + P YSDRLKNLI  ML + P  RPN+CQVLEEVSRMQ
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 NVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQADNLSNPMIKPMPIAQRPTFSG 360
            V  P+RNFYLLRAM+    ST    P + +        +    P  +  P+    +   
Sbjct: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSM-----VNTNTFMAPPAQVAPLTPAQSLGA 355

Query: 361 NGM 363
           NGM
Sbjct: 356 NGM 358

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  481 bits (1237), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/313 (70%), Positives = 253/313 (80%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP +   + GT+L VG H V I+KYLTSGGFAQIY V++      NG N+ACLKRV V
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           P+K  LN LRAEV+AM+LL    HVV YIDS+A RS +NDGTYEV  LME+C GGGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E E+L+IM+Q TQGI  MH+L PPL+HRDIKIENVL+S  G YKVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSG+IRPP+N +E  +VQ DIMKNTTAQYRCPEMLDLYRG PI+EK+DIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFE  GE AILHAR+Q+P +P YS RLKNLI+ ML E P  RPNVCQVLEEVS MQ
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 NVPCPIRNFYLLR 313
            +PCP+ NFYL R
Sbjct: 301 GIPCPLPNFYLQR 313

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  478 bits (1229), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 223/324 (68%), Positives = 262/324 (80%), Gaps = 4/324 (1%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQPE+     G  L VG+H  KILKYLTSGGFAQ+Y VEI    + +GSN+ACLKRV V
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRS----PTNDGTYEVFLLMEYCEGGG 116
           PDK SLN+ RAEV+AMKLL NNK+VVSYIDSHA +S       +G+YEVFLLMEYC G G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVC 176
           LIDFMNTRLQNRL E EIL+IMS  +QG+A MHAL PPLLHRDIKIENVL+S    +K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236
           DFGSV GVIRPP NQ EL +VQHDI+KNTTAQYR PEML L + +PI+EK+DIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           YK+CYYTTPFEK GE AILH+R+Q+P++P YSD LKNLI+ ML   PS RPN+CQV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SRMQNVPCPIRNFYLLRAMEKVKL 320
           SR+Q VPCP++NFYL RA+ +  +
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAV 324

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  473 bits (1217), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 279/353 (79%), Gaps = 4/353 (1%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP++   NVGTQLTVG+H V+I+KYLTSGGFAQ+Y+  I      + SN+ACLKRV V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAM+LL NN++VVSYIDSHA ++  ++G+YEVF+LMEYCE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL IMSQ TQG+A MHAL PPL+HRDIKIENVL+S    YK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V GVIRPPRN QEL YVQ DI KNTTAQYR PEM+D++RGLPIDEK+DIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GEPAIL   F+FP +P+YS++L++LI+ +L ++P  RPNV Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 NVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQADNLSNPMIKPMPIA 353
           NVPCPI +  + +A +     TE+     QL   +N ++ N  + + +P+P A
Sbjct: 301 NVPCPISDIQVPQAPDSHLNLTELH----QLSATQNIRSLNSHSTIERPIPNA 349

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  472 bits (1214), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 255/317 (80%), Gaps = 1/317 (0%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQ   D    GT LTVG+H VK++KYLTSGGFAQIY  E++S       +VACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAMKLL  NKH+VSYIDSHA++S  N+G+YEV LLMEYC  GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQ+RL E E+L IM+Q  QGI  MHAL PPL+HRDIKIENVL+++ G  KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V GVIRPP+N  EL YVQHDI+KNTTAQYR PEM+DLYRG  +DEK+DIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AIL A FQFPS+P YS+RLKNLI  ML E+P  RPN CQVLEEV R+Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 NVPCPIRNFYLLRAMEK 317
             PCP++NFYL R++++
Sbjct: 300 GQPCPVKNFYLERSLKQ 316

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  468 bits (1203), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/308 (69%), Positives = 258/308 (83%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP++   NVGTQLTVG+H V+I+KYLTSGGFAQ+Y+  I        SNVACLKRV V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAMKLL NN++VVSYIDSHA ++  ++G+YEVF+LMEYCE GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL IM Q TQG+A MHAL PPL+HRDIKIENVL+S    YK+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V GVIRPPRN QEL YV+ D++KNTTAQYR PEM+D++RGLPIDEK+DIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GEPAIL+ +F+F  +PNYS++L+NLI  +L ++PS RPNV Q+L++++ MQ
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 NVPCPIRN 308
           N P PIR+
Sbjct: 301 NAPYPIRD 308

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  468 bits (1204), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/314 (68%), Positives = 260/314 (82%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP++   NVGTQLTVG+H V+I+KYLTSGGFAQ+Y+  I      + S+VACLKRV V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAM+LL NN++VVSYIDSHA ++  ++G+YEVF+LMEYCE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL IMSQ TQG+A MHAL PPL+HRDIKIENVL+S    YK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V G+IRPPRN QEL YVQ DI+KNTTAQYR PEM+D +RGLPIDEK+DIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK G+ AIL  +F+FP +PNYS++LK LI+ +L + P  RPNV Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 NVPCPIRNFYLLRA 314
           NVPCPI +  +++A
Sbjct: 301 NVPCPINDIQVVQA 314

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  468 bits (1203), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 261/314 (83%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP++   NVGT+LTVG+H V+I+KYLTSGGFAQ+Y+V I        +NVACLKRV V
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDAM+LL NN++VVSYIDSHA ++   +G+YEVF+LMEYCE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL I+SQ TQG+A MHAL PPL+HRDIKIENVL+S    YK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V G+IR PRN QEL YVQ DI+KNTTAQYR PEM+D++RGLPIDEK+DIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GEPAIL  +F+FP +PNYS++LK+LI+ +L ++P  RP+V Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 NVPCPIRNFYLLRA 314
           NVPCPI +   ++A
Sbjct: 301 NVPCPINDIQTVQA 314

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  469 bits (1208), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 218/320 (68%), Positives = 255/320 (79%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP++     G  L VG H   ILKYLTSGG+AQ+Y  +I       GS++ CLKR+ V
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN  RAEVDAMKLL N  HVVSYIDS+A +S  ++G YEV LLME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQ TQG+A MH+L PPLLHRDIKIENVL+S  G YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V GVIRPP +QQE  +VQHDI+KNTTAQYR PEM+DL R LPIDEK+DIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AILH+R+++ ++P+YSD LKNLI+ ML   PS RPN+CQVLEEVSR+Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 NVPCPIRNFYLLRAMEKVKL 320
            +PCPI+NFYL RA+ +  L
Sbjct: 301 GIPCPIKNFYLERAIHRSTL 320

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 64/145 (44%), Gaps = 20/145 (13%)

Query: 546 NSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDELSSTGTNIPKVTPDSPVLADLID 605
           N     SIQ R+++L+DN  +  + K A  YGKYT    + G +  +            +
Sbjct: 581 NQSDNNSIQDRMKNLIDNADNIPINKIASDYGKYTKSSDNFGKDSGE------------E 628

Query: 606 FNDVPTIRIPSD--KNQLSKSGXXXXXXXXXXXXLRSNK--KISTLSALR-LEPKQNDRI 660
            ND   I+  +   +NQ  K+             LR  K  K + L+  R L+  ++D  
Sbjct: 629 MNDKENIKTANSGTRNQPKKNKKEKPVPAKKPAHLRPQKPPKPTFLAGKRKLDKNKSDVK 688

Query: 661 TSDATDVLMHLNVDDLEEDFKRRFP 685
           TS  +   M  N++ L E+F +RFP
Sbjct: 689 TSSES---MEPNLETLTEEFNKRFP 710

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  454 bits (1168), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 209/311 (67%), Positives = 253/311 (81%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP +     GT LTVG+H V+I+KYLT+GGFAQIY   I  +  F+G+N+ACLKRV V
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN+LRAEVDAMKLL NN+ VVSYIDSHA +S   +GTYEVFLLMEYCE GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           +N+RLQNRL E E+++IM   +QG+A MHAL PPL+HRDIKIENVLLSK   +K+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSG IRPP N QEL  VQ+DIM+NTTAQYR PEM+D+ RG PIDEK+DIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE  IL +R++FP+FP YSDRL++LI  +L   P+ RPN+  V++E+S M+
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 NVPCPIRNFYL 311
           N+ CPI NFYL
Sbjct: 301 NISCPIINFYL 311

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  438 bits (1126), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 200/320 (62%), Positives = 253/320 (79%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQ +L      T +TVG+H+ KI+KYL SGG+AQ+Y+  +  +     +N+ACLKRV V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK SLN LRAEVDA+K+L N K+VVSYIDSHA++   + G+YEVF+LMEYC GG LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           +NTRL+NRL E EIL IM+Q   G+A MH L P L+HRDIKIEN+L+S+ G YKVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           V GVIRPPR+ +E+ Y+QHDIMKNTTAQYR PEMLDL +G  I+EK+DIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFEK GE AIL ++FQ+P++P YSD LKN+I+ +L   P  RPN+CQ++EE+SR+Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 NVPCPIRNFYLLRAMEKVKL 320
            +  P++NFYL RA+E   L
Sbjct: 301 GIVPPMKNFYLSRALETSSL 320

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 541 LPLNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTD 581
           + L    E + SI+ RV+ LL      +  ++A GYGKYTD
Sbjct: 602 IKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTD 642

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  426 bits (1095), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 243/311 (78%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MN P + +   GT +TVG+HSV ILKYLTSGG+AQIY+ +I+    F G+N+A LKRV V
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           PDK  LN LRAEVDAMK L ++K++VSYIDSHA +S   DGTYEVFL+MEYC  GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNTRLQNRLTE EIL I    +QG+A MH L PPL+HRDIKIENVL+S    YK+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSG IRPP+  +EL YV+HDIM +TTAQYR PEMLDL +G  +++K+DIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFE+ GE  IL+   +FP +P+YSD +K LI SML ++P  RPN+ Q+++ VS++ 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 NVPCPIRNFYL 311
           NV CPI N ++
Sbjct: 301 NVNCPIPNIHV 311

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  443 bits (1139), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 204/317 (64%), Positives = 239/317 (75%), Gaps = 6/317 (1%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSN----VACLK 56
           MNQPE+ +   G  L +GTH V I KYL  GGFAQ+Y+V ++     N  N    +ACLK
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSS--NARNELGTMACLK 58

Query: 57  RVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGG 116
           RV VPDK  LN LRAEVDAMKLL  NK++VSYIDSHA RS    G YEVFLLMEYC  GG
Sbjct: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118

Query: 117 LIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVC 176
           +IDF+NTRL +RL E EIL IMS   QG+A MH L PPL+HRDIKIENVL+S+ G YK+C
Sbjct: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178

Query: 177 DFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236
           DFGS   V+RPP+  QE  ++ HDIM NTTAQYR PEM+D Y G PIDEK+DIWALGVFL
Sbjct: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238

Query: 237 YKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           YKLCYYTTPFEK GE AIL+ +FQFPS+P YSD ++N+I  ML + P  RPN+CQVLE+V
Sbjct: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298

Query: 297 SRMQNVPCPIRNFYLLR 313
           S++Q VPCPI NF L R
Sbjct: 299 SKLQGVPCPIENFMLTR 315

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 526  VQRSPSSRSDGSDFRLPLNPNSEKRKSIQLRVQHLLDNMSS-NEVKKSAQGYGKYTDELS 584
            +  S SS+ D S  RL  NP++  +  I+ RV  LL N  + N V ++A GYGKYTD+ +
Sbjct: 1185 INNSNSSKGDISSLRLVSNPDA--KDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPN 1242

Query: 585  STGTNIPKVT 594
            ++    P+ T
Sbjct: 1243 TSQNKAPQRT 1252

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  418 bits (1074), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 248/324 (76%), Gaps = 6/324 (1%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           MNQP +     G  + VG+H  KILKYLTSGGFAQIY+VEI     +  SN+ACLKRV V
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           P+K  LN+LR EVDAMKLL NN+HVVSYIDS+A +S   +G+YEVFLLMEYCE G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MNT+L+ RL E E+L+IM+Q  QGIA MH L+PPL+HRDIKIENVL+S  G++KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKA---DIWALGVFLY 237
           V G+IRPPRN QEL YVQHD+MKNTTAQYR PEM+DL +G PI+ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVS 297
            L +YT  F +  E AIL+ R+Q+P++P YSDRLKN+++ +L  HP  RPN+CQ+LEE+S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 RMQNVPCPIRNFYLLRAMEKVKLS 321
           ++QN+PCPI NFYL R+  +  +S
Sbjct: 298 KIQNIPCPIDNFYLERSRHQGAVS 321

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 75/154 (48%), Gaps = 16/154 (10%)

Query: 550 RKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDE---LSSTGTNIPKVTPDS----PVLAD 602
           + SI+ RV +LL N   + VKK+A GYGKYT     +S T  +   V  +S    P++  
Sbjct: 635 KASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILS 694

Query: 603 LIDFNDVPTIRIPSDKNQLSKSGXXXXXXXX------XXXXLRSN--KKISTLSALRLEP 654
               +  P + +P+  N+ + +G                  LR    KK + LS+L++  
Sbjct: 695 ARGSSGHPVV-VPALINRDNDNGKYPAKSKAPPVVPKKPDHLRPKPPKKPAHLSSLKINK 753

Query: 655 KQNDRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688
           K +  + +   D+L    VD+LE+ FK+R+PS V
Sbjct: 754 KHSTTVLNTPADLLSDTAVDELEKSFKQRYPSTV 787

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  404 bits (1037), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 240/322 (74%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60
           M+Q   D+   GT+L V +H V I  YLTSGGFAQ+Y   I S        + CLKRV V
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120
           P+K SLNILRAEVDAMK+L NNK++VSYIDSHA R   ++ +Y V LLMEYC G GL+DF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180
           MN RL+ RL E EIL IM+  +QG+  MH L PPLLHRDIKIENVLLS  G +K+CDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240
           VSGV+R P + +E +Y+Q+DI+KNTTAQYR PEM++L  G PI+EK+DIWALG+ LYKLC
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
           YYTTPFE+ G  AI+  +F +P++P Y+D LKN+I+ +L  +P  RPN+CQ+LEE+ R+Q
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 301 NVPCPIRNFYLLRAMEKVKLST 322
           +   P+ NFY+ RAM  +++ T
Sbjct: 301 HKSSPLPNFYVQRAMSSLQMDT 322

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 27/40 (67%)

Query: 546 NSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDELSS 585
           N E +KSI+ RVQ L+ + S N V  SA GYGKYTD  SS
Sbjct: 625 NLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTDNKSS 664

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  306 bits (784), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 214/322 (66%), Gaps = 20/322 (6%)

Query: 6   LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNG--------------S 50
           +++ + G  + VG+H V+I+KYLT GGFAQIY V++   +  F+                
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 51  NVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLME 110
           ++ CLKRV V D+  L+ ++ EV+ MK L    +VV Y DS+ATR+   +G +EVFLLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
           YC    L+D+MN RL  +LTE EIL+IM   T G++ +H L  PL+HRDIKIENVL+   
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 GIYKVCDFGSVSGVIRPP--RNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKAD 228
             +K+CDFGS +  I PP     Q++  + HDI  +TT QYR PEM+DL+R LP++EKAD
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPN 288
           IWALGVFLYKL +YTTPFE  G+ AILH++++ P   +YS+RL NLI  ML E+P+ RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPNLRPN 322

Query: 289 VCQVLEEVSRMQNVPCPIRNFY 310
           + QVL E+  + NV  PI + Y
Sbjct: 323 IYQVLSEICSILNVEVPIPDIY 344

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  300 bits (769), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 164/374 (43%), Positives = 224/374 (59%), Gaps = 21/374 (5%)

Query: 12  GTQLTVGTHSVKILKYLTSGGFAQIYAVEILSM----------GLFNGSNVACLKRVKVP 61
            TQ+ VGTH  +IL++L  GGFA IY V+ L +           L    ++ACLKRV VP
Sbjct: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91

Query: 62  DKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFM 121
           D+  LN LR EV+ MK L  + ++V Y DS+A+R P     +E+ LLME C    L+D+M
Sbjct: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151

Query: 122 NTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSV 181
           N +L  +LTE EIL IM   +  IA MH L  PL+HRDIKIENVL+ K   +K+CDFGS 
Sbjct: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211

Query: 182 SGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCY 241
           S         Q++  + ++I  +TT QYR PEM+DLYR LPI+EK+DIWALG+FLYKL +
Sbjct: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271

Query: 242 YTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQN 301
           YTTPFE  G+ AILH++++ P    YS +L NLI  ML E+PS RPN+ QV+  V  +  
Sbjct: 272 YTTPFELTGQFAILHSKYEIPQ-NGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILK 330

Query: 302 VPCPIRNFYLLRAMEKVKLS------TEIDYPQLQL---QKLRNAQADNLSNPMIKPMPI 352
              P  + Y L   +  K S       +I Y   +L   +K+ +   D L++  I+   I
Sbjct: 331 CDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMFELYKNEKVTSGDVDKLNDLFIQNFEI 390

Query: 353 A-QRPTFSGNGMVN 365
           A ++P   G G V+
Sbjct: 391 APKQPIDKGIGSVD 404

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  301 bits (771), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 151/316 (47%), Positives = 202/316 (63%), Gaps = 10/316 (3%)

Query: 4   PELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMG---------LFNGSNVAC 54
           P L+R+  G+Q+ VG H V+I+KYL  GGFA IY V+ +                   AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEG 114
           LKRV V D+  LN +R EV  MK L+   ++V Y DSHA+RS      +EV LLME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
             L+D+MN RL  +L+E EIL IM   T+ +A MH L  PL+HRD+KIENVL+     +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGV 234
           +CDFGS S  +      QE+  + ++I  +TT QYR PEM+DLYR LPIDEK+DIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           FLYKL +YTTPFE  G+ AILH++++FP   NYS +L NLI  ML E+P+ RPN+ Q+++
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 295 EVSRMQNVPCPIRNFY 310
            +  +  V  PI + Y
Sbjct: 323 NLCSIMKVENPIEDKY 338

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  299 bits (765), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 205/316 (64%), Gaps = 11/316 (3%)

Query: 4   PELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEIL---------SMGLFNGSNVAC 54
           P L+++  GT + VG+H V+I+KYL  GGFA IY V+ +         S  L  G ++AC
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEG-DLAC 85

Query: 55  LKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEG 114
           LKRV V D+  LN LR EV+ MK L N+ ++V Y DS+A+R       YEV LLME C  
Sbjct: 86  LKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPN 145

Query: 115 GGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
             L+D+MN RL  +L+E E+L IM   T+ +A MH L  PL+HRDIKIENVL+     +K
Sbjct: 146 KSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFK 205

Query: 175 VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGV 234
           +CDFGS S         Q++  + ++I  +TT QYR PEM+DLYR LPIDEK+DIWALG+
Sbjct: 206 LCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGI 265

Query: 235 FLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           FLYKL +YTTPFE  G+ AILH+++  P+  NYS +L NLI  ML E+P+ RPN+ QV+ 
Sbjct: 266 FLYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIY 324

Query: 295 EVSRMQNVPCPIRNFY 310
           +V  +  V  P  + Y
Sbjct: 325 QVCAIMKVDVPFEDKY 340

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  299 bits (765), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 168/393 (42%), Positives = 229/393 (58%), Gaps = 29/393 (7%)

Query: 6   LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSM--------GLFNGSNVACLKR 57
           L+++  G+ L VG H V+I++YL  GGFA IY V  +           +    ++ACLKR
Sbjct: 25  LEKLTAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKR 84

Query: 58  VKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGL 117
           V+V D+  LN LR EV+ MK L    +VV Y DS+A+R       +EV LLME C  G L
Sbjct: 85  VQVNDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSL 144

Query: 118 IDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCD 177
           +D+MN RL  +L+E E+L IM   T+GI+ MH L  PL+HRDIKIENVL+     +K+CD
Sbjct: 145 LDYMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCD 204

Query: 178 FGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLY 237
           FGS S  +      QE+  + ++I  +TT QYR PEM+DLYR L I+EK+DIWALG+FLY
Sbjct: 205 FGSTSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLY 264

Query: 238 KLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVS 297
           KL +YTTPFE  G+ AILH+++  P   N+S +L NLI  ML E+P  RPN+ Q+L  + 
Sbjct: 265 KLLFYTTPFELTGQFAILHSKYDIPQ-NNFSSKLINLIIVMLAENPYIRPNIYQILYHIC 323

Query: 298 RMQNVPCPIRNFY---------LLRAMEKV-KLSTEIDYPQLQ-------LQKLRNAQAD 340
            +     PI + Y           R  E++ +L  EI   Q         + KL N   +
Sbjct: 324 SIMECDVPIEDHYGQGPYDFNKYARYQERLQRLQYEILVNQQNAYRGGSYIDKLNNQFVE 383

Query: 341 NLSNPMIKPMPIAQRPTFSGNGMVNNNRTLPTV 373
           N      +P+ +AQ P  S +G VN   T PTV
Sbjct: 384 NFEVAPRQPISMAQGPLPSIHGHVN---TAPTV 413

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  299 bits (766), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 164/383 (42%), Positives = 228/383 (59%), Gaps = 36/383 (9%)

Query: 6   LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEIL-------------SMGLFNGSNV 52
           +++   G  + VG+H V+IL+Y+  GGFAQIY+V+ L             S       ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATR------SPTNDGTYEVF 106
           ACLKRV V D+  LN LR EV+ MK L    ++V Y DS+A+R      S   +  +EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 107 LLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVL 166
           LLME C    L+D+MN RL  +L+E EIL++M   +  IA MH L  PL+HRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 167 LSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEK 226
           + +   +K+CDFGS S         +++ Y+  +I  +TT QYR PEM+DLYR LPIDEK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 227 ADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
           +DIWALG+FLYKL ++TTPFE+ G+ AILH++F+FP   NYS +L NLI  ML E+P+ R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQ-NNYSFKLINLIIVMLSENPNLR 313

Query: 287 PNVCQVLEEVSRMQNVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQADNLSNPM 346
           PN+ QVL ++ +++ VP PI + Y L A          DY  L    L+  Q D  +   
Sbjct: 314 PNIYQVLHQICQLKQVPIPIADKYGLGAY-------NFDYYMLFQNNLQKVQVDMFN--- 363

Query: 347 IKPMPIAQRPTFSGNGMVNNNRT 369
                  +R  F  NG ++ + T
Sbjct: 364 ------IKRKQFEHNGQLDESDT 380

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  299 bits (765), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 166/395 (42%), Positives = 233/395 (58%), Gaps = 27/395 (6%)

Query: 4   PELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMG---------LFNGSNVAC 54
           P L+++  G+Q+ VG H V+I+KYL  GGFA IY V  +                 ++AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEG 114
           LKRV V D+  LN +R EV  MK L+   ++V Y DSHA+R+      +EV LLME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 115 GGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
             L+D+MN RL  +L+E EIL IM   T+ +A MH L  PL+HRD+KIENVL+     +K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 175 VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGV 234
           +CDFGS S         QE+  + ++I  +TT QYR PEM+DLYR LPI+EK+DIWALG+
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 235 FLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           FLYKL +YTTPFE  G+ AILH++++FP   NYS +L NLI  ML E+P+ RPN+ QV++
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 295 EVSRMQNVPCPIRNFYLLRAMEKVKLS------TEIDYPQLQLQKLRNAQADNLSNPMI- 347
            +  +  V  P+ + Y L +    K S       ++ Y Q+ L      Q D L++  I 
Sbjct: 365 NLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQY-QMYLAYENKQQIDTLNDMFIN 423

Query: 348 -------KPMPIAQRPTFSG--NGMVNNNRTLPTV 373
                  +P+ I+ +   SG  +     N+T+P V
Sbjct: 424 CFEVAPKQPVDISDKKWASGPSSYKTRENKTVPEV 458

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  298 bits (762), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 203/325 (62%), Gaps = 22/325 (6%)

Query: 7   DRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNGS--------------- 50
           ++ N G  + VG H V+I+KYL  GGFAQIY+V  +  +  F+                 
Sbjct: 17  EKFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQF 76

Query: 51  -----NVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEV 105
                N+ACLKRV VPD+  LN LR EV+ M+ L    ++V Y DS+A+R    +  +EV
Sbjct: 77  KLEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEV 136

Query: 106 FLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENV 165
            LLME C    L+D+MN RL  +L+E EIL IM   T GI+ MH L  PL+HRDIKIENV
Sbjct: 137 LLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENV 196

Query: 166 LLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDE 225
           L+     +K+CDFGS S       + QE+  +  +I  +TT QYR PEM+DLYR LPIDE
Sbjct: 197 LVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDE 256

Query: 226 KADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSD 285
           K+DIWALGVFLYKL +YTTPFE  G+ AILH++++ P   NYS RL NLI  ML E+P+ 
Sbjct: 257 KSDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPP-NNYSSRLINLIIIMLAENPNL 315

Query: 286 RPNVCQVLEEVSRMQNVPCPIRNFY 310
           RPN+ QV+ +V     +  PI++ Y
Sbjct: 316 RPNIYQVMHQVCITIGIEPPIKDKY 340

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  301 bits (770), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 205/328 (62%), Gaps = 25/328 (7%)

Query: 7   DRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVE-ILSMGLFNGSN-------------- 51
           ++   GTQ+ VG+H V+I+KY+  GGFAQIYAV+ + S+  F  SN              
Sbjct: 22  EKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAP 81

Query: 52  ---------VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGT 102
                    +ACLKRV V D+  LN +R EV+ MK L    +VV Y DS+A+R       
Sbjct: 82  NPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASG 141

Query: 103 YEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKI 162
           +EV LLME C    L+D+MN RL  +LTE EIL IM   T  ++ MH L  PLLHRDIKI
Sbjct: 142 FEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKI 201

Query: 163 ENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLP 222
           ENVL+     +K+CDFGS S  +      Q++  +  +I  +TT QYR PEM+DLYR LP
Sbjct: 202 ENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 261

Query: 223 IDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREH 282
           IDEK+DIWALG+FLYKL ++ TPFE  G+ AILH++++FP   NYS +L NLI  ML E+
Sbjct: 262 IDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAEN 320

Query: 283 PSDRPNVCQVLEEVSRMQNVPCPIRNFY 310
           P+ RPN+ QVL+ +  M NV  PI + Y
Sbjct: 321 PNLRPNIYQVLDNICSMMNVEVPIEDIY 348

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  299 bits (766), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 163/365 (44%), Positives = 217/365 (59%), Gaps = 20/365 (5%)

Query: 2   NQPE-LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEIL-SMGLFNGSN-------- 51
           N+P  +++   G+ + VG   V+I+KYLT GGFAQIY V+ L +   F+ +N        
Sbjct: 17  NKPSAVEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIG 76

Query: 52  -VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLME 110
            +ACLKRV V D+  LN +R EV+ MKLL    ++V Y DS+A+R       +EV LLME
Sbjct: 77  DLACLKRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLME 136

Query: 111 YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
            C    L+DFMN RL  +L+E EIL IM   T  +A MH L PPL+HRDIKIENVL+   
Sbjct: 137 LCPNKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQ 196

Query: 171 GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIW 230
             +K+ DFGS S         Q++  +  DI  +TT QYR PEM+DLY+ LPIDEK+DIW
Sbjct: 197 NGFKLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIW 256

Query: 231 ALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVC 290
           ALG+FLYKL +Y TPFE  G+ AILH+++ FP   NYS RL NLI  ML E+P+ RPN+ 
Sbjct: 257 ALGIFLYKLLFYITPFEMTGQFAILHSKYDFPQ-TNYSSRLINLIIIMLSENPNLRPNIY 315

Query: 291 QVLEEVSRMQNVPCPIR--------NFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQADNL 342
           QVL E+  +      I         NF   R  +    S ++    LQ +K  N    N 
Sbjct: 316 QVLHEICSISGTRLEITDKYGQGPYNFDQFRKFQNELQSLQVQMFNLQQRKTENDGKLNQ 375

Query: 343 SNPMI 347
           S+ ++
Sbjct: 376 SDEIL 380

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  298 bits (762), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 209/323 (64%), Gaps = 13/323 (4%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAV-------EILSMG---LFNGS 50
           +N P  ++   G  ++VG H V+I+ YL  GGFAQIY V       E  S+G        
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLME 110
           ++ACLKRV V D++ LN +R EV+ MK L ++ ++V Y DS+A+R       +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
            C    L+D+MN RL+ +L+E EIL IM   + GI+ MH L  PL+HRDIKIENVL+   
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIW 230
             +K+CD GS S    P  + Q++  +  +I  +TT QYR PEM+DLYR LPI+EK+DIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPN-YSDRLKNLIKSMLREHPSDRPNV 289
           ALG+FLYKL +YTTPFE  G+ AILH+++ FP  PN YS ++ NLI  ML E+P+ RPN+
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFP--PNKYSSKIINLIIIMLAENPNLRPNI 309

Query: 290 CQVLEEVSRMQNVPCPIRNFYLL 312
            QV+  +  + N+P PI + Y L
Sbjct: 310 FQVVYHICSIMNLPVPIEDRYGL 332

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  298 bits (764), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 203/318 (63%), Gaps = 11/318 (3%)

Query: 3   QPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNGS---------NV 52
           +P  +R   GTQ+ VG H V+I+KY+  GGFAQIYAV+ +  +  F  +         +V
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYC 112
           ACLKRV V D+  LN +R EV+ MK L    ++V Y DS+A+R       +EV LLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 113 EGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGI 172
               L+D+MN RL  +LTE EIL IM   T  ++ MH L  PLLHRDIKIENVL+     
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 173 YKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWAL 232
           +K+CDFGS S         Q++  +  +I  +TT QYR PEM+DLYR LPIDEK+DIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 233 GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
           G+FLYKL ++TTPFE  G+ AILH++++FP   NYS +L NLI  ML E+P+ RPN+ QV
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 293 LEEVSRMQNVPCPIRNFY 310
           L  +  +  +  PI + Y
Sbjct: 315 LHNICSISGMKVPIEDQY 332

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  292 bits (747), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 201/318 (63%), Gaps = 10/318 (3%)

Query: 6   LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAV---EILSMGLFNGSNVA------CLK 56
           LD    GT + VG H V+++KYL  GGFA+IY V   E LS    NG  V       CLK
Sbjct: 26  LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLK 85

Query: 57  RVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGG 116
           RV V D   LN +R EV+ M+ L     VV Y DS+A+R       YEV LLME C    
Sbjct: 86  RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNS 145

Query: 117 LIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVC 176
           L+D+MN RL  +L+E EIL IM   T  +A MH L  PL+HRDIKIENVL+     +K+C
Sbjct: 146 LLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLC 205

Query: 177 DFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236
           DFGS S  +    + Q++  +  +I  +TT QYR PEM+DLYR LP++EK+DIWALGVFL
Sbjct: 206 DFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFL 265

Query: 237 YKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           YKL +YTTPFE+ G+ AILH++++FP   NYS +L NLI  ML E+P+ RPN+ QVL ++
Sbjct: 266 YKLMFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQI 324

