Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0G02585g2.287ON37237219690.0
YIL094C (LYS12)2.287ON37137216560.0
Smik_9.852.287ON37137216500.0
Suva_9.1052.287ON37137216450.0
Skud_9.792.287ON37137216410.0
TDEL0G021802.287ON36937216360.0
KNAG0A054202.287ON37237216270.0
NCAS0B062502.287ON37337416160.0
ZYRO0A01914g2.287ON36837216130.0
NDAI0B035502.287ON37237315920.0
SAKL0E07656g2.287ON36837215830.0
KLLA0E08339g2.287ON36937215810.0
Kpol_1003.392.287ON37037215640.0
KLTH0G10384g2.287ON36737215420.0
Kwal_27.115282.287ON36737215230.0
Ecym_33262.287ON36636615180.0
TBLA0B059402.287ON36936615110.0
KAFR0J013602.287ON37337315040.0
TPHA0C034102.287ON37137514830.0
ADL214C2.287ON36737213730.0
NDAI0C014105.473ON3693544873e-57
ADL223W2.278ON3623814822e-56
KLLA0E03125g5.473ON3683534803e-56
CAGL0I07227g5.473ON3683604788e-56
NCAS0H022505.473ON4223534792e-55
Ecym_23135.473ON3703534673e-54
AFR137C5.473ON3673854664e-54
KLLA0F04103g2.278ON3613504664e-54
Suva_8.1885.473ON3693904665e-54
TPHA0D015602.278ON3603534655e-54
KNAG0B040705.473ON3733524631e-53
Smik_15.3165.473ON3693534622e-53
SAKL0G03520g5.473ON3693594622e-53
Ecym_33162.278ON3623804612e-53
Smik_14.2902.278ON3603764594e-53
Kwal_23.50122.278ON3613534561e-52
TDEL0A033705.473ON3713984562e-52
YNL037C (IDH1)2.278ON3603794533e-52
TBLA0B022405.473ON3733944543e-52
KAFR0B063705.473ON3783594526e-52
Skud_14.2932.278ON3613764508e-52
YOR136W (IDH2)5.473ON3693594518e-52
KLTH0F15048g5.473ON3683534508e-52
Skud_15.3005.473ON3693594508e-52
SAKL0E07876g2.278ON3613534481e-51
Kwal_55.212735.473ON3683594482e-51
Kpol_543.85.473ON3683584472e-51
Kpol_440.125.473ON3683534464e-51
KLTH0G10186g2.278ON3603554455e-51
Kpol_1039.352.278ON3593524402e-50
TPHA0J027705.473ON3763704386e-50
ZYRO0D11220g5.473ON3683894361e-49
NCAS0B062902.278ON3593544315e-49
TDEL0C038402.278ON3613834316e-49
NDAI0B035902.278ON3593814306e-49
CAGL0G02673g2.278ON3583504307e-49
TBLA0B069102.278ON3653764221e-47
TPHA0E014805.473ON3773534142e-46
KAFR0J014102.278ON3503514114e-46
ZYRO0D02838g2.278ON3613794097e-46
KNAG0A052802.278ON3613504081e-45
Suva_14.3022.278ON3002963612e-39
TBLA0C015001.402ON3653763653e-39
Ecym_12961.402ON3633643626e-39
AAL012C1.402ON3723643566e-38
Smik_3.661.402ON3643683503e-37
KLLA0D04906g1.402ON3623653495e-37
KLTH0H12188g1.402ON3643643471e-36
KNAG0I012801.402ON4473803492e-36
TDEL0B060001.402ON3623653433e-36
Skud_3.431.402ON3643683433e-36
YCL018W (LEU2)1.402ON3643683424e-36
NDAI0G042301.402ON3633683382e-35
Kwal_0.2251.402ON3643623373e-35
KAFR0I022001.402ON3653623354e-35
CAGL0H03795g1.402ON3653663346e-35
Suva_3.31.402ON3643723293e-34
Kpol_1048.631.402ON3643653206e-33
ZYRO0E04796g1.402ON3623693181e-32
NCAS0C048701.402ON3653693111e-31
SAKL0D08690g1.402ON3643723102e-31
TPHA0B037301.402ON3653722925e-29
KLTH0H12012g1.396ON4132711504e-10
Kwal_23.42104.254ON4222701504e-10
KLLA0B03355g4.254ON4292701443e-09
CAGL0D00770g4.254ON4232001434e-09
TPHA0B022104.254ON4331731418e-09
KAFR0H031601.396ON4212131372e-08
TDEL0E011604.254ON4232111354e-08
Skud_4.1894.254ON4291061346e-08
AAL022W1.396ON4151921336e-08
Ecym_13061.396ON4152801337e-08
ZYRO0E05016g1.396ON4111271329e-08
Kpol_1055.784.254ON4271981311e-07
YDL066W (IDP1)4.254ON4281061311e-07
SAKL0H02860g4.254ON4212981302e-07
SAKL0D08426g1.396ON4112181302e-07
NCAS0A087201.396ON4132041292e-07
CAGL0H03663g1.396ON4181261292e-07
Smik_12.2351.396ON4122181283e-07
Kpol_1048.701.396ON4191061283e-07
NDAI0D043604.254ON4241071283e-07
Kwal_0.1911.396ON4112101283e-07
KNAG0I013201.396ON4121061273e-07
KAFR0I021301.396ON4081061273e-07
TBLA0C012901.396ON4181261273e-07
KNAG0D044104.254ON4281721274e-07
NCAS0G036201.396ON4181061274e-07
NDAI0G008501.396ON4192051274e-07
Suva_4.1844.254ON4291061265e-07
NCAS0A025104.254ON4262361265e-07
Smik_4.1694.254ON4281061265e-07
KNAG0H016701.396ON4241261256e-07
YLR174W (IDP2)1.396ON4122181256e-07
AER061C4.254ON4251991257e-07
TDEL0B061001.396ON4141271257e-07
KLTH0D14476g4.254ON4201821248e-07
YNL009W (IDP3)1.396ON4201521249e-07
CAGL0B04917g1.396ON4112281212e-06
KLLA0F12342g1.396ON4151731203e-06
KAFR0G032604.254ON4211731203e-06
ZYRO0B12496g4.254ON4221731203e-06
Skud_12.2391.396ON4121261193e-06
Skud_14.3181.396ON4201261193e-06
Suva_10.2711.396ON4121261185e-06
TBLA0A080104.254ON4281301177e-06
Smik_14.3191.396ON4181261168e-06
TPHA0B036601.396ON4221261169e-06
Suva_14.3391.396ON4171261123e-05
Ecym_32654.254ON4241071114e-05
NDAI0G051601.396ON4201261042e-04
Suva_14.303singletonON5350914e-04
KNAG0A037508.531ON83096770.62
KAFR0A053703.455ON120183751.1
ZYRO0G06798g8.188ON87742687.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G02585g
         (372 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   763   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   642   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   640   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   638   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   636   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   634   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              631   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   627   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   625   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   617   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   614   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   613   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   607   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   598   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   591   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   589   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   586   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   583   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   575   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   533   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   192   3e-57
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   190   2e-56
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   189   3e-56
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   188   8e-56
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    189   2e-55
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   184   3e-54
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   184   4e-54
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   184   4e-54
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   184   5e-54
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   183   5e-54
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   182   1e-53
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   182   2e-53
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   182   2e-53
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   182   2e-53
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   181   4e-53
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   180   1e-52
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   180   2e-52
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   179   3e-52
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   179   3e-52
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   178   6e-52
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   177   8e-52
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   178   8e-52
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   177   8e-52
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   177   8e-52
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   177   1e-51
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   177   2e-51
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   176   2e-51
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   176   4e-51
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   176   5e-51
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   174   2e-50
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   173   6e-50
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   172   1e-49
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   170   5e-49
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   170   6e-49
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   170   6e-49
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   170   7e-49
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            167   1e-47
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   164   2e-46
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   162   4e-46
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   162   7e-46
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              161   1e-45
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   143   2e-39
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   145   3e-39
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   144   6e-39
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   141   6e-38
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   139   3e-37
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   139   5e-37
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   138   1e-36
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   139   2e-36
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   136   3e-36
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   136   3e-36
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   136   4e-36
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   134   2e-35
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   134   3e-35
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   133   4e-35
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             133   6e-35
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      131   3e-34
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   127   6e-33
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   127   1e-32
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   124   1e-31
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   124   2e-31
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   117   5e-29
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    62   4e-10
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    62   4e-10
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    60   3e-09
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    60   4e-09
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    59   8e-09
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    57   2e-08
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    57   4e-08
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    56   6e-08
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    56   6e-08
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    56   7e-08
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    55   9e-08
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    55   1e-07
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    55   1e-07
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    55   2e-07
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    55   2e-07
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    54   2e-07
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    54   2e-07
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    54   3e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    54   3e-07
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    54   3e-07
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    54   3e-07
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    54   3e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    54   3e-07
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    54   3e-07
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    54   4e-07
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    54   4e-07
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     54   4e-07
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    53   5e-07
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    53   5e-07
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    53   5e-07
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    53   6e-07
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    53   6e-07
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    53   7e-07
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    53   7e-07
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    52   8e-07
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    52   9e-07
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    51   2e-06
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    51   3e-06
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    51   3e-06
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    51   3e-06
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    50   3e-06
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    50   3e-06
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    50   5e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    50   7e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    49   8e-06
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    49   9e-06
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    48   3e-05
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    47   4e-05
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    45   2e-04
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    40   4e-04
KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.5...    34   0.62 
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...    33   1.1  
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    31   7.0  