Query: 297 SRMQNVPCPIRNFYLLRA 314
             +  +  P+ + Y L A
Sbjct: 325 CYISGIKNPMDDAYGLGA 342

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  293 bits (749), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 150/322 (46%), Positives = 204/322 (63%), Gaps = 18/322 (5%)

Query: 6   LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLF----NGSNV-------- 52
           +++   G  L VGTH V+I+ YLT GGFAQIY V+ +  +  F    NGSNV        
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 53  ----ACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLL 108
               ACLKRV V D++ LN +R EV+ MK L    ++V Y DS+ATRS   +  YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLS 168
           ME C    L+++MN RL  +L+E E+L IM   T G+A MH L  PL+HRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 KGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKAD 228
               +K+CDFGS +         Q++  +  ++  +TT QYR PEM+DLYR LPI+EK+D
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPN 288
           IWALGVFLYKL +YTTPFE  G+ A+LH++F  P+   YS ++ NL+  ML E+ + RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRPN 326

Query: 289 VCQVLEEVSRMQNVPCPIRNFY 310
           + QV+  + ++  V  PI + Y
Sbjct: 327 IYQVMHYICQLIQVDTPILDIY 348

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  294 bits (753), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 157/351 (44%), Positives = 214/351 (60%), Gaps = 15/351 (4%)

Query: 4   PELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNG--------SNVAC 54
           P ++R   G  + VGTH V+++ YL  GGFAQIY V+ L  +  F           +VAC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEG 114
           LKRV V D+  L+ +R EV+ MK L   +++V Y DS+A R    +  +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
             L+D+MN RL  +LTE EIL IM   +  ++ MH L  PL+HRDIKIENVL+     +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGV 234
           +CDFGS S         QE+  +  +I  +TT QYRCPEM+DLYR LPI+EK+DIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKLGEPAILHARFQFPSFPN-YSDRLKNLIKSMLREHPSDRPNVCQVL 293
           FLYKL ++ TPFE  G+ AILH++++FP  PN YS +L NLI  ML E+P  RPN+ QVL
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFP--PNHYSSQLINLIIIMLAENPFVRPNIYQVL 314

Query: 294 EEVSRMQNVPCPIRNFYLLRAM---EKVKLSTEIDYPQLQLQKLRNAQADN 341
             +  M  V  PI + Y   A    +  +  T++   Q Q+  L+  + +N
Sbjct: 315 NHICTMIGVEVPIEDKYGCGAYNFDKYAEFQTKLQNAQYQMYMLQQKKLEN 365

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  293 bits (749), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 151/316 (47%), Positives = 199/316 (62%), Gaps = 15/316 (4%)

Query: 11  VGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS----MGLFNGSN----------VACLK 56
            GT + VG+H V+++KY+  GGFAQIY V+ +          G N          +ACLK
Sbjct: 101 AGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIACLK 160

Query: 57  RVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGG 116
           RV V D   LN +R EV+ M+ L     VV Y DS+A+    +   YEV LLME+C    
Sbjct: 161 RVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPNNS 220

Query: 117 LIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVC 176
           L+D+MN RL  RL+E EI+ IM  TT GIA +H L  PL+HRDIKIENVL+ +   +K+C
Sbjct: 221 LLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFKLC 280

Query: 177 DFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236
           DFGS S       N +++     +I  NTT QYR PEM+DLYR  PIDEK+DIWALGVFL
Sbjct: 281 DFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGVFL 340

Query: 237 YKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           YKL ++TTPFE+ G+ AILH++++FP   NYS +L NLI  ML E+PS RPN+ QVL+ +
Sbjct: 341 YKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQYL 399

Query: 297 SRMQNVPCPIRNFYLL 312
             +     P+ + Y L
Sbjct: 400 CSINGWKVPLNDKYGL 415

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  291 bits (745), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 219/353 (62%), Gaps = 13/353 (3%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFN-GS-------N 51
           + +P +D    GT + VG   V+I+ ++  GGFAQIY+V+ +  +G FN GS       +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEY 111
           +ACLKRV VPD+  L+ +R EV+ MK L   K ++ Y DS+A+R  +    YEV LLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGG 171
           C    L+D+MN RL  RLTE EIL +M  TT  I+ MH L  PL+HRDIKIENVL+    
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWA 231
            +K+CDFGS S         Q++  +  +I  NTT QYR PEM+DLYR LPI+EK+DIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQ 291
           LG+FLYKL ++ TPFE  G+ +ILH++++FP+   YS +L NLI  ML E+P  RPN+ Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 VLEEVSRMQNVPCPIRNFYLLRA--MEK-VKLSTEIDYPQLQLQKLRNAQADN 341
           V+  +  +     PI + Y L     EK  +  T++   Q Q+  L+  + +N
Sbjct: 313 VMHHICSVIGCEVPIEDKYGLGPYNFEKYTEFQTKLQNVQYQMYLLQQKKLEN 365

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  289 bits (740), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 153/328 (46%), Positives = 199/328 (60%), Gaps = 33/328 (10%)

Query: 6   LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEIL----------------SMGLFNG 49
           +++   GT LTVG   ++ILKYLT GGFAQIY V  +                S  L  G
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 50  SNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGT------- 102
            +VACLKRV VPD+  L+ +R EVD MK L N  ++V Y DS+A++   N          
Sbjct: 97  -DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNND 155

Query: 103 --------YEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPP 154
                   +E+ LLMEYC    L+DFMN RL  +LTE EIL  M+  T  +  MH L  P
Sbjct: 156 NNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQP 215

Query: 155 LLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEM 214
           L+HRDIKIENVL+     +K+ DFGS + +  P    Q++  +  DI  NTT QYR PEM
Sbjct: 216 LIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEM 275

Query: 215 LDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNL 274
           +DLY+ LPIDEK+DIWALGV LYKL +YTTPFE  G+ AILH++++FP+  NYS +  NL
Sbjct: 276 IDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINL 334

Query: 275 IKSMLREHPSDRPNVCQVLEEVSRMQNV 302
           I  ML E+P+ RPN+ QVL  +  + N 
Sbjct: 335 IIIMLAENPNLRPNIFQVLYYLKSISNT 362

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  289 bits (739), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 157/347 (45%), Positives = 210/347 (60%), Gaps = 17/347 (4%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNGS--------N 51
           M  P ++R   G  + VGTH V+++ YL  GGFAQIY V+ +  +  F+ +        +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEY 111
           VACLKRV V D+  LN +R EV+ MK L    +VV Y DS+A+R       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGG 171
           C    L+D+MN RL  +LTE EI+ IM      I+ MH L  PL+HRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWA 231
            +K+ DFGS S         Q++  +  +I  +TT QYR PEM+DLYR LPI+EK+DIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQ 291
           LG+FLYKL ++TTPFE  G+ AILH++++FP    YS +L NLI  ML E+P+ RPN+ Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRMQNVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQ 338
           VL  +  + N+  PI + Y   A    K      Y Q Q  KL+N Q
Sbjct: 313 VLYHLCEILNIEVPIEDKYTEGAYNFSK------YTQFQ-NKLQNVQ 352

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  288 bits (738), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 158/347 (45%), Positives = 211/347 (60%), Gaps = 17/347 (4%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNGS--------N 51
           M  P ++R   G  + VGTH V+I+ YL  GGFAQIYAV+ L  +  F+ +        +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEY 111
           VACLKRV V D+  LN +R EV+ MK L    +VV Y DS+A+R       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGG 171
           C    L+D+MN RL  +L+E EI+ IM      I+ MH L  PL+HRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWA 231
            +K+ DFGS S         Q++  +  +I  +TT QYR PEM+DLYR LPI+EK+DIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQ 291
           LG+FLYKL ++TTPFE  G+ AILH++++FP    YS +L NLI  ML E+P+ RPN+ Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRMQNVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQ 338
           VL  +  + N   PI + Y   A +  K      Y + Q  KL+N Q
Sbjct: 313 VLYHICDILNAEVPIEDKYSEGAYDFAK------YTKFQ-NKLQNVQ 352

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  288 bits (736), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/347 (45%), Positives = 209/347 (60%), Gaps = 17/347 (4%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNGS--------N 51
           M  P ++R   G  + VGTH V+++ YL  GGFAQIY V+ L  +  F+ +        +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEY 111
           VACLKRV V D+  LN +R EV+ MK L    ++V Y DS+A+R       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGG 171
           C    L+D+MN RL  +LTE EI+ IM      I+ MH L   L+HRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWA 231
            +K+ DFGS S         Q++  +  +I  +TT QYR PEM+DLYR LPI+EK+DIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQ 291
           LGVFLYKL ++TTPFE  G+ AILH++++FP    YS +L NLI  ML E+P+ RPN+ Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRMQNVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQ 338
           VL  +  + NV  PI + Y   A    K      Y Q Q  KL+N Q
Sbjct: 313 VLYHLCEILNVEVPIEDKYAEGAYNFSK------YTQFQ-NKLQNVQ 352

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  286 bits (733), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 200/319 (62%), Gaps = 10/319 (3%)

Query: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNGS--------N 51
           M  P ++R   G  + VGTH V+I+ YL  GGFAQIY V+ L  +  F+ +        +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEY 111
           +ACLKRV V D+  LN +R EV+ MK L    +VV Y DS+A+R       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGG 171
           C    L+D+MN RL  +LTE EI+ IM      I+ MH L  PL+HRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWA 231
            +K+ DFGS S         Q++  +  +I  +TT QYR PEM+DLYR LPI+EK+DIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQ 291
           LG+FLYKL ++TTPFE  G+ AILH++++FP    YS +L NLI  ML E+P+ RPN+ Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRMQNVPCPIRNFY 310
           VL  +  + NV  PI + Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  282 bits (722), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 196/313 (62%), Gaps = 9/313 (2%)

Query: 6   LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMG--------LFNGSNVACLKR 57
           L+ +  G+ + VG H V++++YL  GGFA IY V  +           +    +  CLKR
Sbjct: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85

Query: 58  VKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGL 117
           V+V D+  LN LR EV+ MK L N  ++V Y DS+A+R       YEV LLME C  G L
Sbjct: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145

Query: 118 IDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCD 177
           +D+MN RL  +L+E E+L IM   T G++ MH    PL+HRDIKIENVL+     +K+CD
Sbjct: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205

Query: 178 FGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLY 237
           FGS S  +    + QE+  + ++I  +TT QYR PEM+DLYR LPI+EK+DIWALG+FLY
Sbjct: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265

Query: 238 KLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVS 297
           KL +YTTPFE  G+ AILH++++ P   ++S +L NL+  ML E+P  RPNV QV+  + 
Sbjct: 266 KLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324

Query: 298 RMQNVPCPIRNFY 310
            M      I + Y
Sbjct: 325 SMMECEVKIDDLY 337

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  278 bits (711), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 195/310 (62%), Gaps = 10/310 (3%)

Query: 12  GTQLTVGTHSVKILKYLTSGGFAQIYA---------VEILSMGLFNGSNVACLKRVKVPD 62
           G  + VG H V+I+KYL  GGFA+IY          ++I  + +    ++ CLKRV V D
Sbjct: 102 GHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLKRVLVTD 161

Query: 63  KLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMN 122
              LN +R EV  MK L    ++V   DS+A+R       YEV LLME C    L+D+MN
Sbjct: 162 DNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKSLLDYMN 221

Query: 123 TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVS 182
            RL  +LTEPEIL IM   T  +A MH L  PL+HRDIKIENVL+     +K+CDFGS S
Sbjct: 222 QRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLCDFGSTS 281

Query: 183 GVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYY 242
             +      +++  +  ++  +TT QYR PEM+D+YR + I+EK+DIWALG+FLYKL +Y
Sbjct: 282 TCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFLYKLLFY 341

Query: 243 TTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQNV 302
            TPFE+ G+ AILH++++FP   +YS +L NLI  ML E+P+ RPN+ QVL  + ++ N+
Sbjct: 342 ITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYICKIINI 400

Query: 303 PCPIRNFYLL 312
             PI + Y L
Sbjct: 401 KTPIDDIYGL 410

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  285 bits (729), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 214/354 (60%), Gaps = 19/354 (5%)

Query: 6   LDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-----------MGLFNGSNVAC 54
           +++   G  ++VG H VKI  YL  GGFAQIY V+ +            +      ++AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGT--YEVFLLMEYC 112
           LKRV V D+  LN +R EV+ MKLL    ++V Y DS+A R   NDG   YE+ LLME C
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRR--NDGLNGYEILLLMELC 149

Query: 113 EGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGI 172
               L+D+MN RL+ +L E EI+ IM  TT  ++ MH L  PL+H+DIK+EN+L+     
Sbjct: 150 PNNSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNN 209

Query: 173 YKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWAL 232
           +K+CDFGS S       +  ++  +  +I  +TT QYR PEM+DLYR LPI+E +DIWAL
Sbjct: 210 FKLCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWAL 269

Query: 233 GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
           GVFLYKL ++ TPFE+ G+ +ILHA+F  P   NY  +L NLI  ML E+ + RPN+ QV
Sbjct: 270 GVFLYKLLFFITPFERTGQFSILHAKFDIP-VNNYHPKLINLIIIMLSENLNLRPNIYQV 328

Query: 293 LEEVSRMQNVPCPIRNFYLLRAMEKVKLST---EIDYPQLQLQKLRNAQADNLS 343
           + E+  + N P PI + Y +      K +T    +   Q+++ +L+N  + N+S
Sbjct: 329 MYEICSITNTPLPIEDKYGMGPYNFDKYATFQNNLQNIQMKMFELQNNHSHNIS 382

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 147/335 (43%), Gaps = 55/335 (16%)

Query: 13  TQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVP--DKLSLNILR 70
           + ++V  H   I + L  GGF+ +Y VE    GL        LK+++ P     S++   
Sbjct: 17  SYVSVNGHRYHIKRLLGEGGFSFVYLVESRENGLMA------LKKIRCPFGSIGSISPAM 70

Query: 71  AEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQN--R 128
            EVD  +    + ++   IDS   +    DG+  V++L+ Y   G L D +N  L +  +
Sbjct: 71  KEVDNYQKF-KSPYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQ 127

Query: 129 LTEPEILDIMSQTTQGIAVMHALVPP---------------------------------- 154
           + E E++ +     +G+  +H   P                                   
Sbjct: 128 VPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQ 187

Query: 155 -LLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPE 213
              H DIK  N+++S  G+  + D GS S       ++Q LL  Q    ++ T  +  PE
Sbjct: 188 AYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPE 247

Query: 214 MLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEK---LGEPAILHA----RFQFPSFPN 266
           +LD+     I EK D+W+ G  +Y +C+  +PFE+   +   ++ ++    ++  PS  N
Sbjct: 248 ILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTN 307

Query: 267 YSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQN 301
           YS  L +++K  L   P  RP+V +++  +  +Q+
Sbjct: 308 YSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQS 342

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 142/336 (42%), Gaps = 61/336 (18%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVD 74
           +++     +I K L  GG + +Y VE     LF       LK+ + P       + +   
Sbjct: 19  VSINGRKYRIQKLLGEGGLSFVYLVESKEGELFA------LKKTRCP----FGSIGSISP 68

Query: 75  AMKLLANNK-----HVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQN-- 127
           AMK +AN +     ++   +DS   +    DG+  V++L+ Y   G L D +N  L +  
Sbjct: 69  AMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCT 126

Query: 128 RLTEPEILDIMSQTTQGIAVMHALVP-------------------PLL------------ 156
           +++E +IL +     +G+  +H   P                    LL            
Sbjct: 127 QMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQ 186

Query: 157 ----HRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCP 212
               HRD+K  N+++S   +  + D GS S       ++Q LL  Q     N T  Y  P
Sbjct: 187 QSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAAP 246

Query: 213 EMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEP-------AILHARFQFPSFP 265
           E+LD+     I EK DIW+ G  +Y +C+  +PFE+  +        AI   ++  P   
Sbjct: 247 EILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGT 306

Query: 266 NYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQN 301
           +YS  L  LI   L  +P  RP+V +++  +  +Q 
Sbjct: 307 SYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 85/340 (25%), Positives = 148/340 (43%), Gaps = 65/340 (19%)

Query: 24  ILKYLTSGGFAQIYAVEIL-------SMGLFNGSNVACLKRVKVP--DKLSLNILRAEVD 74
           I + L  G  + +Y V+ L       S+ L N   +  LKR++ P  +  S++    EVD
Sbjct: 35  IRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIESISAAMKEVD 94

Query: 75  AMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRL--QNRLTEP 132
             K    + ++++ +DS   +    DG+  + +L+ Y   G L D +N  L     ++E 
Sbjct: 95  NYKRF-QSPYIITLVDSQVVQE--KDGSKTLCILLPYFPLGSLQDMVNRNLLKGTFVSEA 151

Query: 133 EILDIMSQTTQGIAVMH-------------------------ALV---PPL--------- 155
           E + IM    +G+  +H                         A +    PL         
Sbjct: 152 ECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPLELDVLSSHN 211

Query: 156 -------LHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQ 208
                  +HRDI++ N+L S  G+  V D GS          + +L  +Q  +  N +  
Sbjct: 212 TVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQDWVTANCSFP 271

Query: 209 YRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEP-------AILHARFQF 261
           Y  PE+L++     ID KADIW++G   Y + +  +PFE+  +        AI   ++ F
Sbjct: 272 YTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTYAIGCGKYTF 331

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQN 301
           P    YS+ L  +IKS L+  P+ RP++ ++L+ +  +Q 
Sbjct: 332 PKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQT 371

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 87/339 (25%), Positives = 143/339 (42%), Gaps = 61/339 (17%)

Query: 13  TQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVAC-----LKRVKVPDKLSLN 67
           T + V     KI + L  GG + +Y V++L   L   + VA      LK++  P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  ILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRL-- 125
               E++  K    + +V+  IDS   +    DG+  +++++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRF-QSPYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLTEPEILDIMSQTTQGIAVMH--------------------------ALV---PPL- 155
              ++E E + IM    +G+  +H                          A +    PL 
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 156 --------------LHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDI 201
                          HRDI   N+L S  G+  + D GS S       N+ +L  +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 MKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEP-------AI 254
             N T  Y  PE+L L     +D K DIW+LG   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
              ++ FP    +S+ L ++IK  ++  P  RP   Q+L
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/333 (24%), Positives = 141/333 (42%), Gaps = 61/333 (18%)

Query: 13  TQLTVGTHSVKILKYLTSGGFAQIYAVEIL--SMGLFNGSNVA---CLKRVKVPDKLSLN 67
           T + V     KI + L  GG + +Y V++L  S+ + N +  A    LK++  P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  ILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRL-- 125
               E++  K    + +V+  IDS   +    DG+  +++++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRF-QSPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLTEPEILDIMSQTTQGIAVMH------------------------------------ 149
              ++E E + IM   T+G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 150 --------ALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDI 201
                   A +    HRDI   N+L S  G+  + D GS S       N+ +L  +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 MKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEP-------AI 254
             N T  Y  PE+L+L     +  K DIW++G   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LHARFQFPSFPNYSDRLKNLIKSMLREHPSDRP 287
              ++ FP    +S+RL ++IK  ++  P  RP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 138/305 (45%), Gaps = 49/305 (16%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN--------ILRAEVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP   S N         LR+EV  +K L ++
Sbjct: 1184 GSFGAVY----LCLNVTTGEMMA-VKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DH 1237

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          D  Y +FL  EY  GG +   +  R+  R  EP I  + +Q  
Sbjct: 1238 LNIVQYLGFE-----NKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVL 1288

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL + GI K+ DF    G+ R  ++    +Y   D+ 
Sbjct: 1289 KGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKD----IYSNSDMT 1338

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF- 261
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L    ++ A F+  
Sbjct: 1339 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIG 1393

Query: 262  ----------PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQNVPCPIRNFYL 311
                       + P  S   +  + +    +P  RP   ++L     + NV    ++  L
Sbjct: 1394 KSKSAPPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELLSHRFSVVNVTFDFKSTEL 1453

Query: 312  LRAME 316
             + ++
Sbjct: 1454 AKFIK 1458

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 131/274 (47%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K +  +++VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVA---KLSIKSEKTRKKLLSEIQIHKSM-KHQNVV 142

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID       TN     V++L+E C  G L+D +  R    LTEPE+    +Q    I 
Sbjct: 143 QFID--CFEDDTN-----VYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   +    K+ DFG ++ V+   R ++  +          T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDRERKYTV--------CGT 242

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH----ARFQFP 262
             Y  PE+L + +      + DIW++GV LY L     PF+      I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFP 301

Query: 263 SFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
              + S+  K LI+ +L   P +RP++ ++++ V
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 129/271 (47%), Gaps = 28/271 (10%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++     +F    VA   ++ +  + + N L +E+   K + + +++V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRH-QNIV 158

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID         +    V++L+E C  G L+D +  R    LTEPE+    +Q    + 
Sbjct: 159 HFIDCF-------EDDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    K+ DFG ++ +I    N+ E  Y         T
Sbjct: 210 HMHS--RNIIHRDLKLGNIFFDKDFNLKIGDFG-LAAIIN---NENERKYTIC-----GT 258

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQFP 262
             Y  PE++   + +    + DIW+LGV ++ +     PF+      I     H  + FP
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFP 318

Query: 263 SFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
           +    S  +K LI+ +L  +P +RP + ++L
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 86/351 (24%), Positives = 140/351 (39%), Gaps = 81/351 (23%)

Query: 18  GTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMK 77
           G H   I + L  GGF+ +Y V+         +++  LK++  P       + +  +AM+
Sbjct: 25  GQH-YAIQRLLGEGGFSFVYLVQSR-----ENNDLFALKKIHCP----FGNIESVSEAMR 74

Query: 78  LLANNKHVVSYIDSHATRSPT---NDGTYEVFLLMEYCEGGGLID--------------- 119
            + + K   S   +H   S      DG+  VF+L+ Y   G L+D               
Sbjct: 75  EVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGTTISEE 134

Query: 120 ------------------------------FMNTRLQNR-------------LTEPEILD 136
                                          +NT LQ R             L +   LD
Sbjct: 135 EIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDSLELD 194

Query: 137 IMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLY 196
           ++S  T       A      H+DIK  N++ S  G+  +CD GS S       ++ +L+ 
Sbjct: 195 VLSGNTSSFM---ASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVE 251

Query: 197 VQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGE----- 251
            Q    ++ T  +R PE+L++     IDEK DIW+LG  LY +C+  +PFE+  +     
Sbjct: 252 FQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGAS 311

Query: 252 --PAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300
              AI   +F  P   NYS  L  +IK  +      RP++ ++L  +  +Q
Sbjct: 312 MTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQ 362

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 133/286 (46%), Gaps = 33/286 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K +  + ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-KHPNIV 133

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            + D         D T  V++L+E C  G L+D +  R Q  LTEPE+    +Q    I 
Sbjct: 134 QFTDCF------EDDT-NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    K+ DFG ++ V+   R ++  +          T
Sbjct: 185 YMHS--RRIIHRDLKLGNIFFDKHFNLKIGDFG-LAAVLANDRERKYTIC--------GT 233

Query: 207 AQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHAR-----FQ 260
             Y  PE+L   + G   +   DIW++GV +Y L     PF+   E   ++ R     F 
Sbjct: 234 PNYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQA-KEVNTIYERIKVCDFS 290

Query: 261 FPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQNVPCPI 306
           FP     S   K LIK +L   P +RP++ +++E V      P  I
Sbjct: 291 FPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFPARI 336

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 133/275 (48%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K +  + +VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-RHFNVV 151

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID         D T  V++L+E C  G L++ +  R    +TEPE+   M+Q    I 
Sbjct: 152 QFIDCF------EDDT-NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    K+ DFG ++ V+   R ++  +          T
Sbjct: 203 YMHS--RRVIHRDLKLGNIFFDKNYNLKIGDFG-LAAVLANDRERKYTV--------CGT 251

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHAR-----FQF 261
             Y  PE+L + +      + DIW++GV +Y L     PF+   +  +++ R     F F
Sbjct: 252 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQS-KDVNMIYERIKNRDFAF 309

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P     S+  K LI  +L   P +RP++ ++++ V
Sbjct: 310 PKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 109/220 (49%), Gaps = 33/220 (15%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           E++L++EY +GG L D++ ++   +L+EPE +   +Q  QG++  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSF--NICHRDLKPE 255

Query: 164 NVLL-SKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTA--QYRCPEML--DLY 218
           N+LL  K  + K+ DFG  +            L + + +++ +     Y  PE++    Y
Sbjct: 256 NLLLDKKNKVIKIADFGMAA------------LELPNKLLETSCGSPHYASPEIVMGKPY 303

Query: 219 RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQFPSFPNYSDRLKNL 274
            G P    +D+W+ G+ L+ L     PF       +L      RFQ P  P  ++  K+L
Sbjct: 304 HGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTNDAKDL 357

Query: 275 IKSMLREHPSDRPNVCQVLEE--VSRMQNVPCPIRNFYLL 312
           I  +L  +P  R  + ++L    + + +N P  IR   LL
Sbjct: 358 ITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLL 397

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 130/282 (46%), Gaps = 49/282 (17%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN--------ILRAEVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP   S N         LR+EV  +K L ++
Sbjct: 1184 GSFGAVY----LCLNVTTGEMMA-VKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DH 1237

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          +  Y +FL  EY  GG +   +  R+  R  EP I  + +Q  
Sbjct: 1238 LNIVQYLGFE-----NKNNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVL 1288

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL + GI K+ DF    G+ R  ++    +Y   D+ 
Sbjct: 1289 KGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKD----IYSNSDMT 1338

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF- 261
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L    ++ A F+  
Sbjct: 1339 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIG 1393

Query: 262  ----------PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
                       + P  S   +N + +    +P  RP   ++L
Sbjct: 1394 KSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 131/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K +  + ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-RHPNIV 133

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            + D       TN     V++L+E C  G L+D +  R Q  LTEPE+    +Q    I 
Sbjct: 134 QFTD--CFEDDTN-----VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    K+ DFG ++ V+   R ++  +          T
Sbjct: 185 YMHS--RRIIHRDLKLGNIFFDKHFNLKIGDFG-LAAVLANDRERKYTIC--------GT 233

Query: 207 AQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHAR-----FQ 260
             Y  PE+L   + G   +   D+W++GV +Y L     PF+   E   ++ R     F 
Sbjct: 234 PNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQA-KEVNTIYERIKVCDFN 290

Query: 261 FPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           FP     S   K LIK +L   P +RP++ +++E V
Sbjct: 291 FPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 89.7 bits (221), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 131/275 (47%), Gaps = 29/275 (10%)

Query: 26  KYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHV 85
           ++L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K +++  ++
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHT-NI 140

Query: 86  VSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGI 145
           V +ID         +    V++L+E C  G L++ +  R    +TEPE+   M+Q   GI
Sbjct: 141 VQFIDCF-------EDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNT 205
             MH+    ++HRD+K+ N+   +    K+ DFG ++ V+   R ++  +          
Sbjct: 192 QYMHS--NRVIHRDLKLGNIFFDEHYNLKIGDFG-LAAVLANDRERKFTI--------CG 240

Query: 206 TAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQF 261
           T  Y  PE+L + +      + DIW++GV LY L     PF+      I        F +
Sbjct: 241 TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAY 299

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P     S   K LI  +L  +P +RP++ ++++ V
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 86/320 (26%), Positives = 144/320 (45%), Gaps = 54/320 (16%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPD--------KLSLNILRAEVDAMKLLANN 82
            G F  +Y    LS+ +  G  +A +K+V+VP         K  +  L++EV  +K L ++
Sbjct: 1160 GSFGAVY----LSLNITTGEMMA-VKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-DH 1213

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+ S           Y +FL  EY  GG +   +  RL  R  E  I  + +Q  
Sbjct: 1214 LNIVQYLGSE-----IRGNIYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVL 1264

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
             G+  +H+    +LHRD+K +N+LL + GI K+ DF    G+ +  +N    +Y   D+ 
Sbjct: 1265 SGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKN----IYSNSDMT 1314

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF- 261
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L    ++ A FQ  
Sbjct: 1315 MRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFQIG 1369

Query: 262  -----PSFPN-----YSDRLKNLIKSMLREHPSDRPNVCQVLEE-VSRMQNVPCPIRNFY 310
                 P  P+      S + K+ +       P  RP    +LE   S++     P  NF 
Sbjct: 1370 KSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLEHSFSKVD----PAFNFS 1425

Query: 311  LLRAMEKVKLSTEIDYPQLQ 330
              R  E +K + +++   L+
Sbjct: 1426 RTRLYEFIKTNDKLNSSVLR 1445

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 126/274 (45%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ +     S  +F    VA   ++ +  + +   L +E+   K +  N ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVA---KLSIKSEKTRRKLLSEIQIHKSM-KNVNIV 143

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID       TN     V++L+E C  G L+D +  R    LTEPE+    +Q    I 
Sbjct: 144 QFID--CFEDDTN-----VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    K+ DFG ++ V+   R ++  +          T
Sbjct: 195 YMHS--RRVIHRDLKLGNIFFDKDYNLKIGDFG-LAAVLANDRERKYTV--------CGT 243

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH----ARFQFP 262
             Y  PE+L + +      + DIW++GV LY L     PF+      I        F FP
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 263 SFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
                S   K LI+ +L   P +RP+V ++++ V
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 95/195 (48%), Gaps = 23/195 (11%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +V++ +EYC G  L +++   +Q+R++  E   + +Q    +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSL--QCVHRDLKLE 157

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDL--YRGL 221
           N+LL K G  K+ DF    G  R    +  L  V        T  Y  PE+++   Y G 
Sbjct: 158 NILLDKKGRAKITDF----GFTRECATKTMLETVC------GTTVYMAPELIERKSYDGF 207

Query: 222 PIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPN---YSDRLKNLIKSM 278
            I    DIW+LGV LY + + T PF++  E            F N    S   K+LI  +
Sbjct: 208 KI----DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQL 263

Query: 279 LREHPSDRPNVCQVL 293
           L + PS RP + QVL
Sbjct: 264 LCKDPSQRPQLSQVL 278

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/333 (25%), Positives = 146/333 (43%), Gaps = 61/333 (18%)

Query: 13  TQLTVGTHSVKILKYLTSGGFAQIYAVEIL--SMGLFNGS---NVACLKRVKVPDKLSLN 67
           T + V     KI + L  GG + +Y V++L  S+ + NG     +  LK++  P   S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  ILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRL-- 125
               E++  K    + +V+  IDS  T+    +G+  +++++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRF-QSPYVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLTEPEILDIMSQTTQGIAVMH--------------------------ALV---PPL- 155
              ++E E + IM   T+G+  +H                          A++    PL 
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 156 --------------LHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDI 201
                          HRDI   N+L S  G+  + D GS S       ++ +L  +Q  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 MKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEK---LGEPAILHA- 257
             N T  Y  PE+L+L     +  K DIW++G   Y L +  +PFE+   +   +I +A 
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 258 ---RFQFPSFPNYSDRLKNLIKSMLREHPSDRP 287
              ++ FP    +S+ L N+IK  ++  P  RP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 88/179 (49%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +   L+  +TE E   I  Q    I  +H+    ++HRDIK ENV++   G  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEK-ADIWALG 233
            + DFGS + V   P +    ++V        T  Y  PE+L    G P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 234  VFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            V LY + +   PF  + E  IL    +F      S+   NLIK +L ++PS RP + +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/347 (23%), Positives = 143/347 (41%), Gaps = 67/347 (19%)

Query: 12  GTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRA 71
           G ++++   S  +   L  G    +Y V+       +   V  LK+V  P   +  + RA
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALYQVKCPKRS--HSGGVYALKKVTCPIGRADFVTRA 78

Query: 72  --EVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRL--QN 127
             E+   +   N+ ++ + +D    +   ++GT  +++L+ Y   G L D +N  +   +
Sbjct: 79  MTEISNYQRF-NSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNMIIRGD 135

Query: 128 RLTEPEILDIMSQTTQGIAVMHA------------------------------------- 150
            L+E  ++ +M    +G+  MH                                      
Sbjct: 136 SLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDL 195

Query: 151 LVPPL--------LHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPP---RNQQELLYVQH 199
           L PPL        +H  +  EN++LS  G+  + +  S    +R P    +  +LL +Q 
Sbjct: 196 LSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLGLQE 252

Query: 200 DIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEK----LGEP--- 252
            + +N+   Y CPE+LDL+    I  + DIW+LG   Y L Y  + F +     G P   
Sbjct: 253 WLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKH 312

Query: 253 AILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRM 299
           +I    F FP  P YS  LK +++  L   P  RP++ + L +   +
Sbjct: 313 SISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K +  + ++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVA---KLSIKTEKTRKKLLSEIQIHKSM-RHANIV 161

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID     +        V++L+E C  G L++ +  R    LTEPE+    +Q   GI 
Sbjct: 162 QFIDCFEDET-------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    K+ DFG ++ V+   R ++  +          T
Sbjct: 213 YMHS--RRVIHRDLKLGNIFFDKNYNLKIGDFG-LAAVLANDRERKYTV--------CGT 261

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH----ARFQFP 262
             Y  PE+L + +      + DIW++GV +Y L     PF+      I        F FP
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 263 SFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
                S   + L++ +L   P +RP++ +VL+ V
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 135/294 (45%), Gaps = 41/294 (13%)

Query: 11  VGTQLTVG-THSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNIL 69
           +G  L +G T  V++    T+G  A   A++++S  +F  SNV  +     PD L   I 
Sbjct: 20  MGETLGLGSTGKVQLAYNKTTGNQA---AIKVISKTIFQDSNVTSMVDNTTPDALPYGIE 76

Query: 70  RAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRL 129
           R E+  MKLL N+ +V+   D   T S        +++++EY E G L + +  R    L
Sbjct: 77  R-EIVIMKLL-NHANVLRLYDVWETNS-------NLYMVLEYAEKGELFNLLVER--GPL 125

Query: 130 TEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPR 189
            E E +    Q   GI+  HAL   ++HRD+K EN+LL      K+ DFG  +       
Sbjct: 126 PENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMAA------- 176

Query: 190 NQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDEKA-DIWALGVFLYKLCYYTTPF 246
                L  +  +++ +     Y  PE++    G+P    A D+W+ GV LY L     PF
Sbjct: 177 -----LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILYALLTGRLPF 228

Query: 247 -EKLGEP-----AILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
            E+ G        +   +F+ P     S   +NLI  +L  +P++R     +L+
Sbjct: 229 DEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 137/323 (42%), Gaps = 61/323 (18%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSNVA-----CLKRVKVPDKLSLNILRAEVDAMK 77
           +I + L  GG + +Y V++    L   + +A      LK++  P   S++    E++  K
Sbjct: 31  RIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMREIENYK 90

Query: 78  LLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRL--QNRLTEPEIL 135
               + +V+  IDS   +    DG+  +++++ Y   G L D +N RL     ++E E +
Sbjct: 91  RF-QSPYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGTFVSEAECV 147

Query: 136 DIMSQTTQGIAVMH--------------------------ALV---PPL----------- 155
            IM   T+G+  +H                          A++    PL           
Sbjct: 148 RIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDMLSSNSAG 207

Query: 156 ----LHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRC 211
                HRDI   N+L S  G+  + D GS S       N+ +L  +Q  +  N T  Y  
Sbjct: 208 SIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNCTLPYTP 267

Query: 212 PEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEP-------AILHARFQFPSF 264
           PE+L+L     +  K DIW+LG   Y L +  +PFE+  +        AI   ++ FP  
Sbjct: 268 PELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFPRN 327

Query: 265 PNYSDRLKNLIKSMLREHPSDRP 287
             +S+ L ++IK  ++  P  RP
Sbjct: 328 SRFSEGLLSVIKKCIQVDPIQRP 350

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 93/196 (47%), Gaps = 21/196 (10%)

Query: 100  DGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRD 159
            D  Y    L  + E G +  F    L+  +TE E   I  Q   GI  +H     ++HRD
Sbjct: 872  DDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLHD--QGIVHRD 929

Query: 160  IKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DL 217
            IK ENV++   G  K+ DFGS +     P      ++V        T  Y  PE+L  + 
Sbjct: 930  IKDENVIVDSNGFVKLIDFGSAAYTKTGPFE----VFVG-------TIDYAAPEILGGNP 978

Query: 218  YRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKS 277
            Y+G P     DIWALGV LY L Y   PF  + E  IL  + +F    N +    +LI+ 
Sbjct: 979  YKGKP----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRW 1032

Query: 278  MLREHPSDRPNVCQVL 293
            +L +  +DRP++ +++
Sbjct: 1033 ILTKSVNDRPSIDEIV 1048

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 98/199 (49%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           E++L++EY +GG L D++ ++   +LTE E +    Q   GI+  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSF--NICHRDLKPE 264

Query: 164 NVLLSKG-GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTA--QYRCPEML--DLY 218
           N+LL K   I K+ DFG  +            L V + +++ +     Y  PE++    Y
Sbjct: 265 NLLLDKKRRIIKIADFGMAA------------LQVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 219 RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQFPSFPNYSDRLKNL 274
            G P    +DIW+ G+ L+ L     PF       +L    + R+Q PS+   S   KNL
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 275 IKSMLREHPSDRPNVCQVL 293
           I  +L   PS R +  Q+L
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 130/282 (46%), Gaps = 49/282 (17%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN--------ILRAEVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP   S N         LR+EV  +K L ++
Sbjct: 1187 GSFGAVY----LCLNVTTGEMMA-VKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-DH 1240

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          +  Y +FL  EY  GG +   +  R+  R  E  I  + +Q  
Sbjct: 1241 LNIVQYLGFE-----NKNNIYSLFL--EYVAGGSVGSLI--RMYGRFDESLIRHLTTQVL 1291

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL + GI K+ DF    G+ R  ++    +Y   D+ 
Sbjct: 1292 KGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKD----IYSNSDMT 1341

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF- 261
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L    ++ A F+  
Sbjct: 1342 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIG 1396

Query: 262  ----------PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
                       + P  S   ++ + +    +P +RP   ++L
Sbjct: 1397 KSKSAPPIPEDTLPLISQVGRSFLDACFEINPEERPTATELL 1438

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 129/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   +  +  + +   L +E+   K +A+  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAH-PNIV 142

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            ++D     S        V++L+E C  G L++ +  R    LTEPE+    +Q    I 
Sbjct: 143 QFVDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+        K+ DFG ++ V+    N+ E  Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLA---NESERKYTI-----CGT 242

Query: 207 AQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI---LHAR-FQF 261
             Y  PE+L   + G   +   DIW+LGV LY L     PF+      I   +  R F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P     SD  K LI+ +L   P +RP++ ++++ V
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 129/274 (47%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K +  + ++V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSM-KHPNIV 152

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            ++D         D T  V++L+E C  G L+D M  R    LTEPE+    +Q    + 
Sbjct: 153 HFVDCF------EDDT-NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    KV DFG ++ V+   R ++  +          T
Sbjct: 204 YMHS--RRVIHRDLKLGNIFFDKDYNLKVGDFG-LAAVLANNRERKYTVC--------GT 252

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH----ARFQFP 262
             Y  PE+L + +      + DIW++GV +Y L     PF+      I       ++ +P
Sbjct: 253 PNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYP 311

Query: 263 SFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
                S   K LI  +L   P +RP++ +++++V
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 110/224 (49%), Gaps = 35/224 (15%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLS--------LNILRAEVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP   S        +  LR+EV  +K L ++
Sbjct: 1223 GSFGAVY----LCLNVTTGEMMA-VKQVEVPKYSSQDEAIISTVEALRSEVSTLKDL-DH 1276

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          D  Y +FL  EY  GG +   +  R+  R  EP I  + +Q  
Sbjct: 1277 LNIVQYLGFE-----NKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVL 1327

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL + G+ K+ DF    G+ R  ++    +Y   D+ 
Sbjct: 1328 RGLAYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSKD----IYSNSDMT 1377

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPF 246
               T  +  PEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1378 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1419

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 131/290 (45%), Gaps = 39/290 (13%)

Query: 16  TVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRV--KVPDKLSLNILRAEV 73
           T+G  S   ++   +G   Q  AV+++S  +FN  NV+    V    PD L   I R E+
Sbjct: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER-EI 82

Query: 74  DAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPE 133
             MKLL N+ +V+   D   T +       +++L++EY E G L + +  R    L E E
Sbjct: 83  IIMKLL-NHPNVLRLYDVWETNT-------DLYLVLEYAEKGELFNLLVER--GPLPEHE 132

Query: 134 ILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQE 193
            +    Q   G++  HAL   ++HRD+K EN+LL      K+ DFG  +           
Sbjct: 133 AIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA----------- 179

Query: 194 LLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDEKA-DIWALGVFLYKLCYYTTPF-EKL 249
            L  +  +++ +     Y  PE++    G+P    A D+W+ GV L+ L     PF E+ 
Sbjct: 180 -LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLPFDEED 235

Query: 250 GEPAIL-----HARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           G    L        F+ PS    S   ++LI+ +L   P  R     +L+
Sbjct: 236 GNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 129/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   +  +  + +   L +E+   K +A+  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAH-PNIV 142

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID     S        V++L+E C  G L++ +  R    L+EPE+    +Q    I 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+        K+ DFG ++ V+    N+ E  Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLA---NESERKYTI-----CGT 242

Query: 207 AQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI---LHAR-FQF 261
             Y  PE+L   + G   +   DIW+LGV LY L     PF+      I   +  R F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P     SD  K LI+ +L   P +RP++ ++++ V
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 96/202 (47%), Gaps = 37/202 (18%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +V++ +EYC G  L D + ++  +RL   E  ++ +Q T  +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTL--NCVHRDLKLE 162

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDL--YRGL 221
           NVLL K G  K+ DFG           ++ +     + +  TT  Y  PEM+    Y G 
Sbjct: 163 NVLLDKNGNAKLTDFGFT---------RESMTKAVLETVCGTTV-YMAPEMIQHKPYDGF 212

Query: 222 PIDEKADIWALGVFLYKLCYYTTPFEK----------LGEPAILHARFQFPSFPNYSDRL 271
               K DIW+LGV LY L     PF++          + +  ++  R   P         
Sbjct: 213 ----KVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIP-------EA 261

Query: 272 KNLIKSMLREHPSDRPNVCQVL 293
           +NLI+ +L + P++RPN   +L
Sbjct: 262 QNLIEQLLSKDPTERPNTSAIL 283

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 97/203 (47%), Gaps = 32/203 (15%)

Query: 103 YEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKI 162
           Y ++++MEYC GG   D + T  +  L E ++  ++     G+  +HA     +HRDIK 
Sbjct: 85  YLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHA--QHKIHRDIKA 142

Query: 163 ENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLP 222
            N+LL+  G+ KV DFG VS  +R     +  +          T  +  PE++ +  G+ 
Sbjct: 143 ANILLTDSGLVKVADFG-VSAEMRSTMKAKTFV---------GTPYWMAPEVV-MNEGMG 191

Query: 223 IDEKADIWALGVFLYKLCYYTTPFEKLG-----------EPAILHARFQFPSFPNYSDRL 271
            +EK+DIW+LG+  Y+L     P  K             +P  LH          Y++ +
Sbjct: 192 YNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGA--------YTNLV 243

Query: 272 KNLIKSMLREHPSDRPNVCQVLE 294
           K+ I + L + P  RP+  ++LE
Sbjct: 244 KHFIATCLIKDPEKRPSASELLE 266

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 129/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   +  +  + +   L +E+   K +++  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSH-PNIV 142

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID     S        V++L+E C  G L++ +  R    LTEPE+    +Q    I 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+        K+ DFG ++ V+    N+ E  Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLA---NESERKYTI-----CGT 242

Query: 207 AQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI---LHAR-FQF 261
             Y  PE+L   + G   +   DIW+LGV LY L     PF+      I   +  R F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P     SD  K LI+ +L   P +RP++ ++++ V
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 127/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K + ++ ++V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHS-NIV 155

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID     +        V++L+E C  G L+D +  R    LTEPE+    +Q    I 
Sbjct: 156 QFIDCFEDDA-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            +H+    ++HRD+K+ N+   K    KV DFG ++ V+   R ++  +          T
Sbjct: 207 YLHS--RRIIHRDLKLGNIFFDKDYNLKVGDFG-LAAVLANDRERKYTVC--------GT 255

Query: 207 AQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH----ARFQF 261
             Y  PE+L   + G   +   DIW++GV +Y L     PF+      I       ++ +
Sbjct: 256 PNYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYGY 313

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P     S   + LI  +L  +P  RP +  ++++V
Sbjct: 314 PKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 84.7 bits (208), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 138/336 (41%), Gaps = 66/336 (19%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGS-----NVACLKRVKVP--DKLSLN 67
           L++      I K L    F+ IY V+   +G    S     N+  LKR++ P  +  S++
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQ--QIGSVTASSTPRTNLYALKRIRCPFGNIESIS 83

Query: 68  ILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQN 127
               EVD  K    + +++  +DS   +    DG+  V++L+ Y   G L D  +  L N
Sbjct: 84  GAMKEVDNYKRF-QSPYIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLN 140

Query: 128 R--LTEPEILDIMSQTTQGIAVMH--------------------------ALV---PPL- 155
              ++E E + I+    +G+  +H                          A +    PL 
Sbjct: 141 GTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLE 200

Query: 156 ---------------LHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHD 200
                           HRDIK  N+L S  G+  + + GS S          +L  +Q  
Sbjct: 201 LDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAW 260

Query: 201 IMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGE-------PA 253
           +  + T  Y  PE+L +     +D K DIW+LG   Y + +  +PFE+  +        A
Sbjct: 261 VSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYA 320

Query: 254 ILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNV 289
           I    F FPS   YS+ L  LI   L+ +P+ RP++
Sbjct: 321 IGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + +   S  LF    VA   ++ +  + +   L +E+   K +  ++++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVA---KLSIKTEKTRKKLLSEIQIHKSM-KHQNIV 205

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID         D T  V++L+E C  G L++ +  R Q  LTEPE+    +Q    I 
Sbjct: 206 QFIDCF------EDDT-NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   +    K+ DFG ++ V+   R ++             T
Sbjct: 257 YMHS--RRVIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDRERK--------FTVCGT 305

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH----ARFQFP 262
             Y  PE+L + +      + D+W++GV +Y L     PF+      I        F FP
Sbjct: 306 PNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFP 364

Query: 263 SFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
                S   K L++ +L   P +RP++ ++++ V
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 129/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   +  +  + +   L +E+   K +++  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSH-PNIV 142

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID     S        V++L+E C  G L++ +  R    LTEPE+    +Q    I 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+        K+ DFG ++ V+    N+ E  Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLA---NESERKYTI-----CGT 242

Query: 207 AQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI---LHAR-FQF 261
             Y  PE+L   + G   +   DIW+LGV LY L     PF+      I   +  R F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P     SD  K LI+ +L   P +RP++ ++++ V
Sbjct: 301 PRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 102/198 (51%), Gaps = 29/198 (14%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +V++ +EYC G  L + +   + +R+   E   + +Q    +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSL--NCVHRDLKLE 157

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGL 221
           N+LL K G  K+ DF    G  R   ++  L     + +  TT  Y  PE++    Y G 
Sbjct: 158 NILLDKNGNAKLTDF----GFTRECVSKSSL-----ETICGTTV-YMAPELIQRQAYDGF 207

Query: 222 PIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPS-FPNYSDRL-----KNLI 275
            I    DIW+LGV LY +   T PF++  E      +++  + FPN++D       K+LI
Sbjct: 208 KI----DIWSLGVILYTMINGTMPFDEDDETK---TKWKIVNDFPNFNDNFVSHEAKDLI 260

Query: 276 KSMLREHPSDRPNVCQVL 293
           K +L + PS+RP + Q+L
Sbjct: 261 KRLLAKCPSERPTMEQIL 278

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 119/256 (46%), Gaps = 41/256 (16%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLS--------LNILRAEVDAMKLLANN 82
            G F  +Y    L++ +  G  +A +K+V VP+  S        +  L++EV  +K L N+
Sbjct: 1047 GSFGAVY----LALNVTTGEMLA-VKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          +G Y +FL  EY  GG +   +  R+  R  +  I  +  Q  
Sbjct: 1101 VNIVQYLGFEE-----KNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVL 1151

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL   G+ K+ DF    G+ R   N    +Y   D+ 
Sbjct: 1152 EGLAYLHS--KGILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNSDMT 1201

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF- 261
               T  +  PEM+D   G     K DIW+LG  + ++     P+       ++ A FQ  
Sbjct: 1202 MRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWSNF---EVVAAMFQIG 1256

Query: 262  --PSFPNYSDRLKNLI 275
               + P   D  K+L+
Sbjct: 1257 KSKTAPPIPDDTKDLV 1272

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 87/182 (47%), Gaps = 22/182 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +    +  +TE E   I  Q   GI+ +H     ++HRDIK ENV++   G  K
Sbjct: 1094 GCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLHE--SGIVHRDIKDENVIVDAKGFVK 1151

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWAL
Sbjct: 1152 LIDFGSAAYVKNGPFD----VFV-------GTIDYASPEVLRGEKYEGKP----QDIWAL 1196

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL    +FP   N S    +LIK +L     +RP++  +
Sbjct: 1197 GILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDI 1254

Query: 293  LE 294
             E
Sbjct: 1255 SE 1256

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 93/200 (46%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           E++L++EY EGG L D++  R   +L E E +    Q  QG++  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNF--NICHRDLKPE 193

Query: 164 NVLL-SKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTA--QYRCPE--MLDLY 218
           N+LL  K    K+ DFG  +            L   + +++ +     Y  PE  M   Y
Sbjct: 194 NLLLDKKNKTVKIADFGMAA------------LETTNRLLETSCGSPHYASPEIVMGQKY 241

Query: 219 RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQFPSFPNYSDRLKNL 274
            G P    +D+W+ G+ L+ L     PF       +L    H R+Q PS  N S   K+L
Sbjct: 242 HGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDL 295

Query: 275 IKSMLREHPSDRPNVCQVLE 294
           I  +L   P  R  V ++LE
Sbjct: 296 ISKILVVDPEKRITVDKILE 315

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 127/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHV- 85
           +L  GGFA+ + +   S  +F    VA   ++ +  + +   L +E+   K +   KHV 
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM---KHVN 153

Query: 86  -VSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQG 144
            V +ID       TN     V++L+E C  G L+D +  R    LTEPE+    +Q    
Sbjct: 154 IVQFID--CFEDDTN-----VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGA 204

Query: 145 IAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKN 204
           I  MH+    ++HRD+K+ N+   +    K+ DFG  + +     N +E  Y        
Sbjct: 205 IKYMHS--RKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLA----NDRERKYTV-----C 253

Query: 205 TTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI---LHAR-FQ 260
            T  Y  PE+L + +      + DIW++GV +Y L     PF+      I   +  R F 
Sbjct: 254 GTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFS 312

Query: 261 FPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           FP     S   K LI+ +L   P +RP+V ++++ +
Sbjct: 313 FPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +   L+N +TE E+  I  Q   GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLHD--QAIIHRDIKDENVIVDATGFVK 1329

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGPFD----VFV-------GTIDYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL     F    + S   K LI  +L  +   RP +  +
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

Query: 293  LEE 295
              +
Sbjct: 1433 YND 1435

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 127/279 (45%), Gaps = 43/279 (15%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLS--------LNILRAEVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP   S        ++ +++EV  +K L ++
Sbjct: 1263 GSFGAVY----LCLNVTTGEMMA-VKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKDL-DH 1316

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          D  Y +FL  EY  GG +   +  R+  R  EP I  +  Q  
Sbjct: 1317 LNIVQYLGFE-----NKDNIYSLFL--EYVAGGSVGSLI--RIYGRFDEPLIRHLNIQVL 1367

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G+A +HA    +LHRD+K +N+LL + G+ K+ DF    G+ R  ++    +Y   D+ 
Sbjct: 1368 RGLAYLHARG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSKD----IYSNSDMT 1417

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFP 262
               T  +  PEM+D  +G     K DIW+LG  + ++     P+      A +    +  
Sbjct: 1418 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGKSK 1475

Query: 263  SFPNYSDRLKNLIKSMLREH--------PSDRPNVCQVL 293
            S P   +    LI +  RE         P  RP   ++L
Sbjct: 1476 SAPPIPEDTLPLISAEGREFLDACFEIDPDKRPTADELL 1514

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 130/279 (46%), Gaps = 43/279 (15%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVP-----DKLSLNIL---RAEVDAMKLLANN 82
            G F  ++    L + +  G  +A +K+V+VP     D+ +L++L   R+EV  +K L ++
Sbjct: 1155 GSFGSVF----LGLNVTTGEMIA-VKQVEVPRYGSQDETTLSVLEALRSEVATLKDL-DH 1208

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          +  Y   L +EY  GG +   +  RL  +  E  I  +  Q  
Sbjct: 1209 TNIVQYLGFE-------NKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVL 1259

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G++ +H+    +LHRD+K +N+LL   GI K+ DF    G+ +   N    +Y   D+ 
Sbjct: 1260 RGLSYLHS--KKILHRDMKADNLLLDVDGICKISDF----GISKKSNN----IYSNSDMT 1309

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFP 262
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L   A +    +F 
Sbjct: 1310 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFK 1367

Query: 263  SFPNYSDRLKNLIKSMLRE--------HPSDRPNVCQVL 293
            S P   +  + +I +  +E        +P  RP   ++L
Sbjct: 1368 SAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELL 1406

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 110/227 (48%), Gaps = 35/227 (15%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN--------ILRAEVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP   S N         LR+EV  +K L ++
Sbjct: 1190 GSFGAVY----LCLNVTTGEMMA-VKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DH 1243

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          +  Y +FL  EY  GG +   +  R+  R  E  I  + +Q  
Sbjct: 1244 LNIVQYLGFE-----NKNSIYSLFL--EYVAGGSVGSLI--RMYGRFDESLIKHLTTQVL 1294

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL + GI K+ DF    G+ R  ++    +Y   D+ 
Sbjct: 1295 RGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKD----IYSNSDMT 1344

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKL 249
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L
Sbjct: 1345 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNL 1389

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 100/201 (49%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +V++ +EYC G  L D++   +  R+   E   + +Q    +   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSL--NCVHRDLKLE 157

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGL 221
           N+LL   G  K+ DFG         +NQ E +          T  Y  PE+L  D Y G 
Sbjct: 158 NILLDMQGNAKLADFGFTREC--ATKNQLETIC--------GTTVYMAPELLRRDTYDGF 207

Query: 222 PIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSF---PNYSDRLKN----- 273
            I    DIW+LGV LY L   + PF++  E      R ++      P+Y++++ N     
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANSIE 258

Query: 274 LIKSMLREHPSDRPNVCQVLE 294
           LIKS+L + P  RP++ ++L+
Sbjct: 259 LIKSLLIKDPKKRPSMTEILK 279

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 127/286 (44%), Gaps = 60/286 (20%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANN 82
           KILK +  G F ++Y      + L   ++   +  +K  DK   N++R      ++  + 
Sbjct: 40  KILKQIGEGSFGKVY------LALHKPTHKKVV--LKSSDKTDPNVVR------EIFYHR 85

Query: 83  KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
           +    YI        T     +V++++EYC    L D++ ++   R++  E   I +Q  
Sbjct: 86  QFDFPYITKLYEVIITE---TKVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIV 140

Query: 143 QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
             +   H+L    +HRD+K+EN+LL K    K+ DFG                    D  
Sbjct: 141 GAVYYAHSL--SCVHRDLKLENILLDKDNNAKLTDFG-----------------FTRDFS 181

Query: 203 KNT-------TAQYRCPEML--DLYRGLPIDEKADIWALGVFLYKLCYYTTPFE----KL 249
           KNT       T  Y  PE+L  + Y G  I    DIWALG+ LY +   T PF+    K 
Sbjct: 182 KNTQLETICGTTVYMAPELLRREKYDGYKI----DIWALGILLYTIINGTMPFDEDDPKK 237

Query: 250 GEPAILHARFQFPSFPN--YSDRLKNLIKSMLREHPSDRPNVCQVL 293
            E  I+ A    P + N  ++D   +L+  +L + PS RP + Q+L
Sbjct: 238 TELKIISAS---PDYDNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 132/295 (44%), Gaps = 42/295 (14%)

Query: 11  VGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNV-ACLKRVKVPDKLSLNIL 69
           +G  L +G+     L Y +S G  Q  A++++S  +FN  N  A    +  PD L   I 
Sbjct: 22  LGETLGLGSTGKVQLAYNSSTG--QQAAIKVISKAVFNNDNANASDSALLTPDSLPYGIE 79

Query: 70  RAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRL 129
           R E+  MKLL N+ +V+   D   T S        +++++EY E G L + +  R    L
Sbjct: 80  R-EIIIMKLL-NHPNVLRLYDVWETDS-------NLYMVLEYAEKGELFNLLVER--GPL 128

Query: 130 TEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPR 189
            E E +    Q   GI+  HAL   ++HRD+K EN+LL      K+ DFG  +       
Sbjct: 129 PENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA------- 179

Query: 190 NQQELLYVQHDIMKNTTA--QYRCPEMLDL--YRGLPIDEKADIWALGVFLYKLCYYTTP 245
                L  +  +++ +     Y  PE++    Y GL    + D+W+ G+ L+ L     P
Sbjct: 180 -----LETEDKLLETSCGSPHYAAPEIISGLPYHGL----ETDVWSCGIILFALLTGRLP 230

Query: 246 F-EKLGEP-----AILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           F E+ G        +   +F+ P     S   ++LI  +L   P  R    ++L+
Sbjct: 231 FDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 99/203 (48%), Gaps = 37/203 (18%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +V++ +EYC G  L D + +   +R+   E + + +Q   G+   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSL--NCVHRDLKLE 158

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNT------TAQYRCPEMLDL 217
           N+LL K G  K+ DFG                + +  + K T      T  Y  PE+++ 
Sbjct: 159 NILLDKSGDAKLTDFG----------------FTRECMTKTTLETICGTTVYMAPELIER 202

Query: 218 --YRGLPIDEKADIWALGVFLYKLCYYTTPF----EKLGEPAILHARFQFPSFPNYSDRL 271
             Y G  I    DIW+LGV LY +   + PF    E   E  I+H   Q       +D  
Sbjct: 203 KSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTAD-A 257

Query: 272 KNLIKSMLREHPSDRPNVCQVLE 294
           K+LI  +L ++P+DRP V Q+L+
Sbjct: 258 KDLILRLLAKNPNDRPTVEQILK 280

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 95/205 (46%), Gaps = 40/205 (19%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D +     N + E ++  I SQ  +G+  +H      +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHE--QKKIHRDIKAAN 143

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML----DLYRG 220
           +LL+  G  K+ DFG VSG IR    +   +          T  +  PE++    D Y  
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGTFV---------GTPYWMAPEVVSKENDGY-- 191

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFEKLG-----------EPAILHARFQFPSFPNYSD 269
              DEKADIW+LG+ +Y+L     P  K             +P  LH         +YS 
Sbjct: 192 ---DEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHG--------HYSH 240

Query: 270 RLKNLIKSMLREHPSDRPNVCQVLE 294
             KN + S L ++P  R +  +++E
Sbjct: 241 SAKNFVSSCLVKNPVGRASAYEMVE 265

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 132/280 (47%), Gaps = 43/280 (15%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLS--------LNILRAEVDAMKLLANN 82
            G F  ++    LS+ +  G  +A +K+++VP   S        +  +++EV  +K L ++
Sbjct: 1144 GSFGAVF----LSLNITTGEMMA-VKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDL-DH 1197

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+             Y +FL  EY  GG +   +  R+  R  +  I  + +Q  
Sbjct: 1198 LNIVQYLGFEMKH-----NIYSLFL--EYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVL 1248

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G++ +H+    +LHRD+K +N+LL + GI K+ DFG +S        + E +Y   ++ 
Sbjct: 1249 EGLSYLHS--QGILHRDMKADNLLLDQDGICKISDFG-IS-------KKSEDIYSNSEMT 1298

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFP 262
               T  +  PEM+D  +G   + K DIW+LG  + ++     P+        ++   Q  
Sbjct: 1299 MRGTVFWMAPEMVDTKQGY--NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSK 1356

Query: 263  SFPNYSDRLKNLI----KSMLRE----HPSDRPNVCQVLE 294
            S P   +  K+LI    K+ L +     P +RP   Q+LE
Sbjct: 1357 SAPPIPEDTKDLISPTAKNFLNQCFHIDPKERPTAGQLLE 1396

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 133/282 (47%), Gaps = 31/282 (10%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++     +F    VA   ++ +  + +   L +E+   K +  + ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVA---KLSIKSEKTRRKLLSEIQIHKSM-KHPNIV 150

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            + D       TN     V++L+E C  G +++ +  R +  LTEPE+   M Q    I 
Sbjct: 151 QFTD--CFEDDTN-----VYILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIR 201

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    K+ DFG ++ V+    N +E  Y         T
Sbjct: 202 YMHS--RRVIHRDLKLGNIFFDKEYNLKIGDFG-LAAVLA---NDKERKYTI-----CGT 250

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHAR-----FQF 261
             Y  PE+L   +      + DIW++GV LY L +   PF+   E   ++ R     F F
Sbjct: 251 PNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQA-KEVETIYERIKCRDFIF 308

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQNVP 303
           P+    S   KNLI  +L+ +P+ RP++ ++ + V      P
Sbjct: 309 PADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFP 350

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 84/296 (28%), Positives = 135/296 (45%), Gaps = 43/296 (14%)

Query: 11  VGTQLTVG-THSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRV--KVPDKLSLN 67
           +G  L +G T  V++ +  ++G   Q  AV+++S  +FN  NV+    V    PD L   
Sbjct: 21  LGETLGLGSTGKVQLARNKSTG---QEAAVKVISKAVFNSGNVSGTSIVGSNTPDALPYG 77

Query: 68  ILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQN 127
           I R E+  MKLL N+ +V+   D   T +       +++L++EY E G L + +  R   
Sbjct: 78  IER-EIIIMKLL-NHPNVLRLYDVWETNT-------DLYLVLEYAEKGELFNLLVER--G 126

Query: 128 RLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRP 187
            L E E +    Q   G++  HAL   ++HRD+K EN+LL      K+ DFG  +     
Sbjct: 127 PLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA----- 179

Query: 188 PRNQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDEKA-DIWALGVFLYKLCYYTT 244
                  L  +  +++ +     Y  PE++    G+P    A D+W+ GV L+ L     
Sbjct: 180 -------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRL 229

Query: 245 PF-EKLGEPAIL-----HARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           PF E+ G    L        F+ PS    S   ++LI  +L   P  R     +L+
Sbjct: 230 PFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDILK 285

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 132/286 (46%), Gaps = 60/286 (20%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSN-VACLKRVKVPDKLSLNILRAEVDAMKLLAN 81
           KILK +  G F ++Y      + L   ++   CLK     DK   NI+R      ++  +
Sbjct: 42  KILKQVGEGSFGKVY------LALHRPTHRKVCLK---TSDKNDPNIVR------EVFYH 86

Query: 82  NKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQT 141
            +    YI        T     +V++ +EYC G  L D + +   +R++  E  ++ +Q 
Sbjct: 87  RQFDFPYITKLYEVIVTET---KVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQI 141

Query: 142 TQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDI 201
           +  +   H++    +HRD+K+EN+LL K G  K+ DFG                + +  +
Sbjct: 142 SGAVYYAHSM--HCVHRDLKLENILLDKNGNAKLTDFG----------------FTRECM 183

Query: 202 MKNT------TAQYRCPEMLD--LYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPA 253
            K T      T  Y  PE+++   Y G  I    DIW+LGV LY L   + PF+   E  
Sbjct: 184 TKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDDDDE-- 237

Query: 254 ILHARFQFPS-FPNYS-----DRLKNLIKSMLREHPSDRPNVCQVL 293
            +  +++  +  PNY      D  K+LI  +L ++P +RP++ QVL
Sbjct: 238 -VKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 129/286 (45%), Gaps = 58/286 (20%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSL----NILRAEVDAMKL 78
           KILK +  G F ++Y                CL   KV  K+      N++R EV   + 
Sbjct: 38  KILKIVGEGSFGKVYLAS------------HCLTHQKVVLKMGSKNDPNVVR-EVFYHRQ 84

Query: 79  LANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIM 138
             +  H+    +   T +        V++ +EYC G  L +++  +    L E    ++ 
Sbjct: 85  F-DYSHITKLYEVIVTEN-------YVWMALEYCPGKELYEYLLAKKHIPLEE--CSELF 134

Query: 139 SQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG-----SVSGVIRPPRNQQE 193
           SQ    +   H++    +HRD+K+EN+LL K G  K+ DFG     +  G++        
Sbjct: 135 SQIVGAVYYAHSM--KCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGIL-------- 184

Query: 194 LLYVQHDIMKNTTAQYRCPEMLDL--YRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGE 251
                 + +  TT  Y  PE+++   Y G  I    D W+LG+ LY + + T PF+++ E
Sbjct: 185 ------ETICGTTV-YMAPELIERKPYEGYKI----DTWSLGIILYTMIHGTMPFDEVDE 233

Query: 252 PAILHARFQF-PSFPN-YSD-RLKNLIKSMLREHPSDRPNVCQVLE 294
               +    + P++ N Y D   K LI  +L + P+ RP++ QVL+
Sbjct: 234 VKTKYKIVHYNPTYDNDYIDSNGKELISQLLEKDPNQRPSLTQVLQ 279

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 126/288 (43%), Gaps = 39/288 (13%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNI---LRAEVDAMKLL 79
           +I + L  G F ++Y V     GL     +  LK +   + ++ N+    + E+D    L
Sbjct: 119 EIGRKLGKGKFGKVYCVRHKPSGL-----ICALKVMNKMEIVNFNVQKQFKREIDIQYHL 173

Query: 80  ANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMS 139
            +      Y   H +++        V+L+MEY  GG L   +  +    + +    + + 
Sbjct: 174 NHKNLTKLYAFFHDSKN--------VYLVMEYLIGGELYKLL--KKNGPMNDITASNYVY 223

Query: 140 QTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQH 199
           Q T  +  MH     ++HRD+K EN+L+      K+ DFG     I  P NQ+       
Sbjct: 224 QMTDALNYMHK--RKIIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC-- 276

Query: 200 DIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPA----IL 255
                 T  Y  PE++        DE  D+WALG+  Y+L     PFE+  +      I 
Sbjct: 277 -----GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIA 328

Query: 256 HARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQNVP 303
            +  +FP  PN S   ++LI ++L+  PS+R N+ QV+      +N P
Sbjct: 329 KSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVMNHPWIEKNKP 374

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 127/282 (45%), Gaps = 43/282 (15%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN--------ILRAEVDAMKLLANN 82
            G F  +Y    LS+ +  G  +A +K+V+VP+  S N         LR+EV  +K L ++
Sbjct: 1347 GSFGSVY----LSLNVTTGEMMA-VKQVEVPEFGSQNEAIVSTVEALRSEVTLLKDL-DH 1400

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          +  Y +FL  EY  GG +   +  R+  R  E  I    +Q  
Sbjct: 1401 INIVQYLGFEK-----KNNIYSLFL--EYVAGGSIGSLI--RMYGRFDESLIRHSTTQIL 1451

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
             G++ +H+    +LHRD+K +N+LL   GI K+ DF    G+ R  ++    +Y   ++ 
Sbjct: 1452 AGLSYLHS--KGILHRDMKADNILLDGEGICKISDF----GISRKSKD----IYSNSEMT 1501

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFP 262
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L   A +    Q  
Sbjct: 1502 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIILEMFAGKRPWSNLEVVAAMFKIGQSK 1559

Query: 263  S--------FPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
            S         P  S   ++ +    +  P  RP   Q+L+ +
Sbjct: 1560 SAPPIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHL 1601

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 132/287 (45%), Gaps = 41/287 (14%)

Query: 12  GTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRA 71
           G  L  G +S  +L   TS    + YAV++L     N   +   K+VK      +NI   
Sbjct: 182 GEMLGDGAYSTVML--ATSIDSKKQYAVKVL-----NKEYLIKQKKVKY-----VNI--- 226

Query: 72  EVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTE 131
           E +A++ + N+K +V    +    S        ++ L+EYC  G  +  M  +    L E
Sbjct: 227 EKNALQRINNSKMIVKLFFTFQDES-------SLYFLLEYCPNGDFLSLM--KKYGSLNE 277

Query: 132 PEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQ 191
                  +Q    I  +H     ++HRDIK EN+LL K    K+ DFG+   +     N+
Sbjct: 278 TVACYYSAQVIDAIDYLH--TNGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNK 335

Query: 192 QELLYVQHDIMKNTTAQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLG 250
            +LL      +   TA+Y  PE+L D +    +D + D+WA G  LY++     PF+   
Sbjct: 336 FDLLTRSKSFV--GTAEYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKATN 389

Query: 251 E----PAILHARFQFPS-FPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
           E      ++  ++ F + FP     +++L+K +L +  + RP++ Q+
Sbjct: 390 EYLTFQKVMKVQYAFTAGFPLI---IRDLVKKILVKDLNQRPSISQI 433

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 129/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K +  + ++V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-RHFNIV 139

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID       TN     V++L+E C  G L+D +  R    LTEPE+    +Q    + 
Sbjct: 140 QFID--CFEDDTN-----VYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    K+ DFG ++ V+   R ++  +          T
Sbjct: 191 YMHS--RRVIHRDLKLGNIFFDKHYNLKIGDFG-LAAVLANDRERKYTV--------CGT 239

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHAR-----FQF 261
             Y  PE+L   +      + DIW+ GV +Y L     PF+   E  I++ R     + F
Sbjct: 240 PNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQA-KEVNIIYERIKCGDYVF 297

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P     S     LI+ +L   P +RP++ ++++ V
Sbjct: 298 PRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 87/180 (48%), Gaps = 22/180 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +   ++  +TE E + I  Q   GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLHD--NGIVHRDIKDENVIVDCNGFVK 1102

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA+
Sbjct: 1103 IVDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGEPYEGKP----QDIWAI 1147

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            GV LY + Y   PF  + E  IL A  +  S    SD    LI+ +L    S RP++ ++
Sbjct: 1148 GVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 128/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++     +F    VA   ++ +  + +   L +E+   K + +  ++V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHT-NIV 139

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            ++D       TN     V++L+E C  G L+D +  R    LTEPE+    +Q    + 
Sbjct: 140 QFVD--CFEDDTN-----VYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+   K    KV DFG ++ V+   R ++  +          T
Sbjct: 191 YMHS--RRVIHRDLKLGNIFFDKHYNLKVGDFG-LAAVLANDRERKYTV--------CGT 239

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHAR-----FQF 261
             Y  PE+L   +      + DIW+ GV +Y L     PF+   E  I++ R     F F
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQA-KEVNIIYERIKCGDFVF 297

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P     S     LIK +L   P +RP++ ++++ V
Sbjct: 298 PKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 125/279 (44%), Gaps = 43/279 (15%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKL--------SLNILRAEVDAMKLLANN 82
            G F  ++    L+M +  G  +A +K+V+VP           +++ LR EV  +K L ++
Sbjct: 1149 GSFGAVF----LAMNITTGEMMA-VKQVEVPKYGLQNETVVNTVDALRLEVSTLKDL-DH 1202

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+   A      +G Y +FL  EY  GG +   +  R+  R  +  I  +  Q  
Sbjct: 1203 LNIVQYLGFEA-----KNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDILIRHLTIQVL 1253

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            QG++ +H+    +LHRD+K +N+LL + G+ K+ DF    G+ R   +    +Y   ++ 
Sbjct: 1254 QGLSYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSND----IYSNSEMT 1303

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFP 262
               T  +  PEM+D  +G     K DIW+LG  + ++     P+      A +    Q  
Sbjct: 1304 MKGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAK 1361

Query: 263  S--------FPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
            S         P  S+  K  +       P  RP   ++L
Sbjct: 1362 SAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 125/279 (44%), Gaps = 45/279 (16%)

Query: 28  LTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNK---- 83
           L  GGFA+ + ++        G + AC    K+  K S+   + E    KLL+  +    
Sbjct: 99  LGEGGFARCFHIKDDV-----GISFAC----KIVSKKSI---KTERTKFKLLSEIQIHQN 146

Query: 84  ----HVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMS 139
               H+V ++D         +    V++L+E C  G L+D +  R    LTE E+  + +
Sbjct: 147 LRYSHIVKFMDCF-------EDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTT 197

Query: 140 QTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQH 199
           Q    I  MH+    ++HRD+K+ NV   K    K+ DFG  + +     N  E  Y   
Sbjct: 198 QVCGAINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMC 251

Query: 200 DIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH--- 256
                 T  Y  PE++ L + +    +ADIW+LG+ +Y +     PF+      I     
Sbjct: 252 G-----TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIK 305

Query: 257 -ARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
             +++FP     ++ +K LI+ +L   PS RP +  +L+
Sbjct: 306 LCQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 127/279 (45%), Gaps = 43/279 (15%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVP-----DKLSLNILRA---EVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP     D+ +L++L A   EV  +K L ++
Sbjct: 1155 GSFGSVY----LGLNVTTGEMMA-VKQVEVPRYGSQDETTLSVLEALKSEVSTLKDL-DH 1208

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          +  Y +FL  EY  GG +   +  RL  R  E  I  +  Q  
Sbjct: 1209 VNIVQYLGFE-----NKNHVYSLFL--EYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVL 1259

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL   GI K+ DF    G+ +   N    +Y   D+ 
Sbjct: 1260 RGLAYLHS--KGILHRDMKADNLLLDVDGICKISDF----GISKKSNN----IYSNSDMT 1309

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF- 261
               T  +  PEM+D  +G     K DIW+LG  + ++     P+      A +    +F 
Sbjct: 1310 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFK 1367

Query: 262  --PSFPNYSDRL-----KNLIKSMLREHPSDRPNVCQVL 293
              P  P  + +L     K+ + +     P  RP    +L
Sbjct: 1368 SAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLL 1406

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 125/282 (44%), Gaps = 49/282 (17%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLS--------LNILRAEVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP   S        +  LR+EV  +K L ++
Sbjct: 1105 GSFGAVY----LCLNVTTGEMMA-VKQVEVPKYSSQDENIISTVEALRSEVSTLKDL-DH 1158

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          D  Y +FL  EY  GG +   +  R+  R  E  I  +  Q  
Sbjct: 1159 LNIVQYLGFE-----NKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEAMIRHLTIQVL 1209

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G++ +H+    +LHRD+K +N+LL + G+ K+ DF    G+ R   +    +Y   D+ 
Sbjct: 1210 RGLSYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSND----IYSNSDMT 1259

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF- 261
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L    ++ A F+  
Sbjct: 1260 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFKIG 1314

Query: 262  ----------PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
                       + P  S   +  + S     P  RP   ++L
Sbjct: 1315 KSKSAPPIPEDTLPLISQDGRQFLDSCFEIDPESRPTADKLL 1356

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 124/259 (47%), Gaps = 42/259 (16%)

Query: 55  LKRVKVPD-KLSLN---ILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLME 110
           LK++ + D KL  N    +  E++  KL+  +K+++S ID         D T  +++++E
Sbjct: 78  LKKLPINDYKLKTNRRSTILKEIEIHKLVNGHKNIISMIDHFEI-----DAT--MYMVLE 130

Query: 111 YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
            C  G L D +  R +  L E E   +M Q    +  +H     ++H D+K+ N+L+   
Sbjct: 131 LCGAGSLYDII-CRSKRSLREWEAKRLMIQLCGAVDWIHE--KNIVHADLKLSNILIDSS 187

Query: 171 GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNT-----TAQYRCPEMLDLY-----RG 220
              ++CDFG                +V  DI  N+     T  Y  PE++  +     + 
Sbjct: 188 NNLQLCDFGHS--------------FVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKD 233

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFE----KLGEPAILHARFQFPSFPNYSDRLKNLIK 276
           L   +++DIW++G+ LY + +  TPFE    +     I+  ++ F      S+++K LI+
Sbjct: 234 LYFPKESDIWSIGIVLYAMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQ 293

Query: 277 SMLREHPSDRPNVCQVLEE 295
           ++L+  P +R  + +++ +
Sbjct: 294 NILKIQPLERKTIVEIVSD 312

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 111/243 (45%), Gaps = 32/243 (13%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG L   +      ++ E  I  IM +    +  +H     ++HRDIK  N
Sbjct: 107 LWIIMEYCGGGSLRSLLR---PGKIDEKYIGVIMREILIALKYIHK--DNVIHRDIKAAN 161

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPID 224
           VL++  G  K+CDFG  + + +    +Q +           T  +  PE+  +  G+  D
Sbjct: 162 VLINNDGSIKLCDFGVAAQLNQTKSRRQTMA---------GTPYWMAPEV--IMEGVYYD 210

Query: 225 EKADIWALGVFLYKLCYYTTPF---EKLGEPAILHARFQFPSFP--NYSDRLKNLIKSML 279
            KADIW+ G+  Y++     P+   E L    ++ A+ + P     NYS  +K  I + L
Sbjct: 211 TKADIWSTGITAYEVTTGNPPYCDVEALRAMQLI-AKSKPPRLEGRNYSALIKEFIATCL 269

Query: 280 REHPSDRPNVCQVLEEVSRMQNVPCP-------IRNFYLLR---AMEKVKLSTEIDYPQL 329
            E PS+RP   ++L+        P P       I  + L R     E V +  E ++ + 
Sbjct: 270 DEDPSERPTADELLKTAFIKTYKPLPTSILKELISRYLLFRDKTKRESVAVVAEEEHEKA 329

Query: 330 QLQ 332
           +LQ
Sbjct: 330 KLQ 332

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 129/275 (46%), Gaps = 29/275 (10%)

Query: 26  KYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHV 85
           ++L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K + + +++
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKH-QNI 201

Query: 86  VSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGI 145
           V ++D         +    V++L+  C  G L++ +  R    LTEPE+     Q    I
Sbjct: 202 VQFVDCF-------EDHINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 AVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNT 205
             MH+    ++HRD+K+ N+   +    K+ DFG ++ V+   R ++  +          
Sbjct: 253 KYMHS--RRVIHRDLKLGNIFFDENYNLKIGDFG-LAAVLANDRERKYTVC--------G 301

Query: 206 TAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQF 261
           T  Y  PE+L L +      + DIW++GV ++ L     PF+      I     ++ + F
Sbjct: 302 TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF 360

Query: 262 PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P   + S   K LI+ +L   P  RP++ +++E V
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 96/200 (48%), Gaps = 32/200 (16%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I+ + T G+  +H      +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEM----LDLYRG 220
           +LL++ G+ K+ DFG VSG IR    +   +          T  +  PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTLKRDTFV---------GTPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH-------ARFQFPSFPNYSDRLKN 273
              +EKADIW+LG+  Y+L     P  K     ++         + Q P    +SD  K+
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKD 247

Query: 274 LIKSMLREHPSDRPNVCQVL 293
            +   L + P+DRP+   +L
Sbjct: 248 FVAGCLVKTPADRPSAYNLL 267

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 133/293 (45%), Gaps = 40/293 (13%)

Query: 11  VGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILR 70
           +G+ L VG+    ++ Y  + G  Q  AV+I+S  +FN      +     PD L   I R
Sbjct: 19  LGSTLGVGSTGKVVMAYNETKG--QQAAVKIISKSIFNAQGSTMIGG-NDPDVLPYGIER 75

Query: 71  AEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLT 130
            E+  MKLL N+ +V+   D   T       + ++++++EY E G L + +  R    L 
Sbjct: 76  -EIIIMKLL-NHPNVLRLYDVWET-------SKDLYMVLEYVEKGELFNLLVER--GPLP 124

Query: 131 EPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRN 190
           E E +    Q   GI+  HAL   ++HRD+K EN+LL      K+ DFG  +        
Sbjct: 125 ENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNVKLADFGMAA-------- 174

Query: 191 QQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDE-KADIWALGVFLYKLCYYTTPF- 246
               L  +  +++ +     Y  PE++    GLP    ++D+W+ GV LY L     PF 
Sbjct: 175 ----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 227

Query: 247 EKLGEP-----AILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           E+ G        +   +F+ P     S   ++LI  +L   P  R    ++L+
Sbjct: 228 EEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILK 280

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (47%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +    +  +TE E   I  Q   GI  +H     ++HRDIK ENV++   G+ K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLHH--QGIVHRDIKDENVIVDSKGLVK 1300

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWAL
Sbjct: 1301 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLSGEPYEGKP----QDIWAL 1345

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL    +F S    ++    LIK +L     +RP + ++
Sbjct: 1346 GILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEI 1403

Query: 293  LEE 295
             ++
Sbjct: 1404 FDD 1406

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 136/296 (45%), Gaps = 43/296 (14%)

Query: 11  VGTQLTVG-THSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVK--VPDKLSLN 67
           +G  L +G T  V++ +  ++G   Q  AV+++S  +FN  N++    V    PD L   
Sbjct: 21  LGETLGLGSTGKVQLARNKSTG---QEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYG 77

Query: 68  ILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQN 127
           I R E+  MKLL N+ +V+   D   T +       +++L++EY E G L + +  R   
Sbjct: 78  IER-EIIIMKLL-NHPNVLRLYDVWETNT-------DLYLVLEYAEKGELFNLLVER--G 126

Query: 128 RLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRP 187
            L E E +    Q   G++  HAL   ++HRD+K EN+LL      K+ DFG  +     
Sbjct: 127 PLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA----- 179

Query: 188 PRNQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDEKA-DIWALGVFLYKLCYYTT 244
                  L  +  +++ +     Y  PE++    G+P    A D+W+ GV L+ L     
Sbjct: 180 -------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRL 229

Query: 245 PF-EKLGEPAIL-----HARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           PF E+ G    L       +F+ PS    S   ++LI  +L   P  R     +L+
Sbjct: 230 PFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILK 285

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 98/200 (49%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           E++L++EY +GG L D++ ++   +LTE E +    Q  +G+   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSF--NICHRDLKPE 289

Query: 164 NVLLSKG-GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTA--QYRCPEML--DLY 218
           N+LL K   + K+ DFG  +            L V + ++K +     Y  PE++    Y
Sbjct: 290 NLLLDKKRKLIKIADFGMAA------------LQVSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 219 RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQFPSFPNYSDRLKNL 274
            G P    +D+W+ G+ L+ L     PF       +L    + R+Q P++   S   K+L
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKDL 391

Query: 275 IKSMLREHPSDRPNVCQVLE 294
           I  +L  +P  R    Q+LE
Sbjct: 392 ISRILLVNPKARLTTEQILE 411

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 89/188 (47%), Gaps = 21/188 (11%)

Query: 111  YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
            + E G +  F    L+  +TE E   I  Q   GI  +H     ++HRDIK ENV++   
Sbjct: 1065 HGETGSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLHE--QGIVHRDIKDENVIVDSK 1122

Query: 171  GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKAD 228
            G  K+ DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     D
Sbjct: 1123 GFVKLIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGEPYEGKP----QD 1167

Query: 229  IWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPN 288
            IWA+G+ LY + +   PF  + E  I+    +F      S+   NLIK +L ++   RP 
Sbjct: 1168 IWAVGILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPT 1225

Query: 289  VCQVLEEV 296
            +  + ++V
Sbjct: 1226 IQDIYDDV 1233

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 100/213 (46%), Gaps = 42/213 (19%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D +       L E +   I  +  +G+  +H      +HRDIK  N
Sbjct: 88  MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHE--QKKIHRDIKAAN 145

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML----DLYRG 220
           +LL+  G  K+ DFG VSG IR    +   +          T  +  PE++    D Y  
Sbjct: 146 ILLTDEGKVKLGDFG-VSGQIRATLKRGTFV---------GTPFWMAPEVVSKDSDGY-- 193

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFEKLG-----------EPAILHARFQFPSFPNYSD 269
              DEKADIW+LG+ +Y+L   + P  K             +P +LH         +YS 
Sbjct: 194 ---DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVLHG--------HYSS 242

Query: 270 RLKNLIKSMLREHPSDRPNVCQVL--EEVSRMQ 300
             K+ + S L ++P +RP+  ++L  E V+ +Q
Sbjct: 243 AAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 84/296 (28%), Positives = 135/296 (45%), Gaps = 43/296 (14%)

Query: 11  VGTQLTVG-THSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRV--KVPDKLSLN 67
           +G  L +G T  V++ +  ++G   Q  AV+++S  +FN  NV+    V    PD L   
Sbjct: 21  LGETLGLGSTGKVQLARNKSTG---QEAAVKVISKTVFNTGNVSGTSIVGSTTPDALPYG 77

Query: 68  ILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQN 127
           I R E+  MKLL N+ +V+   D   T +       +++L++EY E G L + +  R   
Sbjct: 78  IER-EIIIMKLL-NHPNVLRLYDVWETNA-------DLYLVLEYAEKGELFNLLVER--G 126

Query: 128 RLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRP 187
            L E E +    Q   G++  HAL   ++HRD+K EN+LL      K+ DFG  +     
Sbjct: 127 PLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA----- 179

Query: 188 PRNQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDEKA-DIWALGVFLYKLCYYTT 244
                  L  +  +++ +     Y  PE++    G+P    A D+W+ GV L+ L     
Sbjct: 180 -------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRL 229

Query: 245 PF-EKLGEPAIL-----HARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           PF E+ G    L        F+ PS    S   ++LI  +L   P  R     +L+
Sbjct: 230 PFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILK 285

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 95/198 (47%), Gaps = 24/198 (12%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D +       L E ++  I     +G+  +H      +HRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE--QRKIHRDVKAAN 149

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELL----YVQHDIMKNTTAQYRCPEMLDLYRG 220
           VLL+  G+ K+ DFG VSG +R    +   +    ++  +I+ N++  Y           
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTFVGTPYWMAPEIISNSSHGY----------- 197

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH---ARFQFPSFPNYSDRLKNLIKS 277
              +EKADIW+LG+ +Y+L     P+ K     ++     +       ++SD  K  I +
Sbjct: 198 ---NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISA 254

Query: 278 MLREHPSDRPNVCQVLEE 295
            L + P +RP   ++L++
Sbjct: 255 CLIKDPDERPTATELLQQ 272

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 124/261 (47%), Gaps = 50/261 (19%)

Query: 67  NILRAEVDAMKLLANNKHVVSYI---DSHATRSPTNDGTYEVFLLMEYCEGGGLIDF--- 120
           N ++ E+  MK   NNKHVV  I   D  ++R        +++L++EYCE G ++     
Sbjct: 142 NKIKKEIAIMKK-CNNKHVVKLIEILDDLSSR--------KIYLVLEYCEKGPILWCPRD 192

Query: 121 ---MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCD 177
              +++R   +L+     +I      G+  +H+    ++HRDIK  N+L+ K G+ K+ D
Sbjct: 193 QLEIDSRGPPQLSFQRAREIFRDVILGLEYLHS--QGIIHRDIKPANLLMDKNGVVKISD 250

Query: 178 FG---SVSGVIRPPRNQQEL-------LYVQHDIMKNTTAQYRCP-EMLDLYRGLPIDEK 226
           FG   + +G I    ++ EL       ++   +I     A  R   +  +L+ G  I  K
Sbjct: 251 FGVSLAANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFK 310

Query: 227 ADIWALGVFLYKLCYYTTPFE-----KLGEPAILHARFQFPSFPNYSD------------ 269
            DIWALG+ LY L +   PF      KL E  I++ + +FP+F    D            
Sbjct: 311 IDIWALGITLYCLLFGMLPFVSEFELKLFE-KIVNEKLRFPTFETLQDNHISEISHIREF 369

Query: 270 -RLKNLIKSMLREHPSDRPNV 289
              K+L+  +L ++P+ R ++
Sbjct: 370 VHAKDLLNKLLEKNPAKRISI 390

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 94/199 (47%), Gaps = 31/199 (15%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           E++L++EY +GG L D++ +R   RL E E +    Q  QG++  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAF--NICHRDLKPE 245

Query: 164 NVLL-SKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTA--QYRCPE--MLDLY 218
           N+LL  K    K+ DFG  +            L V + +++ +     Y  PE  M   Y
Sbjct: 246 NLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGKQY 293

Query: 219 RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQFPSFPNYSDRLKNL 274
            G P    +D+W+ G+ L+ L     PF       +L      ++Q P   N S   ++L
Sbjct: 294 HGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQ--NLSKEAQDL 347

Query: 275 IKSMLREHPSDRPNVCQVL 293
           I  +L  +P+ R    ++L
Sbjct: 348 IAKILTVNPAKRLTTEEIL 366

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 96/195 (49%), Gaps = 25/195 (12%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           V++++EYC G  L + +    + RL+  E   + SQ    +   H L    +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHEL--KCVHRDLKLEN 158

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLD--LYRGLP 222
           VLL   G  K+ DFG    +    R+Q E +          T  Y  PE+++   Y G  
Sbjct: 159 VLLDGNGHAKLTDFGFTREM--ATRSQLETIC--------GTTVYMAPELIERKCYDGF- 207

Query: 223 IDEKADIWALGVFLYKLCYYTTPFEKLGEP----AILHARFQFPSFPNYSDRLKNLIKSM 278
              K DIW+LG+ LY +     PF++  +      I++    F      SD   +LI+ M
Sbjct: 208 ---KVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQ-EWISDDAIDLIQGM 263

Query: 279 LREHPSDRPNVCQVL 293
           LR++P++R ++ QVL
Sbjct: 264 LRKNPNERISLAQVL 278

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 128/301 (42%), Gaps = 49/301 (16%)

Query: 7   DRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSL 66
           ++ N G   +  +   K  + +  G F  +Y       G +  +N  C  +V   D    
Sbjct: 4   NKTNAGVPKSSVSTLFKRTEVIGRGKFGIVYK------GYYIKTNRVCAIKVLNLDSADD 57

Query: 67  NI--LRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTR 124
            +  ++ EV  +  L    ++  Y  S+   +       E++++MEYC GG L   +   
Sbjct: 58  EVEDVQKEVQFLSSLKQVPNITHYYGSYLNNT-------ELWVIMEYCAGGSLRTLLRP- 109

Query: 125 LQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGV 184
              ++ E  I  IM +    IA+MH     ++HRDIK  NVL++  G  K+CDFG  + +
Sbjct: 110 --GKIGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL 165

Query: 185 IRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTT 244
            +    +Q +           T  +  PE+  +  G+  D K DIW+LG+  Y++     
Sbjct: 166 SQTKIRRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNP 214

Query: 245 PF---EKL--------GEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
           P+   E L         +P  L  R        +S  LK  I   L E P +RP+  ++L
Sbjct: 215 PYCDVEALRAMQLITKSKPPRLEGR-------QHSSALKEFIALCLDEDPKERPSAEELL 267

Query: 294 E 294
           +
Sbjct: 268 K 268

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 91/183 (49%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +    ++ +TE E   I  Q   GI  +H     ++HRD+K ENV++   G  K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLHD--SNIVHRDVKDENVIVDAKGFVK 1256

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA+
Sbjct: 1257 LIDFGSAAYVNSGPFD----VFV-------GTIDYAAPEVLSGEPYLGKP----QDIWAI 1301

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL A  +  +  + S    +LIK +L ++P+ RP + ++
Sbjct: 1302 GILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEI 1359

Query: 293  LEE 295
            + +
Sbjct: 1360 VND 1362

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVV 86
           +L  GGFA+ + ++  S  +F    VA   ++ +  + +   L +E+   K +  + ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-KHPNIV 137

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
            +ID       TN     V++L+E C  G L+D +  R    LTEPE+    +Q    I 
Sbjct: 138 QFID--CFEDDTN-----VYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            MH     ++HRD+K+ N+        K+ DFG ++ V+   R ++  +          T
Sbjct: 189 YMHN--RRVIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLANDRERKYTV--------CGT 237

Query: 207 AQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQ----- 260
             Y  PE+L   + G   +   DIW++GV +Y L     PF+   E  I++ R +     
Sbjct: 238 PNYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQA-KEVNIIYERIKSGDYI 294

Query: 261 FPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           FP     S  +  LI+ +L   P +RP++ ++++ V
Sbjct: 295 FPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 128/282 (45%), Gaps = 49/282 (17%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN--------ILRAEVDAMKLLANN 82
            G F  ++    L + +  G  +A +K+V+VP   S N         LRAEV  +K L ++
Sbjct: 1191 GSFGAVF----LCLNVTTGEMMA-VKQVEVPRYGSQNEAIISTVEALRAEVSTLKDL-DH 1244

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+          D  Y +FL  EY  GG +   +  R+  +  E  I  +  Q  
Sbjct: 1245 LNIVQYLGFEV-----KDSIYSLFL--EYVAGGSVGSLI--RMYGKFDEKLIKHLTIQVL 1295

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G++ +H+    +LHRD+K +N+LL + G+ K+ DF    G+ R  ++    +Y   ++ 
Sbjct: 1296 RGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSKD----IYSNSEMT 1345

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF- 261
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L    ++ A F+  
Sbjct: 1346 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFKIG 1400

Query: 262  ----------PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
                       + P  S   ++ +    +  P +RP   ++L
Sbjct: 1401 KSKSAPPIPDDTLPLISQSGRDFLDQCFKIDPEERPTADKLL 1442

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 95/200 (47%), Gaps = 32/200 (16%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I+ Q T G+  +H      +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEM----LDLYRG 220
           +LL++ G+ K+ DFG VSG IR    +   +          T  +  PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTFKRDTFV---------GTPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH-------ARFQFPSFPNYSDRLKN 273
              +EKADIW+LG+  Y+L     P  K     ++         + Q P    +S+  K 
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSEAAKE 247

Query: 274 LIKSMLREHPSDRPNVCQVL 293
            +   L + P+DRP+   +L
Sbjct: 248 FVAGCLVKTPADRPSAYDLL 267

>NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa] {ON}
            
          Length = 1508

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 134/298 (44%), Gaps = 54/298 (18%)

Query: 26   KYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN----ILRAEVDAMKLLAN 81
            K++  G F ++Y+   L  G      V  +K +K+ D  S+      ++ E++ +++L++
Sbjct: 1212 KFVGGGTFGEVYSAVNLDTG-----EVLAVKEIKIQDSKSMEKIFPSIKEEMNVLEMLSH 1266

Query: 82   NKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMS-Q 140
              ++V Y      R   N       + MEYCEGG L   +      R+ +  +  + + Q
Sbjct: 1267 -PNIVQYYGVEVHRDRVN-------IFMEYCEGGSLASLLE---HGRIEDEMVTQVYTLQ 1315

Query: 141  TTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIR----------PPRN 190
              +G+A +H     ++HRDIK EN+LL   GI K  DFG+   + +          P  N
Sbjct: 1316 LLEGLAYLHE--SGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRVVTREMPDEN 1373

Query: 191  QQELLYVQ-----HDIMKNTTAQYRCPEMLDLYRGLPIDEKA---DIWALGVFLYKLCYY 242
              E   V      +DI+   T  Y  PE +    G P        DIWALG  + ++   
Sbjct: 1374 DDENGKVVGRNNFNDII--GTPMYMAPEAI---TGSPKKGHLGADDIWALGCVVLEMITG 1428

Query: 243  TTPFEKL-GEPAILH--ARFQFPSFPNYSDRLK----NLIKSMLREHPSDRPNVCQVL 293
              P+  L  E AI++  A  Q P  P  +D +     + +K  L+++P+ R +  ++L
Sbjct: 1429 KRPWANLDNEWAIMYHVAAGQIPQLPT-NDEVSPAGMHFLKRCLKQNPAQRASAVELL 1485

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 95/200 (47%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           E++L++EY EGG L D++ +R   +L E E +    Q  QG++  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHF--NICHRDLKPE 196

Query: 164 NVLLSKGGI-YKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTA--QYRCPEML--DLY 218
           N+LL K  +  K+ DFG  +            L     +++ +     Y  PE++    Y
Sbjct: 197 NLLLDKKNLSVKIADFGMAA------------LETTDKLLETSCGSPHYASPEIVMGQKY 244

Query: 219 RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQFPSFPNYSDRLKNL 274
            G P    +D+W+ G+ L+ L     PF       +L      ++Q P   N S+  K+L
Sbjct: 245 HGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAKDL 298

Query: 275 IKSMLREHPSDRPNVCQVLE 294
           I  +L   P+ R  + +VLE
Sbjct: 299 IAKILIVDPAMRITIDEVLE 318

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 96/196 (48%), Gaps = 24/196 (12%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I+ Q T G+  +H      +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEM----LDLYRG 220
           +LL++ G+ K+ DFG VSG IR    +   +          T  +  PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIRSTMKRDTFV---------GTPYWMAPEVVCCEVDGY-- 189

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH--ARFQFPSFP-NYSDRLKNLIKS 277
              +EKADIW+LG+  Y+L     P  K     ++    + + P    ++S+  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAG 246

Query: 278 MLREHPSDRPNVCQVL 293
            L + P+DRP+   +L
Sbjct: 247 CLVKAPADRPSAYDLL 262

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 100/203 (49%), Gaps = 39/203 (19%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           V++ +EYC G  L +++   ++ R+   E   + SQ    +   H++    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSM--KCVHRDLKLEN 158

Query: 165 VLLSKGGIYKVCDFG-----SVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDL-- 217
           +LL K G  K+ DFG     +  G++              + +  TT  Y  PE+++   
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGIL--------------ETVCGTTV-YMAPELIERKP 203

Query: 218 YRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF-PSFPNYSDRL----- 271
           Y G  I    D W+LG+ LY + +   PF+   E   +  +++   + P Y D       
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGAMPFD---EEDDIKTKYRIVNNEPFYDDNFIDANG 256

Query: 272 KNLIKSMLREHPSDRPNVCQVLE 294
           K+LI  +L++ PS RP++ QVL+
Sbjct: 257 KDLIMQLLQKDPSQRPSLTQVLQ 279

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 116  GLIDFMNT-RLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G +D  +    ++ +TE E   I  Q   GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLHD--QGIVHRDIKDENVIVDSKGFVK 1095

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKA-DIWALG 233
            + DFGS + V   P +    ++V        T  Y  PE+L    G P + K+ DIWA+G
Sbjct: 1096 LIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLG---GNPYEGKSQDIWAIG 1141

Query: 234  VFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
            + LY L Y   PF  + E  IL    +F    + S   K LI  +L      RP + ++ 
Sbjct: 1142 ILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEIC 1199

Query: 294  EEV 296
            ++V
Sbjct: 1200 QDV 1202

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 111/228 (48%), Gaps = 37/228 (16%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLS--------LNILRAEVDAMKLLANN 82
            G F  +Y    L + L  G  +A +K+V+VP   +        +  LR+EV  +K L ++
Sbjct: 1284 GSFGAVY----LCLNLTTGEMMA-VKQVEVPKYSAQDQNILDTVEALRSEVSTLKDL-DH 1337

Query: 83   KHVVSYIDSHATRSPTNDGTYEVF-LLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQT 141
             ++V Y+         ND  ++++ L +EY  GG +   +  RL  R  E  I  +  Q 
Sbjct: 1338 LNIVQYLGFE------ND--HDIYSLFLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQV 1387

Query: 142  TQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDI 201
             +G+A +H+    +LHRD+K +N+LL   G+ K+ DF    G+ R  ++    +Y   D+
Sbjct: 1388 LEGLAYLHS--KGILHRDMKADNLLLDLDGVCKISDF----GISRKSKD----IYSNSDM 1437

Query: 202  MKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKL 249
                T  +  PEM+D  +G     K DIW+LG  + ++     P+  L
Sbjct: 1438 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNL 1483

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G +D  +   L+  +TE E   I  Q   GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1055 GSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLHD--NGIVHRDIKDENVIVDSNGFVK 1112

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA+
Sbjct: 1113 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGEPYEGKP----QDIWAI 1157

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            GV LY + +   PF  + E  IL A  +  S    SD    LI+ +L    S RP++ ++
Sbjct: 1158 GVLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 98/198 (49%), Gaps = 26/198 (13%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I  +  +G+  +H      +HRDIK  N
Sbjct: 93  MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLHE--QKKIHRDIKAAN 150

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEM----LDLYRG 220
           +LL++ G  K+ DFG VSG ++    +  ++          T  +  PE+    ++ Y  
Sbjct: 151 ILLTEEGHVKLGDFG-VSGQLKSTLRRGTIV---------GTPYWMAPEVASQNIEGY-- 198

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPN----YSDRLKNLIK 276
              DEK DIW+LG+ +++L     P  KL +P  + A     S P     YSD  K+ + 
Sbjct: 199 ---DEKIDIWSLGITVFELLKGVPPLVKL-DPIRVLANLSRKSAPRLQGAYSDAAKSFVA 254

Query: 277 SMLREHPSDRPNVCQVLE 294
             L ++P++RP    +L+
Sbjct: 255 LCLIKNPNERPAAVDLLK 272

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 116/239 (48%), Gaps = 38/239 (15%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVP-----DKLSLNI---LRAEVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP     D+ ++++   LR+EV  +K L ++
Sbjct: 1183 GSFGAVY----LGLNVTTGEMMA-VKQVEVPKFGSQDEATISVVEALRSEVSTLKNL-DH 1236

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+      S      Y +FL  EY  GG +   +  RL  R  E  I  +  Q  
Sbjct: 1237 LNIVQYLGFENKNS-----IYSLFL--EYVAGGSVGSLI--RLYGRFDESLIRFLTVQVL 1287

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G++ +H+    +LHRD+K +N+LL   G+ K+ DF    G+ R   +    +Y   D+ 
Sbjct: 1288 RGLSYLHSR--GILHRDMKADNLLLDLDGVCKISDF----GISRKSND----IYCNSDMT 1337

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF 261
               T  +  PEM+D  +G     K DIW+LG  + ++     P+  L    ++ A F+ 
Sbjct: 1338 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFKI 1391

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 79.3 bits (194), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 96/196 (48%), Gaps = 24/196 (12%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I+ Q T G+  +H      +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEM----LDLYRG 220
           +LL++ G+ K+ DFG VSG +R    +   +          T  +  PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLRSTMKRDTFV---------GTPYWMAPEVVCCEVDGY-- 189

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILH--ARFQFPSFP-NYSDRLKNLIKS 277
              +EKADIW+LG+  Y+L     P  K     ++    + + P    ++SD  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAG 246

Query: 278 MLREHPSDRPNVCQVL 293
            L + P+DRP+   +L
Sbjct: 247 CLVKVPADRPSAYDLL 262

>SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weakly
           similar to uniprot|P47116 Saccharomyces cerevisiae
           YJR059W PTK2 Putative serine/threonine protein kinase
           involved in regulation of ion transport across plasma
           membrane enhances spermine uptake
          Length = 818

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 104/233 (44%), Gaps = 23/233 (9%)

Query: 26  KYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV-----PDKLSLNILRAEVDAMKLLA 80
           + L SGG +++  V      +++  ++  LK+ K+     P        +  + A KL +
Sbjct: 291 RKLGSGGSSEVRMV----YSIYHKKDLYALKKFKLFRTERPTHFYCRCAKEFIIAKKL-S 345

Query: 81  NNKHVVSYIDSHATRSPTNDG-TYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMS 139
            N H+ +    +  + PT+   T     +MEYC GG L   +      R    E   +  
Sbjct: 346 KNIHIANTF--YLVKVPTSTTMTRGWAFVMEYCPGGDLHSLITRTGWKRSPLKERFCLFK 403

Query: 140 QTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQH 199
           Q TQG+  MH     ++HRDIK ENVL+SK GI K+ DFG        P +    + V  
Sbjct: 404 QVTQGLRFMHNQG--VVHRDIKPENVLISKDGIAKLTDFGISDWAHEDPDDLNSPMRVFD 461

Query: 200 DIMKNTTAQYRCPEMLDLYRG-----LPIDE-KADIWALGVFLYKLCYYTTPF 246
             +   +  +  PE++ L         P D  K D WALG+ L+ L Y  TPF
Sbjct: 462 CYVG--SPPFSPPEVMALKNAKGDAVKPYDPFKMDCWALGMILFALVYQATPF 512

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 128/282 (45%), Gaps = 49/282 (17%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN--------ILRAEVDAMKLLANN 82
            G F  +Y    L + +  G  +A +K+V+VP   S N         LRAE+  +K L ++
Sbjct: 1133 GSFGAVY----LCLNVTTGEMMA-VKQVEVPKYGSQNEQIIHTVEALRAEMSTLKNL-DH 1186

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
             ++V Y+   A      D    +FL  EY  GG +   +  R+  R  E  I  + +Q  
Sbjct: 1187 LNIVQYLGFEA-----KDHMNSLFL--EYVAGGSVGSLI--RMYGRFDEVMIKHLTTQVL 1237

Query: 143  QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            +G++ +H+    +LHRD+K +N+LL + G+ K+ DF    G+ R  ++    +Y   ++ 
Sbjct: 1238 RGLSYLHSR--GILHRDMKADNLLLDQEGVCKISDF----GISRKSKD----IYSNSEMT 1287

Query: 203  KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF- 261
               T  +  PEM+D  +G     K DIW++G  + ++     P+  L    ++ A F+  
Sbjct: 1288 MRGTVFWMAPEMVDTAQGY--SAKVDIWSMGCVVLEMFAGKRPWSNL---EVVAAMFKIG 1342

Query: 262  ----------PSFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
                       + P  S   ++ I +  +  P  RP   + L
Sbjct: 1343 KSKSAPPIPEDTLPLISQSGRDFIDACFQIDPEARPTADKQL 1384

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 133/294 (45%), Gaps = 42/294 (14%)

Query: 11  VGTQLTVG-THSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNIL 69
           +G  L VG T  V + + + +G   QI AV+I+S  +FN    +       PD L   I 
Sbjct: 22  LGETLGVGSTGKVLMAQNVQTG---QIAAVKIISKSIFNAQG-STFVGSNDPDVLPYGIE 77

Query: 70  RAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRL 129
           R E+  MKLL N+ +V+   D   T       + ++++++EY E G L + +  R    L
Sbjct: 78  R-EITIMKLL-NHPNVLRLYDVWET-------STDLYMVLEYVEKGELFNLLIER--GPL 126

Query: 130 TEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPR 189
            E E +    Q   GI+  HAL   ++HRD+K EN+LL      K+ DFG  +       
Sbjct: 127 PENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKLADFGMAA------- 177

Query: 190 NQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDE-KADIWALGVFLYKLCYYTTPF 246
                L  +  +++ +     Y  PE++    GLP    ++D+W+ GV LY L     PF
Sbjct: 178 -----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPF 229

Query: 247 -EKLGEPAIL-----HARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
            E  G    L        F+ P     S   ++LI  +L   PS R    ++L+
Sbjct: 230 DEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 93/201 (46%), Gaps = 32/201 (15%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D +       + E ++  I+  T +G+  +H      +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHD--QKKIHRDIKAAN 143

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPID 224
           +LL+  G  K+ DFG VSG IR    +   +          T  +  PE+++  +    +
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVIN-KQCKGYN 192

Query: 225 EKADIWALGVFLYKLCYYTTPFEKLG-----------EPAILHARFQFPSFPNYSDRLKN 273
           EKADIW+LG+  Y+L     P  K             +P  LH +        YS++ K 
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQ--------YSEKAKY 244

Query: 274 LIKSMLREHPSDRPNVCQVLE 294
            +   L + P  RP++  +LE
Sbjct: 245 FVSLCLIKDPKQRPSIEALLE 265

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 130/286 (45%), Gaps = 40/286 (13%)

Query: 11  VGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLF-NGSNVACLKRVKVPDKLSLNIL 69
           +G+ L  G+    ++    S G  Q  AV+I+S  +F N SN + +     PD L   I 
Sbjct: 28  LGSTLGAGSTGKVVMAQHESTG--QQAAVKIVSKSIFGNQSNSSTIVGSNDPDVLPYGIE 85

Query: 70  RAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRL 129
           R E+  MKLL N+ +V+   D   T S        +++++EY E G L + +  R    L
Sbjct: 86  R-EIIIMKLL-NHPNVLRLYDVWETNS-------SLYMVLEYVEKGELFNLLVDR--GPL 134

Query: 130 TEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPR 189
            E E +    Q   GI+  HAL   ++HRD+K EN+LL      K+ DFG  +       
Sbjct: 135 PENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMAA------- 185

Query: 190 NQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDE-KADIWALGVFLYKLCYYTTPF 246
                L  +  +++ +     Y  PE++    GLP    ++D+W+ G+ L+ L     PF
Sbjct: 186 -----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGIILFALLTGRLPF 237

Query: 247 -EKLGEP-----AILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
            E+ G        +   +F+ P     S   ++LI  +L   P+ R
Sbjct: 238 DEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAAR 283

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +    +  ++E E   I  Q    I  +H     ++HRDIK ENV++   G  K
Sbjct: 1129 GCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLHD--QGIVHRDIKDENVIVDSQGFIK 1186

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA+
Sbjct: 1187 LIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGEPYVGKP----QDIWAI 1231

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL A  +F +     +   +LIK +L  +P+ RP + ++
Sbjct: 1232 GILLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177
           YAR019C
          Length = 897

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 124/301 (41%), Gaps = 51/301 (16%)

Query: 16  TVGTHSVKILKYLTSGGFAQIYAVE------ILSMGLFNGSNVACLKRVKVPDKLSLNIL 69
           TV   S + +K L  G   ++Y V+      + +M ++N +++  LKR K+         
Sbjct: 486 TVSPQSFQKIKLLGQGDVGKVYLVKEKSTNALYAMKIYNKNDM--LKRKKI--------- 534

Query: 70  RAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRL 129
           +  +   ++LA + H       H+ +S        ++L MEYC GG     + TR    +
Sbjct: 535 KRVITEQEILATSNHPFIVTLYHSFQSED-----YLYLCMEYCMGGEFFRALQTRESKCI 589

Query: 130 TEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG---------- 179
            E       S+    +  +H L    ++RD+K EN+LL K G   + DF           
Sbjct: 590 DEDAAQFYASEVIAALEYLHLL--GFIYRDLKPENILLHKSGHIMLSDFDLSIQAKDSKN 647

Query: 180 --SVSGVIRPPRNQQELLYVQHDIMKN--------TTAQYRCPEMLDLYRGLPIDEKADI 229
              +   I    N    L +   I  +         T +Y  PE++   RG       D 
Sbjct: 648 PTFMKNGILSTNNSNSNLIIDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTVAVDW 704

Query: 230 WALGVFLYKLCYYTTPFEKLGE----PAILHARFQFPSFPNYSDRLKNLIKSMLREHPSD 285
           W LG+ +Y++ +  TPF+          IL   F FP+  N S   KNLIK +L ++ + 
Sbjct: 705 WTLGILIYEMLFGKTPFKGKNTNETFANILSHDFTFPNTNNISRNCKNLIKKLLIKNETK 764

Query: 286 R 286
           R
Sbjct: 765 R 765

>Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON}
           similar to Ashbya gossypii ADR167W
          Length = 896

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 128/300 (42%), Gaps = 53/300 (17%)

Query: 14  QLTVGTHSVKILKYLTSGGFAQIYAVE------ILSMGLFNGSNVACLKRVKVPDKLSLN 67
           + TVG  S + ++ L  G   ++Y V       + ++ +F  + +   K++K        
Sbjct: 474 EATVGPQSFEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKKIK-------R 526

Query: 68  ILRAEVDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRL 125
           IL  +    ++LA + H  +V+   S  T          ++L MEYC GG     + TR 
Sbjct: 527 ILAEQ----EILATSNHPFIVTLYHSFQTED-------YLYLCMEYCMGGEFFRALQTRK 575

Query: 126 QNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVI 185
              ++E +     S+ T  +  +H +    ++RD+K EN+LL + G   + DF  +S   
Sbjct: 576 TKCISEDDARFYASEVTAALEYLHLM--GFIYRDLKPENILLHQSGHIMLSDF-DLSVQA 632

Query: 186 RPPRNQQELLYVQHDIMKNT-------------TAQYRCPEMLDLYRGLPIDEKADIWAL 232
           + PRN Q     Q  ++                T +Y  PE++   RG       D W L
Sbjct: 633 KGPRNPQVKGNAQSSLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTASVDWWTL 689

Query: 233 GVFLYKLCYYTTPFEKLGEPA------ILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
           G+  Y++ +  TPF+  GE        IL     FP+    S   K+LIK +L +  + R
Sbjct: 690 GILTYEMLFGFTPFK--GENTNQTFSNILKVEATFPNNNEISRTCKDLIKKLLIKSETKR 747

>KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {ON}
           Anc_3.60 YNL298W
          Length = 883

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 106/204 (51%), Gaps = 35/204 (17%)

Query: 58  VKVPDKLSLNIL------RAE--VDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFL 107
           +KV DK+++  +      R E  V+ + ++ ++KH  +V++I+S+     T D   ++++
Sbjct: 626 MKVGDKVAIKQMILSKQPRKELIVNEIHVMKDSKHKNIVNFIESYLK---TED---DLWV 679

Query: 108 LMEYCEGGGLIDFM-----NTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKI 162
           +MEY EGG L D +     N    + LTEP+I  I+ +T QG+  +H     ++HRDIK 
Sbjct: 680 VMEYMEGGSLTDIIENSPTNGSTHSPLTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKS 737

Query: 163 ENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLP 222
           +NVLL      K+ DFG  + +    RN++  +          T  +  PE++   +   
Sbjct: 738 DNVLLDTHARVKITDFGFCAKLTD-QRNKRATMV--------GTPYWMAPEVV---KQRE 785

Query: 223 IDEKADIWALGVFLYKLCYYTTPF 246
            DEK D+W+LG+   ++     P+
Sbjct: 786 YDEKVDVWSLGIMAIEMLESEPPY 809

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 88/193 (45%), Gaps = 22/193 (11%)

Query: 106  FLLMEYCEGGGLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
            +L  E     G ID  +   L+  +TE E   +  Q   GI  +H     ++HRDIK EN
Sbjct: 1051 YLETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLHD--NGIVHRDIKDEN 1108

Query: 165  VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLP 222
            V++   G  K+ DFGS + V   P +    ++V        T  Y  PE+L  + Y G P
Sbjct: 1109 VIVDNKGFVKLIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGEPYEGKP 1157

Query: 223  IDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREH 282
                 DIWA+GV LY + Y   PF  + E  IL    +  S    S     LI+ +L   
Sbjct: 1158 ----QDIWAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRS 1211

Query: 283  PSDRPNVCQVLEE 295
             S RP +  ++E+
Sbjct: 1212 VSKRPTIDDIMED 1224

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 133/300 (44%), Gaps = 43/300 (14%)

Query: 7   DRI---NVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDK 63
           DRI    +G  L  G+    +L   T  G  QI AV+++S  +FN      +     PD 
Sbjct: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETG--QIAAVKVISKSVFNAQGSTFVGS-NDPDV 70

Query: 64  LSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNT 123
           L   I R E+  MKLL N+ +V+   D   T         ++++++EY E G L + +  
Sbjct: 71  LPYGIER-EIIIMKLL-NHPNVLRLYDVWET-------AQDLYMVLEYVEKGELFNLLVQ 121

Query: 124 RLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSG 183
           R    L E E +    Q   GI+  HAL   ++HRD+K EN+LL      K+ DFG  + 
Sbjct: 122 R--GPLPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKLADFGMAA- 176

Query: 184 VIRPPRNQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDE-KADIWALGVFLYKLC 240
                      L  +  +++ +     Y  PE++    GLP    ++D+W+ GV LY L 
Sbjct: 177 -----------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALL 222

Query: 241 YYTTPF-EKLGEP-----AILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
               PF E+ G        +   +++ P     S   ++LI  +L   P  R    ++L+
Sbjct: 223 TGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 133/294 (45%), Gaps = 42/294 (14%)

Query: 11  VGTQLTVG-THSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNIL 69
           +G  L +G T  V++    T+G  A   A++++S  +FN +N A    +  PD L   I 
Sbjct: 20  LGETLGLGSTGKVQLAHNKTTGKQA---AIKVISKSVFN-NNSAQSSSLTTPDALPYGIE 75

Query: 70  RAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRL 129
           R E+  MKLL N+ +V+   D   T S        +++++EY E G L + +  +    L
Sbjct: 76  R-EIIIMKLL-NHPNVLRLYDVWETNS-------NLYMVLEYAEKGELFNLLVEK--GPL 124

Query: 130 TEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPR 189
            E E +    Q   GI+  HAL   ++HRD+K EN+LL      K+ DFG  +       
Sbjct: 125 QEQEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA------- 175

Query: 190 NQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDEKA-DIWALGVFLYKLCYYTTPF 246
                L  +  +++ +     Y  PE++    G+P    A D+W+ GV L+ L     PF
Sbjct: 176 -----LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILFALLTGRLPF 227

Query: 247 -EKLGEP-----AILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
            E+ G        +    F+ PS    S   ++L+  +L   P  R     +L+
Sbjct: 228 DEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILK 281

>Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON}
            similar to Ashbya gossypii AFR092W
          Length = 1397

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 123/291 (42%), Gaps = 55/291 (18%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVP-----DKLSLNILRAEVDAMKLLANNKH- 84
            G F  +Y    L + +  G  +A +K+V+VP     D++++  + A +  +  L N  H 
Sbjct: 1107 GSFGAVY----LGLNVTTGEMMA-VKQVEVPKFGSQDQITVTNVEALISEVSTLKNLDHL 1161

Query: 85   -VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQ 143
             +V Y+          +G Y +FL  EY  GG +   +  RL     E  I  +  Q  +
Sbjct: 1162 NIVQYLGFE-----NKNGIYSLFL--EYVAGGSVGSLI--RLYGHFDEQLIRFLTKQVLE 1212

Query: 144  GIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMK 203
            G+A +H     +LHRD+K +N+LL   G+ K+ D     G+ R   N    +Y   ++  
Sbjct: 1213 GLAYLHRR--GILHRDMKADNLLLDNNGVCKISDL----GISRKSNN----IYSNAEMTM 1262

Query: 204  NTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF-- 261
              T  +  PEM+D  +G     K DIW+LG  + ++     P+  L    ++ A FQ   
Sbjct: 1263 RGTVFWMAPEMVDTTQGY--SAKVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFQIGK 1317

Query: 262  ---------PSFPNYSDRLKNLIKSMLREHPSDRPNV--------CQVLEE 295
                      + P  S   +  I    +  P  RP          CQV +E
Sbjct: 1318 SKTAPPIPEKTLPLISKDGRVFIDDCFKIDPEKRPTADTLLSHPFCQVPQE 1368

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 96/370 (25%), Positives = 161/370 (43%), Gaps = 71/370 (19%)

Query: 17  VGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAM 76
           VG  +   +   T+    + YAV++L     N   +   K+VK      +NI   E +A+
Sbjct: 188 VGDGAYSTVMLATAKDSGKKYAVKVL-----NKEYLIKQKKVKY-----VNI---EKNAL 234

Query: 77  KLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILD 136
           + L N++ +V    +    S        ++ L+EY   G  +  M  +    L+E     
Sbjct: 235 QRLNNSRGIVKLFFTFQDES-------SLYFLLEYAPNGDFLSVM--KKYGSLSEDCTRY 285

Query: 137 IMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQE--- 193
             +Q   GI  +H+    ++HRDIK EN+LL K    K+ DFG+    I  P+N+ E   
Sbjct: 286 YSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDMKVKITDFGTAK--ILEPKNEDEDNP 341

Query: 194 ---LLYVQHDIMKNTTAQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKL 249
              LL      +   TA+Y  PE+L D Y    +D + DIWA G  ++++     PF+  
Sbjct: 342 EFNLLTRSKSFV--GTAEYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPFKAT 395

Query: 250 GE----PAILHARFQFPS-FPNYSDRLKNLIKSMLREHPSDRPNVCQVLE---------E 295
            E      ++  ++ F + FP     +++L+K +L + P  R  + Q+ +         E
Sbjct: 396 NEYLTFQKVMKVQYAFTAGFPVV---VRDLVKRILLKVPEQRLTIPQIEKHHFYKDISFE 452

Query: 296 VSRMQNVPCPIRNFYLLRA--MEKV-------KLSTEIDYPQLQLQKLRNAQADNLSNPM 346
              +   P P    Y + A  M+ V          T I+ P+ QLQK   A  ++ S P 
Sbjct: 453 DGSVWTAPAPEIQPYKINAKSMQPVPELKDAPNKRTIINIPKRQLQK---AHTNSSSTPN 509

Query: 347 IKPMPIAQRP 356
              +P  +RP
Sbjct: 510 ---LPTIERP 516

>YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON}
            SSK22MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; functionally
            redundant with, and homologous to, Ssk2p; interacts with
            and is activated by Ssk1p; phosphorylates Pbs2p
          Length = 1331

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 134/288 (46%), Gaps = 42/288 (14%)

Query: 27   YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN----ILRAEVDAMKLLANN 82
            ++  G F Q+Y+    ++ L NG  +A +K +K+ D  ++     +++ E+  +++L N+
Sbjct: 1039 FIGGGTFGQVYS----AINLENGEILA-VKEIKIHDTTTMKKIFPLIKEEMTVLEML-NH 1092

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMS-QT 141
             ++V Y      R   N       + MEYCEGG L   ++     R+ +  +  + + + 
Sbjct: 1093 PNIVQYYGVEVHRDKVN-------IFMEYCEGGSLASLLD---HGRIEDEMVTQVYTFEL 1142

Query: 142  TQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVI----RPPRNQQ-ELLY 196
             +G+A +H     ++HRDIK EN+LL   GI K  DFG+   V+    R  RN   +   
Sbjct: 1143 LEGLAYLHQ--SGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFG 1200

Query: 197  VQHDIMKNT--TAQYRCPEMLDLYRGLPIDEKA---DIWALGVFLYKLCYYTTPFEKL-G 250
            V+   +     T  Y  PE +    G  +  K    D+WALG  + ++     P+  L  
Sbjct: 1201 VETKSLNEMMGTPMYMAPETIS---GSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDN 1257

Query: 251  EPAILH--ARFQFPSFPNYSDRL---KNLIKSMLREHPSDRPNVCQVL 293
            E AI++  A  + P  PN  +     +  ++  L + P+ R    ++L
Sbjct: 1258 EWAIMYHVAAGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELL 1305

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 122/287 (42%), Gaps = 32/287 (11%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVD 74
           +TV   S + ++ L  G   ++Y V        + + +  LK +   + +    ++  + 
Sbjct: 313 ITVEPQSFEKIRLLGQGDVGKVYLVRER-----DTNQIFALKVLSKHEMIKRKKIKRVLT 367

Query: 75  AMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEP 132
             ++LA + H  +V+   S  T          ++L MEYC GG     + TR   R+TE 
Sbjct: 368 EQEILATSDHPFIVTLYHSFQTED-------FLYLCMEYCMGGEFFRALQTRKSKRITEE 420

Query: 133 EILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG-SVSGVIRPPRNQ 191
           +     S+    +  +H L    ++RD+K EN+LL + G   + DF  S+          
Sbjct: 421 DAKFYASEVVAALEYLHLL--GFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSRDPTM 478

Query: 192 QELLYVQHDIMKN--------TTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYT 243
           ++  Y+   +  +         T +Y  PE++   RG       D W LG+ +Y++ +  
Sbjct: 479 KDSTYLDTKVCSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGILVYEMLFGC 535

Query: 244 TPFEKLGE----PAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
           TPF+          IL    +FP     S   K+LIK +L ++ S R
Sbjct: 536 TPFKGDNSNETFSKILTEDVKFPHDKEISKHCKDLIKRLLNKNESKR 582

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 129/303 (42%), Gaps = 58/303 (19%)

Query: 12  GTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRA 71
           G+++  G+HSV             +Y V      +F G  V C      P+K +   +  
Sbjct: 45  GSEINRGSHSV-------------VYKVFDSEDRIFAGKKVHC------PNKENKRKIIK 85

Query: 72  EVDAMKLL--ANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRL 129
           E++  K++  +++ H+V+  D+      +      ++++++YC    L   +  R    L
Sbjct: 86  ELEIYKVICRSHHNHIVALRDAFQWGKESC-----IYMILDYCSNNSLQSILQYR--GSL 138

Query: 130 TEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPR 189
            E E  ++M Q   GI  +H  +  ++H D+K+ N+L  +G   K+CDFGS       PR
Sbjct: 139 NEVECKELMIQLCGGIYWLH--LNNVIHGDLKLSNILFDEGQQLKICDFGSSFIATSSPR 196

Query: 190 NQQELLYVQHDIMKNTTAQYRCPEMLDLYRG--------LPIDEKADIWALGVFLYKLCY 241
              E++          T  Y  PE +  ++         L I    DIW++G+ LY L Y
Sbjct: 197 GPGEIM---------GTPYYLAPETVYTHKNINKSGMAILLISFPIDIWSMGIVLYSLLY 247

Query: 242 YTTPFEK---------LGE--PAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVC 290
              PF K         L E    I     +FP+        + LI  ML ++P +R  + 
Sbjct: 248 GINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLILKMLSQNPLERITLV 307

Query: 291 QVL 293
           +++
Sbjct: 308 EIV 310

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 87/184 (47%), Gaps = 22/184 (11%)

Query: 115  GGLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIY 173
             G ID  +    +  +TE E   I  Q   G+  +H+L   ++HRDIK ENV++   G  
Sbjct: 1130 SGCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSL--GIVHRDIKDENVIIDSKGYV 1187

Query: 174  KVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWA 231
            K+ DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA
Sbjct: 1188 KIIDFGSAAYVKNGPFD----VFVG-------TIDYAAPEVLAGNPYEGKP----QDIWA 1232

Query: 232  LGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQ 291
            LG+ LY + +   PF  + E  I+     F +  + +     LIK ML +    RP++ +
Sbjct: 1233 LGILLYTIIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINE 1290

Query: 292  VLEE 295
            V  +
Sbjct: 1291 VFSD 1294

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 113/271 (41%), Gaps = 39/271 (14%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNI---LRAEVDAMKLL 79
           +I K L  G F ++Y V  +  G      V  LK ++  D +  NI    R EV+    L
Sbjct: 110 EIGKVLGKGKFGRVYCVRHIESGF-----VCALKAMEKKDIIQYNIEKQFRREVEIQSSL 164

Query: 80  ANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMS 139
            +      Y   H  +         V+LLMEY   G L   +  R  +   +      + 
Sbjct: 165 RHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGR--SHFNDVVASYYVY 214

Query: 140 QTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQH 199
           Q    +  MH     +LHRDIK EN+++      K+ DFG    VI P  ++++ L    
Sbjct: 215 QMADALDYMHE--RNILHRDIKPENIIIGFNNTIKLTDFGW--SVITPKGSKRKTL---- 266

Query: 200 DIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFE----KLGEPAIL 255
                 T  Y  PE++   R    +EK D+WALGV  Y+L   + PFE    +L    IL
Sbjct: 267 ----CGTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRIL 319

Query: 256 HARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
                FP   +   R  +LI  +L   P DR
Sbjct: 320 KRNLIFPDHVDTEAR--HLISRLLEYDPGDR 348

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 110/228 (48%), Gaps = 31/228 (13%)

Query: 73  VDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLT 130
           ++ + ++  +KH  +V++IDS+  +        +++++MEY EGG L D +   +   LT
Sbjct: 372 INEILVMKGSKHSNIVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 421

Query: 131 EPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRN 190
           E +I  +  +T +G+  +H+    ++HRDIK +N+LLS  G  K+ DFG  +        
Sbjct: 422 EGQIGAVCRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFGFCA-------- 471

Query: 191 QQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPF--EK 248
           Q   + ++   M   T  +  PE++      P   K DIW+LG+ + ++     P+  E 
Sbjct: 472 QINEVNLKRTTMVG-TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 527

Query: 249 LGEPAILHARFQFPSF---PNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
                 L A    P      N SD LK  +   L+  P DR N  ++L
Sbjct: 528 PLRALYLIATNGTPKLKDPENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 100/197 (50%), Gaps = 25/197 (12%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +V++ +EYC G  L D++  +   R+   E   + +Q    +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGNELYDYLLQK--QRIPLDETSKLFAQIVGAVFYAHSL--QCVHRDLKLE 157

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGL 221
           N+LL K G   + DF    G  R    + +L     + +  TT  Y  PE++  + Y G 
Sbjct: 158 NILLDKQGYAMLTDF----GFTRECATKTQL-----ETICGTTV-YMAPELIKRESYDGY 207

Query: 222 PIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF---PSFPNYSD-RLKNLIKS 277
               K D W+LG+ LY + +   PF++  +P +   +      P    Y++   K+LI  
Sbjct: 208 ----KVDTWSLGIILYTMLHGFMPFDE-EDPTLTGLKIMNEMPPIVDAYTNVHAKDLILK 262

Query: 278 MLREHPSDRPNVCQVLE 294
           +LR+ PS+RP++ +VLE
Sbjct: 263 LLRKTPSERPSLNKVLE 279

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 125/291 (42%), Gaps = 55/291 (18%)

Query: 31   GGFAQIYAVEILSMGLFNGSNVACLKRVKVP-----DKLSLNILRAEVDAMKLLANNKH- 84
            G F  +Y    L + +  G  +A +K+V+VP     D+ ++N   A +  +  L +  H 
Sbjct: 1133 GSFGAVY----LGLNVTTGEMMA-VKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHL 1187

Query: 85   -VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQ 143
             +V Y+          +  Y +FL  EY  GG +   +  RL     E  I  + +Q  +
Sbjct: 1188 NIVQYLGFE-----NKNCIYSLFL--EYVAGGSVGSLI--RLYGHFDEQLIRFLTTQVLE 1238

Query: 144  GIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMK 203
            G+A +H  +  +LHRD+K +N+LL   G+ K+ DF    G+ R   N    +Y   ++  
Sbjct: 1239 GLAYLH--LRGILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNSEMTM 1288

Query: 204  NTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF-- 261
              T  +  PEM+D  +G     K DIW+LG  + ++     P+  L    ++ A FQ   
Sbjct: 1289 RGTVFWMAPEMVDTTQGY--SAKVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFQIGK 1343

Query: 262  ---------PSFPNYSDRLKNLIKSMLREHPSDRPNV--------CQVLEE 295
                      + P+ S   +  +       P +RP          CQV +E
Sbjct: 1344 SKSAPPIPEDTLPHISQDGRAFLDDCFMIDPEERPTADTLLSHPFCQVPKE 1394

>NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON}
           Anc_6.371
          Length = 918

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 125/294 (42%), Gaps = 43/294 (14%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAVE------ILSMGLFNGSNVACLKRVKVPDKLSLNI 68
           +TVG  S + +K L  G   ++Y V       + ++ +F+ S +   K++K        I
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIK-------RI 564

Query: 69  LRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNR 128
           L  +    ++LA + H       H+ +S        ++  MEYC GG     + TR    
Sbjct: 565 LAEQ----EILATSNHPFVVTLYHSFQSED-----YLYFCMEYCMGGEFFRALQTRRTKC 615

Query: 129 LTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG----SVSGV 184
           ++E +     S+ T  +  +H L    ++RD+K EN+LL K G   + DF     +    
Sbjct: 616 ISEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFDLSVQAKDAK 673

Query: 185 IRPPRNQQELLYVQHDIMKN--------TTAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236
           +   +   E   V   I  +         T +Y  PE++   RG       D W LG+ +
Sbjct: 674 VPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILI 730

Query: 237 YKLCYYTTPFEKLGE----PAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
           Y++ +  TPF+          IL     FP+  + S   K+LIK +L ++ + R
Sbjct: 731 YEMLFGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKNEAKR 784

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 84/180 (46%), Gaps = 22/180 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +    +  +TE E   I  Q   GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLHD--QGIVHRDIKDENVIVDSKGFVK 1245

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL    +F +    S+    LIKS+L     +RP +  +
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRPTIDDI 1348

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 129/293 (44%), Gaps = 55/293 (18%)

Query: 31  GGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVD----AMKLLANNKHVV 86
           G F  +Y       G +  +   C  +V     L+L+    EV+     ++ L++ K V 
Sbjct: 28  GKFGVVYK------GYYTKTKQVCAIKV-----LNLDSADDEVEDVQKEIQFLSSLKQVP 76

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
           +   +H   S  ND   +++++MEYC GG L   +      ++ E  I  IM +     A
Sbjct: 77  NI--THYYGSYLND--TKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TA 127

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
           +MH     ++HRDIK  NVL++  G  K+CDFG  + + +    +Q +           T
Sbjct: 128 LMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GT 178

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKL-----------GEPAIL 255
             +  PE+  +  G+  D K DIW+LG+  Y++     P+ ++            +P  L
Sbjct: 179 PYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRL 236

Query: 256 HARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEE--VSRMQNVPCPI 306
             R        +S  LK +I   L E P +RP+   +L+   +   +NVP  I
Sbjct: 237 EGR-------QHSSALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPVSI 282

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 121/252 (48%), Gaps = 36/252 (14%)

Query: 52  VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEY 111
           +  +K++ +  +    ++  E+  MK   +N +VV++I++H ++         ++++MEY
Sbjct: 542 LVAIKQMDLEKQPKKELILNEIIVMKESRHN-NVVNFINAHLSKG-------NLWIVMEY 593

Query: 112 CEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGG 171
            EGG L D +   L   L+E +I  +  +T +G+  +H+    ++HRDIK +NVLLS  G
Sbjct: 594 MEGGSLTDVVTHCL---LSEGQIGAVCRETLEGLKFLHS--KGVIHRDIKSDNVLLSMKG 648

Query: 172 IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWA 231
             K+ DFG  + +     N+  ++          T  +  PE++      P   K DIW+
Sbjct: 649 DIKLTDFGFCAQINDIDLNRTTMV---------GTPYWMAPEVVSRKEYGP---KVDIWS 696

Query: 232 LGVFLYKLCYYTTPFEKLGEPAILHARF--------QFPSFPNYSDRLKNLIKSMLREHP 283
           LG+ + ++     P+  L E A L A +        +     N SD   N +   LR  P
Sbjct: 697 LGIMIIEMIEGEPPY--LNE-APLKALYLIATNGTPKLKEPENLSDVFSNFLDRCLRVEP 753

Query: 284 SDRPNVCQVLEE 295
            +R +  ++L +
Sbjct: 754 EERASAIELLAD 765

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 93/200 (46%), Gaps = 32/200 (16%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG   D + T   N L E ++  I  +  +G+  +H      +HRDIK  N
Sbjct: 86  MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHD--QKKIHRDIKAAN 143

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPID 224
           +LL+  G  K+ DFG VSG IR    +   +          T  +  PE+++       +
Sbjct: 144 ILLTDEGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVVN-KESNGYN 192

Query: 225 EKADIWALGVFLYKLCYYTTPFEKLG-----------EPAILHARFQFPSFPNYSDRLKN 273
           EKADIW+LG+ +Y+L     P  K             +P  LH +        YSD  K 
Sbjct: 193 EKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQ--------YSDVAKG 244

Query: 274 LIKSMLREHPSDRPNVCQVL 293
            + + L + P+ RP+   +L
Sbjct: 245 FVAACLVKDPNLRPSAEMLL 264

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 125/275 (45%), Gaps = 28/275 (10%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANN 82
           +IL+ +  G F  +Y    L+        V  L+    P    +++L  E+  +  L + 
Sbjct: 21  EILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDEP----IDLLAQEIFFLSELRS- 75

Query: 83  KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTT 142
                YI ++ T    +     ++++MEYC GG   + +    +++LTE +   I+S+  
Sbjct: 76  ----PYITNYKTAFLVD---VSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVL 128

Query: 143 QGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIM 202
            G+  +H+     +HRDIK  N+LL+  G  K+ DFG VSG +   R +   +       
Sbjct: 129 VGLDYLHS--QRKIHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV------- 178

Query: 203 KNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHA--RFQ 260
              T  +  PE++D  +    +E ADIW+LG+ + +L     P +K      L A  +  
Sbjct: 179 --GTPFWMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRD 235

Query: 261 FPSF-PNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
            P     +S   K+ +   L + PS RP   ++L+
Sbjct: 236 PPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 108/247 (43%), Gaps = 31/247 (12%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG L   +      ++ E  I  IM +    +  +H     ++HRDIK  N
Sbjct: 95  LWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIHK--DNVIHRDIKAAN 149

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPID 224
           VL++  G  K+CDFG  + V     NQ  L   +   M   T  +  PE+  +  G+  D
Sbjct: 150 VLITNEGNVKLCDFGVAAQV-----NQTSL---RRQTMAG-TPYWMAPEV--IMEGVYYD 198

Query: 225 EKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFP------NYSDRLKNLIKSM 278
            K DIW+LG+  Y++     P+ ++   A+   +    S P      +YS  LK  I   
Sbjct: 199 TKVDIWSLGITTYEIATGNPPYCEV--EALRAMQLIIKSKPPRLEGRSYSPSLKEFIALC 256

Query: 279 LREHPSDRPNVCQVLEE--VSRMQNVPCP-----IRNFYLLRAMEKVKLSTEIDYPQLQL 331
           L E P +R +   +L+   +   +  P       I  + L R   K     E   P+ +L
Sbjct: 257 LDEDPKERLSADDLLKSKFIKNHKTTPTSILKELISRYLLFRDKNKSMYRIEGSIPENEL 316

Query: 332 QKLRNAQ 338
            K   AQ
Sbjct: 317 SKPTEAQ 323

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 82/177 (46%), Gaps = 19/177 (10%)

Query: 117 LIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVC 176
           L DF+  +  +++ E E   I  Q   GI  +H L   ++HRDIK EN+++   G  +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEK-ADIWALGVF 235
           DFGS +     P        V H      T  Y  PE+L   +G P + K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGP------FQVFH-----GTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
           LY + +  TPF  + E              N SD+ + LI  ML +    RP + ++
Sbjct: 868 LYIITFKQTPFNSVAEIIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 127/276 (46%), Gaps = 48/276 (17%)

Query: 30  SGGFAQIYAVEILSMGLFNGSNVA-CLKRVKVPDKLSLNILRAEVDAMKLLANNKH--VV 86
           SGG    Y +         G+NV+  +K++ +  +    ++  E+  MK    +KH  +V
Sbjct: 631 SGGVYTAYEI---------GTNVSVAIKQMNLEKQPKKELIINEILVMK---GSKHPNIV 678

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
           ++IDS+  +        +++++MEY EGG L D +   +   LTE +I  +  +T  G+ 
Sbjct: 679 NFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLE 728

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            +H+    +LHRDIK +N+LLS  G  K+ DFG  +        Q   L ++   M   T
Sbjct: 729 FLHS--KGVLHRDIKSDNILLSMEGDIKLTDFGFCA--------QINELNLKRTTMVG-T 777

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI----LHARFQFP 262
             +  PE++      P   K DIW+LG+ + ++     P+  L E  +    L A    P
Sbjct: 778 PYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY--LNETPLRALYLIATNGTP 832

Query: 263 SF---PNYSDRLKNLIKSMLREHPSDRPNVCQVLEE 295
                 N S  LK  +   L   P DR +  ++L +
Sbjct: 833 KLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 92/202 (45%), Gaps = 34/202 (16%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG +   +      ++ E  I  IM +    +  +H     ++HRDIK  N
Sbjct: 114 LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELLVALHYIHK--DNVIHRDIKAAN 168

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPID 224
           +L++  G  K+CDFG  + + +    +Q +           T  +  PE+  +  G+  D
Sbjct: 169 LLITNEGNVKLCDFGVAAQLNQNTMRRQTMA---------GTPYWMAPEV--IMEGISYD 217

Query: 225 EKADIWALGVFLYKLCYYTTPFEKL-----------GEPAILHARFQFPSFPNYSDRLKN 273
            KADIW++G+  Y++     PF ++            +PA L  +       N+   LK 
Sbjct: 218 TKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGK-------NHDPLLKE 270

Query: 274 LIKSMLREHPSDRPNVCQVLEE 295
            I   L E P +RP   ++L E
Sbjct: 271 FIAMCLDEDPQERPTADKLLHE 292

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 129/274 (47%), Gaps = 44/274 (16%)

Query: 30  SGGFAQIYAVEILSMGLFNGSNVA-CLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSY 88
           SGG    Y V         G+N +  +K++ +  +    ++  E+  MK  + + ++V++
Sbjct: 678 SGGVYTAYEV---------GTNASVAIKQMNLEKQPKKELIINEILVMKA-SKHANIVNF 727

Query: 89  IDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVM 148
           IDS+  R        +++++MEY EGG L D +   +   LTE +I  +  +T +G+  +
Sbjct: 728 IDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFL 777

Query: 149 HALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQ 208
           H+    ++HRDIK +NVLLS  G  K+ DFG  +        Q   + ++   M   T  
Sbjct: 778 HS--KGVIHRDIKSDNVLLSMSGEIKLTDFGFCA--------QINEINLKRTTMVG-TPY 826

Query: 209 YRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI----LHARFQFPSF 264
           +  PE++      P   K DIW+LG+ + ++     P+  L E  +    L A    P  
Sbjct: 827 WMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY--LNETPLRALYLIATNGTPEL 881

Query: 265 PN---YSDRLKNLIKSMLREHPSDRPNVCQVLEE 295
            +    SD LK+ +   L  +P +R    Q+L +
Sbjct: 882 KDADSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 113/233 (48%), Gaps = 35/233 (15%)

Query: 73  VDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLT 130
           ++ + ++  +KH  +V++IDS+       DG  +++++MEY EGG L D +   +   LT
Sbjct: 670 INEILVMKGSKHPNIVNFIDSYLL-----DG--DLWVIMEYMEGGSLTDVVTHCI---LT 719

Query: 131 EPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRN 190
           E +I  +  +T  G+  +H+    +LHRDIK +N+LLS  G  K+ DFG  + V      
Sbjct: 720 EGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSINGNIKLTDFGFCAQVNETTLK 777

Query: 191 QQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLG 250
           +  ++          T  +  PE++      P   K DIW+LG+ + ++     P+  L 
Sbjct: 778 RTTMV---------GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY--LN 823

Query: 251 EPAI----LHARFQFPSFPN---YSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           E  +    L A    P        SD LK+ +   L  +P  R +  ++LE+V
Sbjct: 824 ETPLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {ON}
           similar to uniprot|P53739 Saccharomyces cerevisiae
           YNR047w or uniprot|P25341 Saccharomyces cerevisiae
           YCR091w KIN82
          Length = 895

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 128/296 (43%), Gaps = 47/296 (15%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAVE------ILSMGLFNGSNVACLKRVKVPDKLSLNI 68
           +TVG  S + ++ L  G   ++Y V+      + ++ +F+ S +   K++K        I
Sbjct: 490 ITVGPQSFEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKKIK-------RI 542

Query: 69  LRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNR 128
           L  +    ++LA + H       H+ +S        ++L MEYC GG     + TR    
Sbjct: 543 LAEQ----EILATSNHPFVVTLYHSFQSED-----YLYLCMEYCMGGEFFRALQTRKSKC 593

Query: 129 LTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG----SVSGV 184
           ++E +     S+ T  +  +H L    ++RD+K EN+LL + G   + DF     +    
Sbjct: 594 ISEEDAKFYASEVTAALEYLHLL--GFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDAK 651

Query: 185 IRPPRNQQELLYVQHDIMKN--------TTAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236
           +   +   +   V   I  +         T +Y  PE++   RG       D W LG+ +
Sbjct: 652 VPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILI 708

Query: 237 YKLCYYTTPFEKLGEPA------ILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
           Y++ +  TPF+  GE        IL     FP+    S   K+LIK +L ++ S R
Sbjct: 709 YEMLFGFTPFK--GENTNETFSNILKKDVTFPNNNEVSRNCKDLIKKLLIKNESKR 762

>YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putative
           serine/threonine protein kinase implicated in the
           regulation of phospholipid asymmetry through the
           activation of phospholipid translocases (flippases)
           Lem3p-Dnf1p/Dnf2p; similar to Fpk1p
          Length = 720

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 129/297 (43%), Gaps = 52/297 (17%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAV------EILSMGLFNGSNVACLKRVKVPDKLSLNI 68
           +TV   S + ++ L  G   ++Y V      +I ++ + N   +  +KR K+   L+   
Sbjct: 317 ITVEPQSFEKIRLLGQGDVGKVYLVRERDTNQIFALKVLNKHEM--IKRKKIKRVLT--- 371

Query: 69  LRAEVDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQ 126
                   ++LA + H  +V+   S  T+         ++L MEYC GG     + TR  
Sbjct: 372 ------EQEILATSDHPFIVTLYHSFQTKD-------YLYLCMEYCMGGEFFRALQTRKS 418

Query: 127 NRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG---SVSG 183
             + E +     S+    +  +H L    ++RD+K EN+LL + G   + DF      +G
Sbjct: 419 KCIAEEDAKFYASEVVAALEYLHLL--GFIYRDLKPENILLHQSGHVMLSDFDLSIQATG 476

Query: 184 VIRPPRNQQELLYVQHDIMKN--------TTAQYRCPEMLDLYRGLPIDEKADIWALGVF 235
             +P    ++  Y+   I  +         T +Y  PE++   RG       D W LG+ 
Sbjct: 477 SKKP--TMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGIL 531

Query: 236 LYKLCYYTTPFEKLGEPA------ILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
           +Y++ +  TPF+  G+ +      IL    +FP     S   K+LIK +L ++ + R
Sbjct: 532 IYEMLFGCTPFK--GDNSNETFSNILTKDVKFPHDKEVSKNCKDLIKKLLNKNEAKR 586

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 128/301 (42%), Gaps = 49/301 (16%)

Query: 9   INVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVK--VPDKLSL 66
              G QL  G++S  +L      G  + YAV++LS        +   K+VK    +KL+L
Sbjct: 125 FKFGEQLGDGSYSSVVLATARDSG--KKYAVKVLSK-----EYLIRQKKVKYVTVEKLAL 177

Query: 67  NILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQ 126
             L      ++L    +   S                 ++ L+EY   G  +  +  +  
Sbjct: 178 QKLNGTKGIIRLFFTFQDEAS-----------------LYFLLEYASHGDFLGLI--KKY 218

Query: 127 NRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIR 186
             L E       SQ    +  +HA+   ++HRDIK EN+LL K    K+ DFG+   +  
Sbjct: 219 GSLNEKCARYYASQIIDAVDSLHAI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPE 276

Query: 187 PPRNQQEL-----LYVQHDIMKNTTAQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLC 240
            P N  +      LY +       TA+Y  PE+L D Y     D + DIWA G  LY++ 
Sbjct: 277 QPSNNADGKPCFDLYARSKSFVG-TAEYVSPELLNDSY----TDSRCDIWAFGCILYQMV 331

Query: 241 YYTTPFEKLGE----PAILHARFQFPS-FPNYSDRLKNLIKSMLREHPSDRPNVCQVLEE 295
               PF+   E      ++  ++ F + FP  +   K+L+K +L   P+DR  V Q+   
Sbjct: 332 AGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIA---KDLVKKLLVREPNDRLTVEQIKAH 388

Query: 296 V 296
           V
Sbjct: 389 V 389

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 105/216 (48%), Gaps = 18/216 (8%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++ L+EY   G L+  +  +      E   +   +Q    I  +H++   ++HRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSM--GIIHRDIKPEN 389

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNT-----TAQYRCPEML-DLY 218
           +LL+K    K+ DFG+ + ++ P +  Q       ++++ +     TA+Y  PE+L D Y
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 219 RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHA--RFQFPSFPNYSDRLKNLIK 276
                D + DIWA G  L++L     PF+   E        + Q+     +   L++LIK
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIK 504

Query: 277 SMLREHPSDRPNVCQVLEEV-SRMQNVPCPIRNFYL 311
            +L ++P++R  + Q+   +  R ++   P   +YL
Sbjct: 505 KILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYL 540

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 84/180 (46%), Gaps = 22/180 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +    +  +TE E   I+ Q   GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1192 GCIDLFDLIEFKTNMTECEAKLIVKQVVAGIKHLHD--QGIVHRDIKDENVIVDSKGFVK 1249

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA+
Sbjct: 1250 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGNPYEGKP----QDIWAI 1294

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL    +F +    S+    LIKS+L      RP +  +
Sbjct: 1295 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1352

>Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL045W
            (REAL)
          Length = 1106

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 84/187 (44%), Gaps = 21/187 (11%)

Query: 111  YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
            + E G +  F     +  + E E   +  Q    I  +H     ++HRDIK EN+++   
Sbjct: 934  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVSSIKHLHD--QGIVHRDIKDENIIVDSH 991

Query: 171  GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKAD 228
            G  K+ DFGS +     P +    ++V        T  Y  PE+L    Y+G P     D
Sbjct: 992  GFVKLIDFGSAAYTKSGPFD----VFV-------GTMDYAAPEVLGGSSYKGKP----QD 1036

Query: 229  IWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPN 288
            IWALGV LY + Y   P+  + E  IL    +F +  N SD   +LIK +L      RP 
Sbjct: 1037 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDNAENVSDECISLIKGILTREVDKRPT 1094

Query: 289  VCQVLEE 295
            +  + ++
Sbjct: 1095 IDDIYQD 1101

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 130/282 (46%), Gaps = 52/282 (18%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSN-VACLKRVKVPDKLSLNILRAEVDAMKLLAN 81
           KILK +  G F ++Y      + L   ++   CLK     DK   NI+R EV   +   +
Sbjct: 42  KILKQIGEGSFGKVY------LALHRPTHRKVCLK---TSDKNDPNIVR-EVFYHRQF-D 90

Query: 82  NKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQT 141
             ++    +   T S       +V++ +EYC G  L D + +   +R++  E  ++ +Q 
Sbjct: 91  FPYITKLYEVIVTES-------KVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQI 141

Query: 142 TQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDI 201
           +  +   H++    +HRD+K+EN+LL K G  K+ DF    G  R    +  L  V    
Sbjct: 142 SGAVYYAHSM--HCVHRDLKLENILLDKNGNAKLTDF----GFTRECMTKTTLETV---- 191

Query: 202 MKNTTAQYRCPEML--DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARF 259
               T  Y  PE++    Y G  I    D W+LGV LY L   + PF+   E     A+ 
Sbjct: 192 --CGTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDDDDE-----AKT 240

Query: 260 QFP---SFPNYSDRL-----KNLIKSMLREHPSDRPNVCQVL 293
           ++      P Y  +L     K+LI  +L ++P +RP++ QVL
Sbjct: 241 KWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 93/196 (47%), Gaps = 24/196 (12%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG L   +      ++ E  I  IM +    + V+H     ++HRDIK  N
Sbjct: 88  LWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIHK--DNVIHRDIKAAN 142

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPID 224
           VL++  G  K+CDFG  + + +    +Q +           T  +  PE+  +  G+  D
Sbjct: 143 VLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEV--IMEGVYYD 191

Query: 225 EKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFP------NYSDRLKNLIKSM 278
            K DIW+LG+  Y++     P+  +   A+   +    S P      NY+ +LK  I   
Sbjct: 192 TKVDIWSLGITAYEIATGNPPYCDV--EALRAMQLIIKSKPPRLEERNYTPQLKEFIALC 249

Query: 279 LREHPSDRPNVCQVLE 294
           L E P +R +  ++L+
Sbjct: 250 LDEDPQERLSAEELLK 265

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 106/234 (45%), Gaps = 33/234 (14%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           E++L++EY +GG L D++ +R   +L E E +    Q  QG+A  HA    + HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAF--NICHRDLKPE 228

Query: 164 NVLLS-KGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTA--QYRCPEML--DLY 218
           N+LL  K  I K+ DFG  +            L V   ++  +     Y  PE++    Y
Sbjct: 229 NLLLDKKNKIIKIADFGMAA------------LEVSDKLLSTSCGSPHYASPEIVMGKSY 276

Query: 219 RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQFPSFPNYSDRLKNL 274
            G P     D+W+ G+ L+ L     PF       +L       +  PS  + S   K+L
Sbjct: 277 HGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMPS--DLSPDAKDL 330

Query: 275 IKSMLREHPSDRPNVCQVLEE--VSRMQNVPCPIRNFYLLRAMEKVKLSTEIDY 326
           I  +L   P  R    ++L    +++   +    RN+    +M + K ++ +++
Sbjct: 331 ISKILVVDPDKRLTTTEILNHSLITKYDRMGLTNRNYNNNLSMARDKSNSNLNF 384

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 96/203 (47%), Gaps = 39/203 (19%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           V++ +EYC G  L D++   L+ R+   E   + +Q    +   H+L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSL--QCVHRDLKLEN 158

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLP 222
           +LL K G   + DF    G  R    + +L  V        T  Y  PE++  + Y G  
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELIKREAYDGY- 207

Query: 223 IDEKADIWALGVFLYKLCYYTTPFE-----KLG------EPAILHARFQFPSFPNYSDRL 271
              K D W+LG+ LY + +   PF+     + G      EPA+L            S + 
Sbjct: 208 ---KVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLD--------EYTSPQA 256

Query: 272 KNLIKSMLREHPSDRPNVCQVLE 294
           K+LI  +L ++ + RPN+ +VL+
Sbjct: 257 KDLIVRLLDKNAAQRPNLNEVLQ 279

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 132/288 (45%), Gaps = 47/288 (16%)

Query: 16  TVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRAEVDA 75
           T+G  S   +   TS    + YAV++LS        +   K+VK      +NI   E +A
Sbjct: 172 TLGDGSYSTVMLATSKESGKKYAVKVLSKEY-----LIRQKKVKY-----VNI---EKNA 218

Query: 76  MKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEIL 135
           ++ L N++ +V    +    S        ++ L+EY   G  +  M  +    L E    
Sbjct: 219 LQRLNNSRGIVKLYFTFQDES-------SLYFLLEYAPNGDFLSIM--KKYGSLNEDCAC 269

Query: 136 DIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELL 195
              +Q    I  +H+    ++HRDIK EN+LL K    K+ DFG+   ++ P  N  +  
Sbjct: 270 YYSAQIIDAIDFLHS--KGIVHRDIKPENILLDKDFKVKLTDFGTAK-ILEPKPNTTD-- 324

Query: 196 YVQHDIMKNT-----TAQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKL 249
              +D++  +     TA+Y  PE+L D Y    +D + DIWA G  L+++     PF+  
Sbjct: 325 --SYDLLSRSKSFVGTAEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGKPPFKAT 378

Query: 250 GE----PAILHARFQFPS-FPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            E      ++  ++ F + FP     +++L+K +L + P+ R  + Q+
Sbjct: 379 NEYLTFQKVMKVQYAFTAGFPLV---VRDLVKGILIKQPAQRLTIPQI 423

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 98/200 (49%), Gaps = 33/200 (16%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +V++ +EYC G  L + +      R++  E   + +Q    I   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHL--LALKRISLDECSRLFAQIVGAIYYAHSL--NCVHRDLKLE 157

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDL--YRGL 221
           N+LL K G  K+ DFG     +            Q D +  TT  Y  PE+ +   Y G 
Sbjct: 158 NILLDKKGNAKLTDFGFTRECVSKS---------QLDTICGTTV-YMAPELTERKSYDGF 207

Query: 222 PIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFP---SFPNYSDRL-----KN 273
            I    DIWALGV LY +   + PF++  E     A+ ++      P  ++ L     K+
Sbjct: 208 KI----DIWALGVILYTMINGSMPFDEDDE-----AKTKWKIVNEMPEINEDLVSPDAKD 258

Query: 274 LIKSMLREHPSDRPNVCQVL 293
           LI+ +L + P++RP++ ++L
Sbjct: 259 LIEQLLAKDPNERPSIEKIL 278

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (46%), Gaps = 34/201 (16%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +++++MEYC GG L     T L+    + + L ++ +    +A+++     ++HRDIK  
Sbjct: 94  KLWVIMEYCAGGSL----RTLLRPGKIDEKYLGVIVRNLL-VALLYIHKDNVIHRDIKAA 148

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPI 223
           NVL++ GG  K+CDFG  + +      +Q +           T  +  PE+  +  G+  
Sbjct: 149 NVLITNGGHVKLCDFGVAAQLTTANHKRQTMA---------GTPYWMAPEV--IMEGVYY 197

Query: 224 DEKADIWALGVFLYKLCYYTTPF---EKL--------GEPAILHARFQFPSFPNYSDRLK 272
           + KADIW+LG+  Y++     P+   E L         +P  L  R       NYS  LK
Sbjct: 198 NTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR-------NYSPLLK 250

Query: 273 NLIKSMLREHPSDRPNVCQVL 293
             I   L E P  RP   ++L
Sbjct: 251 EFIALCLDEDPEARPTAEELL 271

>TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON}
           Anc_6.371 YCR091W
          Length = 837

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 128/297 (43%), Gaps = 49/297 (16%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAVE------ILSMGLFNGSNVACLKRVKVPDKLSLNI 68
           +TVG  S + ++ L  G   ++Y V+      + ++ +F  S    +KR K+   L+   
Sbjct: 432 ITVGPQSFEKVRLLGQGDVGKVYLVKEKRTNRLYALKIF--SKAEMIKRKKIKRILA--- 486

Query: 69  LRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNR 128
                   ++LA + H       H+ +S        ++L MEYC GG     + TR    
Sbjct: 487 ------EQEILATSNHPFIVTLYHSFQSED-----YLYLCMEYCMGGEFFRALQTRKTKC 535

Query: 129 LTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPP 188
           ++E +     S+ T  +  +H +    ++RD+K EN+LL K G   + DF  +S   +  
Sbjct: 536 ISEDDARFYASEVTAALEYLHLM--GCIYRDLKPENILLHKSGHIMLSDF-DLSIQAKDA 592

Query: 189 RN-----QQELLYVQHDIMKN--------TTAQYRCPEMLDLYRGLPIDEKADIWALGVF 235
           +N       +   V   I  N         T +Y  PE++   RG       D W LG+ 
Sbjct: 593 KNPVVKGSAQSTLVDTKICSNGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGIL 649

Query: 236 LYKLCYYTTPFEKLGEPA------ILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
            Y++ +  TPF+  G+        IL +   FP+    S   K+LIK +L ++ S R
Sbjct: 650 TYEMLFGFTPFK--GDNTNETFCNILKSEVTFPNNNEISRACKDLIKKLLTKNESKR 704

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 101/199 (50%), Gaps = 29/199 (14%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +V++ +EYC G  L D +      R+   E  ++ +Q    +   H+L    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHL--LFSKRIPIAECTELFAQIVGAVYYAHSL--NCVHRDLKLE 161

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDL--YRGL 221
           N+LL K G  K+ DF    G  R    +  L  V        T  Y  PE+++   Y G 
Sbjct: 162 NILLDKHGRAKLTDF----GFTRECMTRSTLETV------CGTTVYMAPELIERKSYDGF 211

Query: 222 PIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF----PSFPN--YSDRLKNLI 275
            I    DIWALGV LY + Y   PF++  E   +  +++     P F N   S+ +K+LI
Sbjct: 212 KI----DIWALGVILYTMIYGAMPFDEDDE---VKTKWKIVNEDPDFTNNISSNDVKDLI 264

Query: 276 KSMLREHPSDRPNVCQVLE 294
           K +L++ P++RP + ++L+
Sbjct: 265 KKLLKKDPTERPTIREILK 283

>TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1730

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 137/309 (44%), Gaps = 60/309 (19%)

Query: 26   KYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN----ILRAEVDAMKLLAN 81
            K++ SG F  +++   L  G     +V  +K +K+ D  ++     +++ E+  +++L N
Sbjct: 1413 KFIGSGTFGNVFSAVNLDSG-----DVLAVKEIKIQDTKAMKKVFPLIKKEMTVLEML-N 1466

Query: 82   NKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFM-NTRLQNRL-TEPEILDIMS 139
            + ++V Y      R   N       + MEYCEGG L   + + R+++ + T+   L+++ 
Sbjct: 1467 HPNIVQYYGVEVHRDKVN-------IFMEYCEGGSLASLLEHGRIEDEMVTQVYTLELL- 1518

Query: 140  QTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS----------VSGVIRPPR 189
               +G++ +H     ++HRDIK EN+LL   GI K  DFG+          ++   +  +
Sbjct: 1519 ---EGLSYLHQ--SGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKDHTRIASFSKDGK 1573

Query: 190  NQQELLYVQHDIMKNTTA-------------QYRCPEMLDLYRGLPIDEKA---DIWALG 233
            + +E   +   +++   A              Y  PE +    G P   K    D+W+LG
Sbjct: 1574 DNKESKKIDDTLLETEEAGVGTGLYDMVGTPMYMAPEAIS---GSPNKNKFGSDDVWSLG 1630

Query: 234  VFLYKLCYYTTPFEKL-GEPAILHARF-----QFPSFPNYSDRLKNLIKSMLREHPSDRP 287
              + ++     P+  L  E AI++        Q PS    S    N +K  L++ P  R 
Sbjct: 1631 CVVLEMITGRRPWANLDNEWAIMYHVAAGHSPQLPSKDEVSTNGNNFLKRCLQQDPYKRA 1690

Query: 288  NVCQVLEEV 296
                +L +V
Sbjct: 1691 TAVDLLMDV 1699

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 126/302 (41%), Gaps = 45/302 (14%)

Query: 8    RINVGTQLTVGTHS-VKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKL-- 64
             IN+G+Q  +   S   IL+ +  G + ++      ++ + N  +   + ++   +++  
Sbjct: 826  EINIGSQKRIKRFSDFTILQVMGEGAYGKV------NLCIHNKMHYIVVIKMIFKERILV 879

Query: 65   -------SLNILRAEVDAMKLLANN--KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGG 115
                    L  + +E+  M  L  N  K+++  +D         D  Y       + E G
Sbjct: 880  DTWVRDRKLGTIPSEIQIMATLNKNSQKNILKLLDFF------EDDDYYYIETPVHGETG 933

Query: 116  GLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKV 175
             +  F     +  + E E   +  Q    I  +H     ++HRDIK ENV++   G  K+
Sbjct: 934  SIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHN--QGIVHRDIKDENVIVDSHGFVKL 991

Query: 176  CDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWALG 233
             DFGS + V   P +    ++V        T  Y  PE+L    Y+G P     DIWALG
Sbjct: 992  IDFGSAAYVKSGPFD----VFV-------GTMDYAAPEVLGGSSYKGKP----QDIWALG 1036

Query: 234  VFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVL 293
            V LY + Y   P+  + E  IL    +F      S+    LIK +L      RP + ++ 
Sbjct: 1037 VLLYTIIYKENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPTIDEIY 1094

Query: 294  EE 295
            E+
Sbjct: 1095 ED 1096

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 83/187 (44%), Gaps = 21/187 (11%)

Query: 111  YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
            + E G +  F     +  + E E   +  Q    I  +H     ++HRDIK ENV++   
Sbjct: 929  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHG--QGIVHRDIKDENVIVDSH 986

Query: 171  GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKAD 228
            G  K+ DFGS + +   P +    ++V        T  Y  PE+L    Y+G P     D
Sbjct: 987  GFVKLIDFGSAAYIKSGPFD----VFV-------GTMDYAAPEVLGGSSYKGKP----QD 1031

Query: 229  IWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPN 288
            IWALGV LY + Y   P+  + E  IL    +F      S+    LIK +L      RP 
Sbjct: 1032 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILTREVDKRPT 1089

Query: 289  VCQVLEE 295
            + ++ E+
Sbjct: 1090 IDEIYED 1096

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 98/212 (46%), Gaps = 33/212 (15%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           E++L++EY +GG L D++ +R   +L E E +    Q  +G++  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSF--NICHRDLKPE 243

Query: 164 NVLL-SKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTA--QYRCPE--MLDLY 218
           N+LL  K    K+ DFG  +            L + + ++K +     Y  PE  M   Y
Sbjct: 244 NLLLDKKNKKIKIADFGMAA------------LELPNKLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAIL----HARFQFPSFPNYSDRLKNL 274
            G P    +D+W+ G+ L+ L     PF       +L      ++Q P   N S   +NL
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPM--NLSLEARNL 345

Query: 275 IKSMLREHPSDRPNVCQVLEE--VSRMQNVPC 304
           I  +L   P  R    ++LE   + +  N+P 
Sbjct: 346 ISKILVIDPEKRITTQEILEHPLIKKYDNLPV 377

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 85/187 (45%), Gaps = 21/187 (11%)

Query: 111  YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
            + E G +  F     +  + E E   +  Q    I  +H     ++HRDIK ENV++   
Sbjct: 929  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHD--QGIVHRDIKDENVIVDSH 986

Query: 171  GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKAD 228
            G  K+ DFGS + +   P +    ++V        T  Y  PE+L    Y+G P     D
Sbjct: 987  GFVKLIDFGSAAYIKSGPFD----VFV-------GTMDYAAPEVLGGSSYKGKP----QD 1031

Query: 229  IWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPN 288
            IWALGV LY + Y   P+  + E  IL    +F    + S+   +LIK +L      RP 
Sbjct: 1032 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPT 1089

Query: 289  VCQVLEE 295
            + ++ E+
Sbjct: 1090 IDEIYED 1096

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 83/180 (46%), Gaps = 22/180 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +    +  +TE E   I  Q   GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1189 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLHD--QGIVHRDIKDENVIVDSKGFVK 1246

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA+
Sbjct: 1247 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGNPYEGQP----QDIWAI 1291

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL    +F +    S+    LIKS+L      RP +  +
Sbjct: 1292 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEGVSEDCIELIKSILNRCVPKRPTIDDI 1349

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 83/180 (46%), Gaps = 22/180 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +    +  +TE E   I  Q   GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLHD--QGIVHRDIKDENVIVDSKGFVK 1245

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL    +F +    S+    LIKS+L      RP +  +
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1348

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 90/193 (46%), Gaps = 15/193 (7%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++M+YC GG   D +     N + E ++  I+     G+  +H      +HRDIK  N
Sbjct: 87  MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHE--QKKIHRDIKAAN 144

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPID 224
           +LL+  G  K+ DFG VSG I+    +   +          T  +  PE+++       D
Sbjct: 145 ILLTDDGQVKLGDFG-VSGQIKATLKRDTFV---------GTPYWMAPEVINKEINNGYD 194

Query: 225 EKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQF--PSFPN-YSDRLKNLIKSMLRE 281
           EK DIW+LG+  Y+L     P  K     ++ +  +   P     Y+D  K+ I   L +
Sbjct: 195 EKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIK 254

Query: 282 HPSDRPNVCQVLE 294
            P  RPNV  +L+
Sbjct: 255 DPKLRPNVQNLLK 267

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 98/195 (50%), Gaps = 23/195 (11%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIE 163
           +V++  EYC G  L D +   LQ R+     +++ +Q    +   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSL--NCVHRDLKLE 158

Query: 164 NVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGL 221
           N+LL K G  K+ DFG           ++ +     + +  TT  Y  PE++  + Y G 
Sbjct: 159 NILLDKNGNAKLTDFGFT---------RECMTKTSLETICGTTV-YMAPELIKRESYDGF 208

Query: 222 PIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI-LHARFQFPSFPN--YSDRLKNLIKSM 278
            I    DIW+LGV LY +   + PF++  E         + P F +   S+  K+L+  +
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKL 264

Query: 279 LREHPSDRPNVCQVL 293
           L + P++RP++ ++L
Sbjct: 265 LSKDPNERPSMQEIL 279

>NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {ON}
           Anc_6.262 YPL236C
          Length = 406

 Score = 75.9 bits (185), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 77/154 (50%), Gaps = 9/154 (5%)

Query: 157 HRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLD 216
           HR+IK  N+L S  G   + D  S S      +  +++L  +  I    +  +  PE+LD
Sbjct: 251 HRNIKPSNILFSSDGSQVISDLSSTSKSNIHLKTGKQILDFKEWIDSCCSVPFMSPELLD 310

Query: 217 LYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPA-------ILHARFQFP-SFPNYS 268
           L  G  IDEK DIW+LG  +Y +    +PFE+  +         IL A F FP     ++
Sbjct: 311 LKMGSKIDEKVDIWSLGCTIYTIILGVSPFEREVQLTGKSIRMLILSANFTFPEGMERHA 370

Query: 269 DR-LKNLIKSMLREHPSDRPNVCQVLEEVSRMQN 301
            R L + IK  L+  P+ RP + Q+L ++  +Q+
Sbjct: 371 SRELIDTIKQCLQVDPTKRPTINQLLNDLQALQS 404

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 127/276 (46%), Gaps = 48/276 (17%)

Query: 30  SGGFAQIYAVEILSMGLFNGSNVA-CLKRVKVPDKLSLNILRAEVDAMKLLANNKH--VV 86
           SGG    Y +         G+NV+  +K++ +  +    ++  E+  MK    +KH  +V
Sbjct: 610 SGGVYTAYEI---------GTNVSVAIKQMNLEKQPKKELIINEILVMK---GSKHPNIV 657

Query: 87  SYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIA 146
           ++IDS+  +        +++++MEY EGG L D +   +   LTE +I  +  +T  G+ 
Sbjct: 658 NFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLK 707

Query: 147 VMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTT 206
            +H+    +LHRDIK +N+LLS  G  K+ DFG  +        Q   L ++   M   T
Sbjct: 708 FLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCA--------QINELNLKRTTMVG-T 756

Query: 207 AQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI----LHARFQFP 262
             +  PE++      P   K DIW+LG+ + ++     P+  L E  +    L A    P
Sbjct: 757 PYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY--LNETPLRALYLIATNGTP 811

Query: 263 SF---PNYSDRLKNLIKSMLREHPSDRPNVCQVLEE 295
                 N S  LK  +   L   P +R +  ++L +
Sbjct: 812 KLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 847

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 116/247 (46%), Gaps = 28/247 (11%)

Query: 52  VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEY 111
           V  +K +   +   LN + AE+  +K L N+ ++V Y   H     +    YE+++L+EY
Sbjct: 50  VVAIKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY---HGFIRKS----YELYILLEY 101

Query: 112 CEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGG 171
           C  G L   + +R    L+E E    ++QT  G+  +H     ++HRDIK  N+LLS   
Sbjct: 102 CANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 172 IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWA 231
             K+ DFG VS ++    N   L           T  +  PE+L   RG      +DIW+
Sbjct: 159 TVKLADFG-VSTIV----NSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWS 203

Query: 232 LGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFP--NYSDRLKNLIKSMLREHPSDRPNV 289
           LG  + ++     P+  L +  I +A      +P  ++S+ LK+ +     ++   RP  
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTA 263

Query: 290 CQVLEEV 296
            Q+L+ V
Sbjct: 264 DQLLKHV 270

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYK 174
            G ID  +    +  +TE E   I  Q   GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1214 GCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLHD--QGIVHRDIKDENVIVDSKGCVK 1271

Query: 175  VCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKADIWAL 232
            + DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     DIWA+
Sbjct: 1272 IIDFGSAAYVKSGPFD----VFVG-------TIDYAAPEVLSGEPYEGKP----QDIWAI 1316

Query: 233  GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
            G+ LY + +   PF  + E  IL    +F +  + S+    LIK +L      RP + ++
Sbjct: 1317 GILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEI 1374

Query: 293  LEE 295
              +
Sbjct: 1375 FND 1377

>TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON}
            Anc_6.371 YCR091W
          Length = 1248

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 135/296 (45%), Gaps = 47/296 (15%)

Query: 15   LTVGTHSVKILKYLTSGGFAQIYAVE------ILSMGLFNGSNVACLKRVKVPDKLSLNI 68
            +TVG  S + ++ L  G   ++Y V+      + ++ +FN S +  +KR K+   L+   
Sbjct: 845  ITVGPTSFEKIRLLGQGDVGKVYLVKEKSTSRLYALKIFNKSQM--IKRKKIKRVLA--- 899

Query: 69   LRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNR 128
                    ++LA++ H       H+ +S        ++L +EYC GG     + TR    
Sbjct: 900  ------EQEILASSNHPFIVTLYHSFQSED-----YLYLCIEYCMGGEFFRALQTRRSKC 948

Query: 129  LTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG-SV-SGVIR 186
            ++E       S+ T  +  +H +    ++RD+K EN+LL K G   + DF  S+ S V +
Sbjct: 949  ISEDAARFYASEVTAALEYLHLM--GYIYRDLKPENILLHKSGHIMLSDFDLSIQSKVAK 1006

Query: 187  PP----RNQQELLYVQ---HDIMKNT---TAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236
             P     NQ  L+  +        N+   T +Y  PE++   RG       D W LG+ +
Sbjct: 1007 NPVVKKFNQSSLVDTKICSEGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILI 1063

Query: 237  YKLCYYTTPFEKLGEPA------ILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
            Y++ +  TPF+  G+        IL     FP+  + +   K++IK +L ++ + R
Sbjct: 1064 YEMLFGFTPFK--GDSTNETFSNILKNEVSFPNNNDITRNCKDVIKKLLTKNENKR 1117

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 82/339 (24%), Positives = 136/339 (40%), Gaps = 79/339 (23%)

Query: 4   PELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSN-------VACLK 56
           P+  R  +   +T+G  +  I K +  G FA ++   +L   + +          +  + 
Sbjct: 19  PKKSRKGIERSITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPPLNFAIKIVS 78

Query: 57  RVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGG 116
           R K+ +K  L  L  E+  +K + N+ H+V  ID   T       T + +L+MEYC  G 
Sbjct: 79  RSKLKNKKLLENLEIEIAILKKI-NHPHIVKLIDCERT-------TTDFYLIMEYCALGD 130

Query: 117 LIDFMNTRLQ----------------------NRLTEPEILDIMSQTTQGIAVMHALVPP 154
           L   +  R +                      N L    IL+ + Q    +  + +    
Sbjct: 131 LTFLIKKRHELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRS--KN 188

Query: 155 LLHRDIKIENVLL---------SKG-------GIY-----KVCDFGSVSGVIRPPRNQQE 193
           L+HRDIK +N+LL         SK        GIY     K+ DFG    +  P  +  E
Sbjct: 189 LVHRDIKPQNLLLLTPLINYNDSKAFKKLGFIGIYELPILKIADFGFARFL--PNTSMAE 246

Query: 194 LLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPA 253
            L          +  Y  PE+L+  +    + KAD+W++G  LY++CY T PF+      
Sbjct: 247 TLC--------GSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLE 295

Query: 254 ILHA------RFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
           +         +  FP++    + +K LI  +L   P  R
Sbjct: 296 LYKKIKRSNNKINFPNYIQIQNDMKILISKLLTFDPQRR 334

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 84/184 (45%), Gaps = 21/184 (11%)

Query: 111  YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
            + E G +  F      + +TE EI  +  Q   G+  +H     ++HRDIK EN+++   
Sbjct: 1209 HGETGSIDLFDLIEFTSNMTEFEIKLLFKQVVSGVKHLHD--QGIVHRDIKDENIIVDNK 1266

Query: 171  GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKAD 228
            G  K+ DFGS + V   P +    ++V        T  Y  PE+L  + Y G P     D
Sbjct: 1267 GFIKIIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGNPYEGKP----QD 1311

Query: 229  IWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPN 288
            IWALG+ LY + +   PF  + E  IL    +F    N S     LIK +L  +   RP 
Sbjct: 1312 IWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLILNRNVFKRPT 1369

Query: 289  VCQV 292
            +  +
Sbjct: 1370 IDDI 1373

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 129/288 (44%), Gaps = 64/288 (22%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSN-VACLKRVKVPDKLSLNILRAEVDAMKLLAN 81
           KILK +  G F ++Y      + L   ++   CLK     DK   NI+R EV   +   +
Sbjct: 42  KILKQIGEGSFGKVY------LALHRPTHRKVCLK---TSDKNDPNIVR-EVFYHRQF-D 90

Query: 82  NKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQT 141
             ++    +   T S       +V++ +EYC G  L D  +     R++  E  ++ +Q 
Sbjct: 91  FPYITKLYEVIVTES-------KVWMALEYCPGKELYD--HLLSLRRISLLECGELFAQI 141

Query: 142 TQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDI 201
           +  +   H++    +HRD+K+EN+LL K G  K+ DFG                + +  +
Sbjct: 142 SGAVYYAHSM--HCVHRDLKLENILLDKNGNAKLTDFG----------------FTRECM 183

Query: 202 MKNT------TAQYRCPEMLD--LYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPA 253
            K T      T  Y  PE+++   Y G  I    DIW+LGV LY L     PF+   E  
Sbjct: 184 TKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDDDDE-- 237

Query: 254 ILHARFQFP---SFPNYS-----DRLKNLIKSMLREHPSDRPNVCQVL 293
              A+ ++      P Y      D  ++LI  +L ++P +RP++ QVL
Sbjct: 238 ---AKTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa]
           {ON} Anc_3.60 YNL298W
          Length = 934

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 128/270 (47%), Gaps = 45/270 (16%)

Query: 2   NQPELDRINVGTQLTVGTHS------VKILKYLTSGGFAQIYAVEILSMG----LFNGSN 51
           ++P++    + ++L+  T+S       K+++    G    +Y  E + +       N + 
Sbjct: 611 SRPQMSHAEIMSRLSKVTYSKDPTSFFKMIEKAGQGASGSVYLAERIRLPPDPISNNNAK 670

Query: 52  VACLKRVKVPDKLSLNIL------RAEVDAMKLL----ANNKHVVSYIDSHATRSPTNDG 101
                  ++ DK+++  +      R E+   ++L    + +K++V++++++     T D 
Sbjct: 671 YTTENSSQIGDKVAIKQMILSKQPRKELIVNEILVMQDSRHKNIVNFLEAYLK---TED- 726

Query: 102 TYEVFLLMEYCEGGGLIDFMNTRLQN-----RLTEPEILDIMSQTTQGIAVMHALVPPLL 156
             +++++MEY EGG L D +    +N      LTEP+I  I+ +T QG+  +H     ++
Sbjct: 727 --DLWVVMEYMEGGSLTDIIENSPENVTNKSPLTEPQIAYIVRETCQGLKFLHERH--II 782

Query: 157 HRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLD 216
           HRDIK +NVLL   G  K+ DFG  + +      +  ++          T  +  PE++ 
Sbjct: 783 HRDIKSDNVLLDNQGRVKITDFGFCAKLTDQRSKRATMV---------GTPYWMAPEVV- 832

Query: 217 LYRGLPIDEKADIWALGVFLYKLCYYTTPF 246
             +    DEK D+W+LG+   ++     P+
Sbjct: 833 --KQREYDEKVDVWSLGIMTIEMLEGEPPY 860

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 121/294 (41%), Gaps = 43/294 (14%)

Query: 9   INVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVK--VPDKLSL 66
              G QL  G++S  +L      G  + YAV++LS        +   K+VK    +KL+L
Sbjct: 125 FKFGEQLGDGSYSSVVLATARDSG--KKYAVKVLSK-----EYLIRQKKVKYVTVEKLAL 177

Query: 67  NILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQ 126
             L       KL    +   S                 ++ L+EY   G  +  +  +  
Sbjct: 178 QKLNGTKGIFKLFFTFQDEAS-----------------LYFLLEYAPHGDFLGLI--KKY 218

Query: 127 NRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIR 186
             L E       SQ    +  +H +   ++HRDIK EN+LL K    K+ DFG+   +  
Sbjct: 219 GSLNETCARYYASQIIDAVDSLHNI--GIIHRDIKPENILLDKNMKVKLTDFGTAKILPE 276

Query: 187 PPRNQQEL-----LYVQHDIMKNTTAQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLC 240
            P N  +      LY +       TA+Y  PE+L D Y     D + DIWA G  LY++ 
Sbjct: 277 EPSNTADGKPYFDLYAKSKSFVG-TAEYVSPELLNDNY----TDSRCDIWAFGCILYQML 331

Query: 241 YYTTPFEKLGEPAILHA--RFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292
               PF+   E        + Q+     +   +K+L+K +L   P+DR  + Q+
Sbjct: 332 AGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVKKLLVRDPNDRLTIKQI 385

>Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {ON}
           YJR059W (PTK2) - putative serine)/threonine kinase
           involved in spermine metabolism [contig 43] FULL
          Length = 735

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 108/244 (44%), Gaps = 47/244 (19%)

Query: 28  LTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV-----PDKLSLNILRAEVDAMKLLANN 82
           L SGG +++  V      L +   V  LK+ K+     P+       + E    K L++N
Sbjct: 283 LGSGGSSEVRTVR----SLIHKKEVYALKKFKLLRNEKPEHFYKRCSK-EFILAKRLSHN 337

Query: 83  KHVVS--YIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQ 140
            HV +  Y+   +T +    G      +MEYC  G L   ++     +    E  +   Q
Sbjct: 338 AHVANTFYLVKVSTSTFMTRG---WAFVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQ 394

Query: 141 TTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG----------SVSGVIR---- 186
             +GI  +H+    ++HRDIK ENVL+SK GI K+ DFG           ++  +R    
Sbjct: 395 VVEGIKFIHSQG--VVHRDIKPENVLISKEGIAKMTDFGISDWGNEDPDDLTSPVRLFDT 452

Query: 187 ----PPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYY 242
               PP +  E++  + +   ++T Q R P   D Y       K D WALGV L+ L Y 
Sbjct: 453 YVGSPPYSAPEVVAFKDE---DSTYQDRKP--YDAY-------KMDCWALGVLLFTLVYQ 500

Query: 243 TTPF 246
            TPF
Sbjct: 501 CTPF 504

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 127/282 (45%), Gaps = 38/282 (13%)

Query: 27   YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN----ILRAEVDAMKLLANN 82
            ++  G F  +Y+   L  G     ++  +K +K  D+ ++      +R E+  +++L N+
Sbjct: 1196 FIGGGSFGSVYSAVNLDTG-----DILAVKEIKFNDRKTIKQVFPSIRDEMTVLEML-NH 1249

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMS-QT 141
             +VV Y      R   N       + MEYCEGG L   +      R+ +  +  + S Q 
Sbjct: 1250 PNVVQYYGVEVHRDRVN-------IFMEYCEGGSLASLL---AHGRIEDEMVTQVYSLQM 1299

Query: 142  TQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDI 201
             +G+A +H     + HRDIK EN+LL   GI K  DFG+    +      ++L   QH  
Sbjct: 1300 LEGLAYLHE--SGVDHRDIKPENILLDFNGIIKYVDFGAAK--VLASNGSKKLNLEQH-- 1353

Query: 202  MKNT----TAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKL-GEPAILH 256
            M+      T  Y  PE +    G       DIW+LG  + ++     P+  L  + AI++
Sbjct: 1354 MEGEKMIGTPMYMSPEAIS-GTGYGKFGSDDIWSLGCVILEMVTGRRPWANLDNQWAIIY 1412

Query: 257  --ARFQFPSFPNYSDRLKNLIKSMLR---EHPSDRPNVCQVL 293
              A  Q P FP+ ++  +  IK + R   + P+ R    ++L
Sbjct: 1413 QVAAGQIPMFPSKNEMSQAGIKFLSRCLIQDPNQRSTAVELL 1454

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 127/298 (42%), Gaps = 51/298 (17%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAVE------ILSMGLFNGSNVACLKRVKVPDKLSLNI 68
           + VG  S + ++ L  G   +++ V       + ++ +F  +    +KR KV   L+   
Sbjct: 429 VKVGPQSFEKIRMLGQGDVGKVFLVREKETNRLYALKVF--TKREMIKRKKVQRILT--- 483

Query: 69  LRAEVDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQ 126
                   ++LA + H  VV+   S  T          V+L MEYC GG     + TR  
Sbjct: 484 ------EQEILATSNHPFVVTLYHSFQTED-------YVYLCMEYCMGGEFFRALQTRKA 530

Query: 127 NRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG---SVSG 183
             ++E +     S+ T  +  +H L    ++RD+K EN+LL K G   + DF      + 
Sbjct: 531 KSISEDDARFYASEVTAALEYLHLL--GFIYRDLKPENILLHKSGHIMLSDFDLSVQAND 588

Query: 184 VIRPPR---NQQELLYVQ---HDIMKNT---TAQYRCPEMLDLYRGLPIDEKADIWALGV 234
             +P +    Q  ++  +        N+   T +Y  PE++   RG       D W LG+
Sbjct: 589 AAKPVKRVATQSSMVDTKVFSEGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGI 645

Query: 235 FLYKLCYYTTPFEKLGEPA------ILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
            +Y++ +  TPF+  GE        IL     FP     S   K+LI+ +L ++ S R
Sbjct: 646 LIYEMLFGCTPFK--GENTNETFCNILKNEVTFPEHHEISRHCKDLIRKLLSKNESKR 701

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 128/282 (45%), Gaps = 42/282 (14%)

Query: 12  GTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLNILRA 71
           G  L  G +S  +L   TS    + YAV++L     N   +   K+VK      +NI   
Sbjct: 177 GEMLGDGAYSTVMLA--TSNDSGKKYAVKVL-----NKEYLIRQKKVKY-----VNI--- 221

Query: 72  EVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTE 131
           E  A++ L N++ ++    +    +        ++ L+EY   G L+  M  +    L E
Sbjct: 222 EKLALQRLNNSRSIIRLFFTFQDEA-------SLYFLLEYAPNGDLLSLM--KKFGSLNE 272

Query: 132 PEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVI-RPPRN 190
                  +Q    I  MH+    ++HRDIK EN+LL K    K+ DFG+   +  +PP  
Sbjct: 273 ECCCYYGAQIIDAIKFMHS--KGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGT 330

Query: 191 QQELLYVQHDIMKNTTAQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKL 249
             +LL      +   TA+Y  PE+L D Y     D ++DIWA G  ++++     PF+  
Sbjct: 331 SYDLLTRSKSFV--GTAEYVSPELLNDNY----TDARSDIWAFGCIVFQMIAGKPPFKAT 384

Query: 250 GE----PAILHARFQFPS-FPNYSDRLKNLIKSMLREHPSDR 286
            E      ++  ++ F + FP     +++L+K +L + P  R
Sbjct: 385 NEYLTFQKVMKVQYAFTAGFPTV---VRDLVKRILIKAPEQR 423

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 124/295 (42%), Gaps = 43/295 (14%)

Query: 12  GTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVK--VPDKLSLNIL 69
           G QL  G++S  +L      G  + YAV++LS        +   K+VK    +KL+L  L
Sbjct: 128 GEQLGDGSYSSVVLATARESG--KKYAVKVLSK-----EYLIRQKKVKYVTVEKLALQKL 180

Query: 70  RAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRL 129
                 ++L    +   S                 ++ L+EY   G  +  +  +    L
Sbjct: 181 NGTKGIIRLFFTFQDEAS-----------------LYFLLEYAPHGDFLGLI--KKYGSL 221

Query: 130 TEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPR 189
            E       SQ    +  +H++   ++HRDIK EN+LL K    K+ DFG+   +   P 
Sbjct: 222 NEICARYYASQIIDAVDSLHSI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPS 279

Query: 190 NQQEL-----LYVQHDIMKNTTAQYRCPEML-DLYRGLPIDEKADIWALGVFLYKLCYYT 243
           N  +      LY +       TA+Y  PE+L D Y     D + DIWA G  LY++    
Sbjct: 280 NAADGKPCFDLYAKSKSFVG-TAEYVSPELLNDSY----TDSRCDIWAFGCILYQMLAGK 334

Query: 244 TPFEKLGEPAILHA--RFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
            PF+   E        + Q+     +   +K+L+K +L   P+DR  + Q+   V
Sbjct: 335 PPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVKKLLVRDPNDRLAIEQIKAHV 389

>KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} similar
           to uniprot|P48562 Saccharomyces cerevisiae YNL298W CLA4
           Involved in localizing cell growth with respect to the
           septin ring protein kinase homologous to Ste20p
           interacts with CDC42
          Length = 879

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 95/181 (52%), Gaps = 27/181 (14%)

Query: 73  VDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMN-----TRL 125
           V+ + ++ ++KH  +V++++++     T D   +++++MEY EGG L D +      +  
Sbjct: 645 VNEILVMKDSKHNNIVNFLEAYLK---TED---DLWVVMEYMEGGSLTDIIENSPTGSSG 698

Query: 126 QNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVI 185
           Q+ LTEP+I  I+ +T QG+  +H     ++HRDIK +NVLL   G  K+ DFG  + + 
Sbjct: 699 QSPLTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLT 756

Query: 186 RPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTP 245
                +  ++          T  +  PE++   +    DEK D+W+LG+   ++     P
Sbjct: 757 DKRSKRATMV---------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEPP 804

Query: 246 F 246
           +
Sbjct: 805 Y 805

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 134/297 (45%), Gaps = 44/297 (14%)

Query: 11  VGTQLTVGTHS-VKILKYLTSGGFAQIYAVEILSMGLFNG---SNVACLKRVKVPDKLSL 66
           +G+ L  G+   V + ++ T+G   Q  AV+I+S  +F     +N + +     PD L  
Sbjct: 28  LGSILGAGSAGKVLMAQHETTG---QQAAVKIVSKSIFGAVAQNNSSTIVGSNDPDLLPY 84

Query: 67  NILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQ 126
            I R E+  MKLL N+ +V+   D   T+S        +++++EY E G L + +  R  
Sbjct: 85  GIER-EIIIMKLL-NHTNVLRLYDVWETKS-------NLYMVLEYVEKGELFNLLVER-- 133

Query: 127 NRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIR 186
             L E E +    Q   GI+  HAL   ++HRD+K EN+LL      K+ DFG  +    
Sbjct: 134 GPLPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMAA---- 187

Query: 187 PPRNQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDE-KADIWALGVFLYKLCYYT 243
                   L  +  +++ +     Y  PE++    GLP    ++D+W+ GV LY L    
Sbjct: 188 --------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGR 236

Query: 244 TPFEKLGEP------AILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
            PF++           +    ++ P     S   ++LI  +L   P  R    ++L+
Sbjct: 237 LPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

>NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6.371
          Length = 886

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 124/296 (41%), Gaps = 47/296 (15%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAVE------ILSMGLFNGSNVACLKRVKVPDKLSLNI 68
           +TV   S + +K L  G   ++Y V+      + ++ +F  S    +KR K+   L+   
Sbjct: 470 ITVSPQSFEKIKLLGRGDVGKVYLVKEKNTNRLYALKIF--SKAEMIKRKKIKRVLA--- 524

Query: 69  LRAEVDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQ 126
                   ++LA + H  +V+   S  T          V+  MEYC GG     + TR  
Sbjct: 525 ------EQEILATSNHPFIVTLYHSFQTED-------YVYFCMEYCMGGEFFRALQTRKT 571

Query: 127 NRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG----SVS 182
             + E +     S+ T  +  +H L    ++RD+K EN+LL K G   + DF     +  
Sbjct: 572 KCICEEDAKFYASEVTAALEYLHLL--GFIYRDLKPENILLHKSGHIMLSDFDLSVQAKD 629

Query: 183 GVIRPPRNQQELLYVQHDIMKN--------TTAQYRCPEMLDLYRGLPIDEKADIWALGV 234
             I   +   E   +   I+ +         T +Y  PE++   RG       D W LG+
Sbjct: 630 AKIPVMKGMDESTIIDTKIVSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGI 686

Query: 235 FLYKLCYYTTPFEKLGE----PAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
            +Y++ +  TPF+          IL     FP+  + S   K+LIK +L ++ + R
Sbjct: 687 LIYEMLFGMTPFKGSNSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKNENKR 742

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 115/245 (46%), Gaps = 61/245 (24%)

Query: 73  VDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLT 130
           ++ + ++ ++KH  +V++IDS   +        +++++ME+ EGG L D +   +   LT
Sbjct: 594 INEIIVMKDSKHPNIVNFIDSFLLKG-------DLWVIMEFMEGGSLTDVVTHCI---LT 643

Query: 131 EPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRN 190
           E +I  +  +T +G+  +H+    ++HRDIK +N+LLS  G  K+ DFG  + +      
Sbjct: 644 EGQIGTVCRETLRGLQFLHSNG--VIHRDIKSDNILLSMKGDIKLTDFGFCAQI------ 695

Query: 191 QQELLYVQHDIMKNT---TAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPF- 246
                  +H++ + T   T  +  PE++      P   K DIW+LG+ + ++     P+ 
Sbjct: 696 ------NEHNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYL 746

Query: 247 ----------------EKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVC 290
                            KL EP +L            SD L + +   L+ +P +R +  
Sbjct: 747 NETPLRALYLIATNGTPKLKEPELL------------SDVLNDFLSWCLKVNPDERASAS 794

Query: 291 QVLEE 295
            +LE+
Sbjct: 795 TLLED 799

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 132/295 (44%), Gaps = 39/295 (13%)

Query: 27   YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN----ILRAEVDAMKLLANN 82
            ++ SG F  +Y+   L  G     ++  +K +K+ D  S+      L+ E+  M++L N+
Sbjct: 1264 FIGSGSFGTVYSAVNLDTG-----DILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NH 1317

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMS-QT 141
             ++V Y      R   N       + ME+CEG  L   +      R+ +  +  + + Q 
Sbjct: 1318 PNIVQYYGVEVHRDKVN-------IFMEFCEGSSLASLLE---HGRIEDEMVTQVYTLQL 1367

Query: 142  TQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSV-----SGVIRPPRNQQELLY 196
             +G+A +H     ++HRDIK EN+LL + G+ K  DFG+      +G  R   +      
Sbjct: 1368 LEGLACLHQ--SGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKST 1425

Query: 197  VQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKL-GEPAIL 255
               D++   T  Y  PE +   +G       DIW+LG  + ++     P+  L  E AI+
Sbjct: 1426 GGKDMIG--TPMYMAPETVT-GQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIM 1482

Query: 256  H--ARFQFPSFPNYSD---RLKNLIKSMLREHPSDRPNVCQVLEE--VSRMQNVP 303
            +  A    P FP  S+     +  I   L +  + R    ++L +  +S+++N+ 
Sbjct: 1483 YHVAAGHLPQFPTKSEISSAGRKFISRCLIQDANKRATAMELLLDPWISQIRNIA 1537

>Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {ON}
            YNR031C (REAL)
          Length = 1376

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 136/294 (46%), Gaps = 49/294 (16%)

Query: 27   YLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN----ILRAEVDAMKLLANN 82
            ++  G F Q+Y+    ++ L NG  +A +K + + D  ++     +++ E++ +++L N+
Sbjct: 1079 FIGGGTFGQVYS----AVNLENGEILA-VKEINLHDTKTMKKIFPLIKEEMNVLEML-NH 1132

Query: 83   KHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFM-NTRLQNRL-TEPEILDIMSQ 140
             +VV Y      R   N       + MEYCEGG L   + + R+++ + T+   L+++  
Sbjct: 1133 PNVVQYYGVEVHRDKVN-------IFMEYCEGGSLAALLEHGRIEDEMVTQVYTLELL-- 1183

Query: 141  TTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRP------------- 187
              +G+  +H     ++HRDIK EN+LL   GI K  DFG+    +               
Sbjct: 1184 --EGLTYLHQ--SGVVHRDIKPENILLDFNGIIKYVDFGTARTFVETSTRAMRNATINDL 1239

Query: 188  --PRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTP 245
              P ++ E  Y+  D M   T  Y  PE +            D+WALG  + ++     P
Sbjct: 1240 DLPESEPETNYM--DGMMG-TPMYMAPETISGSAAKGKLGADDVWALGCVVLEMVTGRRP 1296

Query: 246  FEKL-GEPAILH--ARFQFPSFPN---YSDRLKNLIKSMLREHPSDRPNVCQVL 293
            +  L  E AI++  A    P FPN    + + +  ++  L + P+ R +  ++L
Sbjct: 1297 WSNLDNEWAIMYHVAAGHIPQFPNKDEVTSKGRAFLERCLVQDPASRASAVELL 1350

>KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1468

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/303 (26%), Positives = 130/303 (42%), Gaps = 58/303 (19%)

Query: 26   KYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKVPDKLSLN----ILRAEVDAMKLLAN 81
            KY+  G F  +++    ++ L NG  +  +K +K+ D  S+     +++ E++ +++L N
Sbjct: 1161 KYIGGGTFGAVFS----AVNLDNGE-ILAVKEIKIQDNKSMEKFFPLIKDEMNVLEML-N 1214

Query: 82   NKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMS-- 139
            + +VV Y      R   N       + MEYCEGG L     T L++   E E++  M   
Sbjct: 1215 HPNVVQYYGVEVHRDRVN-------IFMEYCEGGSLA----TLLEHGRIEDELVTQMYTL 1263

Query: 140  QTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIR------------- 186
            Q  +G+A +H     ++HRDIK EN+LL   GI K  DFG+    ++             
Sbjct: 1264 QLLEGLAYLHE--SGIIHRDIKPENILLDYNGIIKYVDFGASKRAVKNSTRWAASIGKGS 1321

Query: 187  --------PPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYK 238
                       N  +L     D++   T  Y  PE +           +DIW+LG    +
Sbjct: 1322 ISSHSSSEGDSNSGKL----QDLI--GTPMYMAPEAITGSTTEGRFGSSDIWSLGCVTLE 1375

Query: 239  LCYYTTPFEKL-GEPAILH--ARFQFPSFPN---YSDRLKNLIKSMLREHPSDRPNVCQV 292
            +     P+  L  E AIL+     Q P FPN    S   +  +K  L    S R    ++
Sbjct: 1376 MITGKRPWYNLDNEWAILYHVVAGQSPRFPNKNKVSSAGRKFLKRCLVHSASKRATAFEL 1435

Query: 293  LEE 295
            L E
Sbjct: 1436 LME 1438

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 102/202 (50%), Gaps = 35/202 (17%)

Query: 104 EVFLLMEYCEGGGLIDFMNTRLQ-NRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKI 162
           +V++ +EYC G  L D +   LQ  R+   E + + SQ    +   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSL--NCVHRDLKL 165

Query: 163 ENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDL--YRG 220
           EN+LL K G  K+ DFG           ++ +  V  + +  TT  Y  PE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFGFT---------RECMEKVNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 LPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSF---PNYSDRL-----K 272
             I    DIW+LGV LY +   + PF++  E     A+ ++      P Y+ +      +
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDE-----AKTKWKIINEEPEYNSKFMTAEGE 266

Query: 273 NLIKSMLREHPSDRPNVCQVLE 294
           +L++ +L++  + RP+V ++L+
Sbjct: 267 DLVRKLLQKDSNLRPSVREILQ 288

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 127/273 (46%), Gaps = 44/273 (16%)

Query: 30   SGGFAQIYAVEILSMGLFNGSNVA-CLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSY 88
            SGG    Y V         G+N +  +K++ +  +    ++  E+  MK  + +K++V++
Sbjct: 1038 SGGVYTAYEV---------GTNASVAVKQMNLEKQPKTELIINEIIVMKE-SKHKNIVNF 1087

Query: 89   IDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVM 148
            IDS+  +        +++++MEY EGG L D +   +   LTE +I  +  +T  G+  +
Sbjct: 1088 IDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLNGLKFL 1137

Query: 149  HALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQ 208
            H+    ++HRDIK +N+LLS  G  K+ DFG  +        Q   ++++   M   T  
Sbjct: 1138 HS--KGVIHRDIKSDNILLSMQGDIKLTDFGFCA--------QINEVHLKRTTMVG-TPY 1186

Query: 209  YRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI----LHARFQFPSF 264
            +  PE++      P   K DIW+LG+ + ++     P+  L E  +    L A    P  
Sbjct: 1187 WMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY--LNETPLRALYLIATNGTPEL 1241

Query: 265  ---PNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
                  S  L N + + L+  P  R    ++LE
Sbjct: 1242 KEPEKLSSILHNFLDACLKVDPEVRATATELLE 1274

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 85/187 (45%), Gaps = 21/187 (11%)

Query: 111  YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170
            + E G +  F    L+  +TE E   I  Q   GI  +H     ++HRDIK EN+++   
Sbjct: 1102 HGETGSIDLFDLIELKTNMTEHEAKLIFKQVASGIKHLHD--NGIVHRDIKDENIIVDNK 1159

Query: 171  GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLYRGLPIDEKAD 228
            G  K+ DFGS + V   P +    ++V        T  Y  PE+L  D Y G P     D
Sbjct: 1160 GFVKLIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLGGDPYEGKP----QD 1204

Query: 229  IWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPN 288
            IWA+GV LY + +   PF  + E  IL    +  S    S+    LI+ +L      RP 
Sbjct: 1205 IWAIGVLLYTIIFKENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPT 1262

Query: 289  VCQVLEE 295
            + ++  +
Sbjct: 1263 IEEIYND 1269

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 127/274 (46%), Gaps = 44/274 (16%)

Query: 30  SGGFAQIYAVEILSMGLFNGSNVA-CLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSY 88
           SGG    Y +         G+NV+  +K++ +  +    ++  E+  MK  + + ++V++
Sbjct: 633 SGGVYTAYEI---------GTNVSVAIKQMNLEKQPKKELIINEILVMKG-SRHPNIVNF 682

Query: 89  IDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVM 148
           IDS+  +        +++++MEY EGG L D +   +   LTE +I  +  +T  G+  +
Sbjct: 683 IDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLKFL 732

Query: 149 HALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQ 208
           H+    +LHRDIK +N+LLS  G  K+ DFG  +        Q   L ++   M   T  
Sbjct: 733 HSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCA--------QINELNLKRTTMVG-TPY 781

Query: 209 YRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAI----LHARFQFPSF 264
           +  PE++      P   K DIW+LG+ + ++     P+  L E  +    L A    P  
Sbjct: 782 WMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY--LNETPLRALYLIATNGTPKL 836

Query: 265 ---PNYSDRLKNLIKSMLREHPSDRPNVCQVLEE 295
               N S  LK  +   L   P +R +  ++L +
Sbjct: 837 KEPENLSSSLKKFLDWCLCVEPEERASATELLHD 870

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 118/282 (41%), Gaps = 57/282 (20%)

Query: 59  KVPDKLSLNILRAEVDAMKLLANNKHVVSYI---DSHATRSPTNDGTYEVFLLMEYCEGG 115
           K P K   + ++ E+  MK   ++KHVV  I   D   +R        +++L++EYC  G
Sbjct: 186 KKPGKTENDKIKREIAIMKK-CHHKHVVKLIEVLDDLKSR--------KIYLVLEYCSRG 236

Query: 116 GLIDFMNTRLQNRLTEPEIL------DIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSK 169
            +       L+     P  L      +I+     G+  +H     ++HRDIK  N+LLS+
Sbjct: 237 EVKWCPPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLH--YQGIIHRDIKPANLLLSE 294

Query: 170 GGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNT-TAQYRCPEML------------- 215
            GI K+ DFG          +  +    + ++ K   T  +  PE+              
Sbjct: 295 TGIVKISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDR 354

Query: 216 -DLYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFP-SFPNYSDRLKN 273
            +L++G  I  K DIWALGV LY L +   PF    E  +       P  FP YSD LKN
Sbjct: 355 EELFKGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKN 414

Query: 274 -----------------LIKSMLREHPSDRPNVCQVLEEVSR 298
                            L+  +L ++P  R N+    EE+ R
Sbjct: 415 NQVLQMTEEAEYEAAKDLLTRLLEKNPIKRINI----EEIKR 452

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 126/295 (42%), Gaps = 41/295 (13%)

Query: 11  VGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFN--GSNVACLKRVKVPDKLSLNI 68
           +G  L +G+     L Y  S    Q  A++++S  +FN  GS          PD L   I
Sbjct: 22  LGETLGLGSTGKVQLAYDESTN--QQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGI 79

Query: 69  LRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNR 128
            R E+  MKLL N+ +V+   D   T S        +++++EY + G L + +  R    
Sbjct: 80  ER-EIIIMKLL-NHPNVLRLYDVWETNS-------NLYMVLEYAQKGELFNLLVER--GP 128

Query: 129 LTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPP 188
           L E E +    Q   GI+  HAL   ++HRD+K EN+LL      K+ DFG  +      
Sbjct: 129 LPEKEAIRFFRQIVIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMAA------ 180

Query: 189 RNQQELLYVQHDIMKNTTA--QYRCPEMLDLYRGLPIDEKA-DIWALGVFLYKLCYYTTP 245
                 L  +  +++ +     Y  PE++    G+P    A D+W+ GV L+ L     P
Sbjct: 181 ------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILFALLTGRLP 231

Query: 246 FEKLGEP------AILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
           F+            +   R++ P     S   ++LI  +L   P  R     +L+
Sbjct: 232 FDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILK 286

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 130/286 (45%), Gaps = 60/286 (20%)

Query: 23  KILKYLTSGGFAQIYAVEILSMGLFNGSN-VACLKRVKVPDKLSLNILRAEVDAMKLLAN 81
           KILK +  G F ++Y      + L   ++   CLK     DK   NI+R EV   +   +
Sbjct: 42  KILKQIGEGSFGKVY------LALHRPTHRKVCLK---TSDKNDPNIVR-EVFYHRQF-D 90

Query: 82  NKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQT 141
             ++    +   T S       +V++ +EYC G  L D  +     RL+  E  ++ +Q 
Sbjct: 91  FPYITKLYEVIVTES-------KVWMALEYCPGKELYD--HLLSLRRLSLLECGELFAQI 141

Query: 142 TQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDI 201
           +  +   H++    +HRD+K+EN+LL + G  K+ DFG                + +  +
Sbjct: 142 SGAVYYAHSM--HCVHRDLKLENILLDRNGNAKLTDFG----------------FTRECM 183

Query: 202 MKNT------TAQYRCPEMLD--LYRGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPA 253
            K T      T  Y  PE+++   Y G  I    DIW+LGV LY L     PF+   E  
Sbjct: 184 TKTTLETVCGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDDDDE-- 237

Query: 254 ILHARFQFPS-FPNYS-----DRLKNLIKSMLREHPSDRPNVCQVL 293
            +  +++  +  P Y      D  K+LI  +L ++P +RP++ QVL
Sbjct: 238 -VKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W
           (REAL)
          Length = 719

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 125/293 (42%), Gaps = 44/293 (15%)

Query: 15  LTVGTHSVKILKYLTSGGFAQIYAV------EILSMGLFNGSNVACLKRVKVPDKLSLNI 68
           +TV   S + ++ L  G   ++Y V      +I ++ + +   +  +KR K+   L+   
Sbjct: 316 ITVEPRSFEKIRLLGQGDVGKVYLVRERDTNQIFALKVLSKHEM--IKRKKIKRVLT--- 370

Query: 69  LRAEVDAMKLLANNKH--VVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQ 126
                   ++LA + H  +V+   S  T          ++L MEYC GG     + TR  
Sbjct: 371 ------EQEILATSDHPFIVTLYHSFQTED-------YLYLCMEYCMGGEFFRALQTRKS 417

Query: 127 NRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG-SVSGVI 185
             + E +     S+    +  +H L    ++RD+K EN+LL + G   + DF  S+  + 
Sbjct: 418 KCIAEEDAKFYASEVVAALEYLHLL--GFIYRDLKPENILLHQSGHVMLSDFDLSIQAIG 475

Query: 186 RPPRNQQELLYVQHDIMKN--------TTAQYRCPEMLDLYRGLPIDEKADIWALGVFLY 237
                 ++  Y+   I  +         T +Y  PE++   RG       D W LG+ +Y
Sbjct: 476 SKNPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGILVY 532

Query: 238 KLCYYTTPFEKLGE----PAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDR 286
           ++ +  TPF+ +        IL    +FP     S   K+LIK +L ++ + R
Sbjct: 533 EMLFGCTPFKGVNSNETFSNILAKDAKFPHGKEVSKNCKDLIKKLLNKNETKR 585

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 86/193 (44%), Gaps = 34/193 (17%)

Query: 105 VFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIEN 164
           ++++MEYC GG L   +   +   + E  I  IM +    +  +H     ++HRDIK  N
Sbjct: 116 LWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIHK--DNVIHRDIKAAN 170

Query: 165 VLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPID 224
           VL++  G  K+CDFG  + + +    +Q +           T  +  PE+  +  G+  D
Sbjct: 171 VLITNEGKVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEV--IMEGVYYD 219

Query: 225 EKADIWALGVFLYKLCYYTTPFEKL-----------GEPAILHARFQFPSFPNYSDRLKN 273
            K DIW+LG+  Y++     P+ ++            +PA L  R        YS  LK 
Sbjct: 220 TKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGR-------QYSSGLKE 272

Query: 274 LIKSMLREHPSDR 286
            I   L E P +R
Sbjct: 273 FIALCLDEDPKER 285

>KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P47116 Saccharomyces
           cerevisiae YJR059W PTK2 Putative serine/threonine
           protein kinase involved in regulation of ion transport
           across plasma membrane enhances spermine uptake
          Length = 775

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 104/244 (42%), Gaps = 47/244 (19%)

Query: 28  LTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV-----PDKLSLNILRAEVDAMKLLANN 82
           L SGG +++  V      LF+  ++  LK+ K+     P+       + E    K L+ N
Sbjct: 285 LGSGGSSEVRTVR----SLFHKKDLYALKKFKLLRNEEPEHFYKRCSK-EFILAKRLSKN 339

Query: 83  KHVVS--YIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQ 140
            H+ +  Y+      S T   T     +MEYC GG L   ++     +    E  D   Q
Sbjct: 340 PHIANTFYL---VKVSTTTFMTRGWAFVMEYCSGGDLYSLISRPTWKKRPLKEKFDYWRQ 396

Query: 141 TTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFG-SVSG---------------- 183
             +GI  +H+    ++HRD+K ENVL+ K G  K+ DFG S  G                
Sbjct: 397 VVEGIKFVHSQG--IVHRDLKPENVLIDKEGTAKITDFGISDWGHEDPDDLNSPVSLFEN 454

Query: 184 -VIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYY 242
            V  PP +  E++    D   N T Q + P   D +       K D WALG+ L+ L Y 
Sbjct: 455 YVGSPPYSPPEVMAFNDD---NATKQDKKP--YDAH-------KMDCWALGMLLFVLVYQ 502

Query: 243 TTPF 246
            +PF
Sbjct: 503 CSPF 506

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 123/272 (45%), Gaps = 41/272 (15%)

Query: 35  QIYAVEILSMGLFN---GSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDS 91
           Q  A++I+S  +FN    SN   +     PD L   I R E+  MKLL  + +V+S  D 
Sbjct: 46  QQAAIKIISKSIFNTKPNSNETSMV-ANTPDSLPYGIER-EIIIMKLL-RHANVLSLYDV 102

Query: 92  HATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHAL 151
             T S        +++++EY E G L + +  +    L E E +    Q   GI+  HAL
Sbjct: 103 WETNS-------NLYMILEYAEKGELFNLLVEK--GPLPEKEAVRFFRQIIIGISYCHAL 153

Query: 152 VPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTA--QY 209
              ++HRD+K EN+LL      K+ DFG  +            L  +  +++ +     Y
Sbjct: 154 --GIVHRDLKPENLLLDHKFNIKIADFGMAA------------LETEDKLLETSCGSPHY 199

Query: 210 RCPEMLDLYRGLPIDE-KADIWALGVFLYKLCYYTTPF-EKLGEP-----AILHARFQFP 262
             PE++    G+P    ++D+W+ GV L+ L     PF E+ G        +   +F+ P
Sbjct: 200 AAPEIVS---GIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256

Query: 263 SFPNYSDRLKNLIKSMLREHPSDRPNVCQVLE 294
                S   ++LI  +L   P+ R    ++L+
Sbjct: 257 DDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 116/247 (46%), Gaps = 28/247 (11%)

Query: 52  VACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEY 111
           V  +K V   +   LN + AE+  +K L N+ ++V Y   H     +    YE+++L+EY
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNL-NHNNIVKY---HGFIRKS----YELYILLEY 101

Query: 112 CEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGG 171
           C  G L   + +R    L+E E    ++QT  G+  +H     ++HRDIK  N+LLS   
Sbjct: 102 CANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 172 IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWA 231
             K+ DFG VS ++    N   L           T  +  PE+L   RG      +DIW+
Sbjct: 159 TVKLADFG-VSTIV----NSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWS 203

Query: 232 LGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFP--NYSDRLKNLIKSMLREHPSDRPNV 289
           LG  + ++     P+  L +  I +A      +P  ++S+ LK+ +     ++   RP  
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTA 263

Query: 290 CQVLEEV 296
            Q+L+ V
Sbjct: 264 DQLLKHV 270

>Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar to
           Ashbya gossypii AEL205W
          Length = 818

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 89/172 (51%), Gaps = 25/172 (14%)

Query: 80  ANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNR-----LTEPEI 134
           + +K++V++++++     T D   +++++MEY EGG L D +   + N      +TEP+I
Sbjct: 591 SQHKNIVNFLEAYLK---TED---DLWVVMEYMEGGSLTDVIENSMGNETSESPMTEPQI 644

Query: 135 LDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQEL 194
             I+ +T QG+  +H     ++HRDIK +NVLL   G  K+ DFG  + +      +  +
Sbjct: 645 AYIVRETCQGLKFLHD--KNIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATM 702

Query: 195 LYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPF 246
           +          T  +  PE++   +    DEK D+W+LG+   ++     P+
Sbjct: 703 V---------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLEGEPPY 742

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 129/285 (45%), Gaps = 64/285 (22%)

Query: 30  SGGFAQIYAVEILSMGLFNGSNVA-CLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSY 88
           SGG    Y V         G+N +  +K++ +  +    ++  E+  MK  + ++++V++
Sbjct: 634 SGGVYTAYEV---------GTNASVAIKQMNLEKQPKKELIINEILVMKG-SKHQNIVNF 683

Query: 89  IDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVM 148
           IDS+  +        +++++MEY EGG L D +   +   LTE +I  +  +T +G+  +
Sbjct: 684 IDSYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGLQFL 733

Query: 149 HALVPPLLHRDIKIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQ 208
           H+    ++HRDIK +N+LLS  G  K+ DFG  +        Q   + ++   M   T  
Sbjct: 734 HS--KGVIHRDIKSDNILLSMNGEIKLTDFGFCA--------QINEINLKRTTMVG-TPY 782

Query: 209 YRCPEMLDLYRGLPIDEKADIWALGVFLYKLCYYTTPF-----------------EKLGE 251
           +  PE++      P   K DIW+LG+ + ++     P+                  KL E
Sbjct: 783 WMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKE 839

Query: 252 PAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296
           P +L            S  LK+ +   L  +P  R +  ++L +V
Sbjct: 840 PEVL------------SPELKSFLAWCLNVNPDTRASATELLRDV 872

>NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86
          Length = 1082

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 89/194 (45%), Gaps = 24/194 (12%)

Query: 104  EVFLLME---YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDI 160
            E +  ME   + E G +  F    L+  +TE E   I  Q   G+  +H     ++HRDI
Sbjct: 900  EEYYYMETPAHGETGSIDLFDLIELKKNMTEYEEKLIFKQVVSGLKHLHD--QGIVHRDI 957

Query: 161  KIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEML--DLY 218
            K ENV++   G  K+ D+GS +     P +    ++V        T  Y  PE+L   +Y
Sbjct: 958  KDENVIVDSKGHVKLIDYGSAAYTKSGPFD----VFVG-------TIDYAAPEVLGGSVY 1006

Query: 219  RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSM 278
             G P     DIWA+G+ LY + +   PF  + E  I+    +F    N S+    LIK +
Sbjct: 1007 DGKP----QDIWAIGILLYTIIFKENPFYNIDE--IMDGELRFNDAGNTSEACIKLIKKI 1060

Query: 279  LREHPSDRPNVCQV 292
            L     DRP V ++
Sbjct: 1061 LNRSIVDRPCVDEI 1074

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,749,186
Number of extensions: 3434493
Number of successful extensions: 15518
Number of sequences better than 10.0: 1824
Number of HSP's gapped: 14288
Number of HSP's successfully gapped: 1888
Length of query: 688
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 571
Effective length of database: 40,065,477
Effective search space: 22877387367
Effective search space used: 22877387367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)