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/372 (100%), Positives = 372/372 (100%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 361 TQQVVDDILSKI 372
           TQQVVDDILSKI
Sbjct: 361 TQQVVDDILSKI 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/372 (83%), Positives = 343/372 (92%), Gaps = 1/372 (0%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           M R  ATRL+A RG +S   A+K+LTIGLIPGDGIGKEVIPAGKQ+LE +  K  L F F
Sbjct: 1   MFRSVATRLSACRGLASN-AARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF 59

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL+AG++TFQ TGKALPDETV+VL+  CQGALFGAVQSPTTKVEGYSSPIVALR+ MGL
Sbjct: 60  IDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           FANVRPVK+VEG   +P+DMVIVRENTEDLYIKIEKTY D ATGTRVA+ATKRISE+ATR
Sbjct: 120 FANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           RIATIALDIAL+RLQ+RG ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYG+I+YNE
Sbjct: 180 RIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GIANPIATIRSTALMLEFLG+ EAAQ IYKAVD+N+RE  IKTPDLGGK++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAS 359

Query: 361 TQQVVDDILSKI 372
           TQQVVDD+LS++
Sbjct: 360 TQQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/372 (82%), Positives = 343/372 (92%), Gaps = 1/372 (0%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLR  ATRL+  RG + T  A+K+LTIGLIPGDGIGKEVIPAGKQ+LE +  K  L F F
Sbjct: 1   MLRSVATRLSTCRGLA-TNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF 59

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL+AG++TFQ TGKALPDETV+VL+  CQGALFGAVQSPTTKVEGYSSPIVALR+ MGL
Sbjct: 60  IDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           FANVRPVK+VEG  D+P+DMVIVRENTEDLYIKIEKTY D ATGTRVA+ATKRISE+ATR
Sbjct: 120 FANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           RIATIA+DIAL+RLQ+RG ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYG+I+YNE
Sbjct: 180 RIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GIANPIATIRSTALMLEFLG+  AAQ IYKAVD+N+RE  IKTPDLGGK++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359

Query: 361 TQQVVDDILSKI 372
           TQQVV+D+LS++
Sbjct: 360 TQQVVEDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/372 (82%), Positives = 342/372 (91%), Gaps = 1/372 (0%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           M R  ATR++A RG +S   A+K+LTIGLIPGDGIGKEVIPAGKQILE +  K  L F F
Sbjct: 1   MFRSVATRISACRGLASN-AARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNF 59

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL+AG++TFQ TGKALPDET++VL+  CQGALFGAVQSPTTKVEGYSSPIVALR+ MGL
Sbjct: 60  IDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           +ANVRPVK+VEGT D+P+DMVIVRENTEDLYIKIEKTY D ATGTRVA+A KRISEVATR
Sbjct: 120 YANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATR 179

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           RIA IALDIALQRLQ+RG ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG+I+YNE
Sbjct: 180 RIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNE 239

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCH 299

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GIANPIATIRSTALMLEFLG+ +AAQ IYKAVD+N+RE  I TPDLGGK++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359

Query: 361 TQQVVDDILSKI 372
           TQQVVDD+LS++
Sbjct: 360 TQQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/372 (81%), Positives = 343/372 (92%), Gaps = 1/372 (0%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           M R  ATR++A RG + T  A+K+LTIGLIPGDGIGKEVIPAGKQ+LE +  K  L F F
Sbjct: 1   MFRSVATRVSACRGLA-TNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF 59

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL+AG++TFQ TGKALPDETV VL++ CQGALFGAVQSPTTKVEGYSSPIVALR+ MGL
Sbjct: 60  IDLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           FANVRPVK+VEG+ ++P+DMVIVRENTEDLYIKIEKTY D ATGTRVA+ATKRISE+ATR
Sbjct: 120 FANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           RIATIALDIAL+RLQ+RG ATLTVTHKSNVLSQ+DGLFREICK+VYESNKDKYG+I+YNE
Sbjct: 180 RIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GIANPIATIRSTALMLEFLG+  AAQ IYKAVD+N+RE  I TPDLGGK++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAS 359

Query: 361 TQQVVDDILSKI 372
           TQQVVDD+LS++
Sbjct: 360 TQQVVDDVLSRL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/372 (82%), Positives = 338/372 (90%), Gaps = 3/372 (0%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLR +  RL   R ++S   A K++ IGLIPGDGIGKEVIPAGKQ+LE +  K  L+F F
Sbjct: 1   MLRSAIGRLATRRAYAS---APKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDF 57

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL AGW TFQ TGKALP++TV+VL+  CQGALFGAVQSPTTKVEGYSSPIVALRK +GL
Sbjct: 58  IDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGL 117

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           +ANVRPVK+VEGT DRPVDMVIVRENTEDLYIK+EKTY D ATGTRVAEATKRISEVATR
Sbjct: 118 YANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATR 177

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           RIATIALDIALQRL++ GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG++ YNE
Sbjct: 178 RIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNE 237

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 238 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 297

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GI+NPIATIRST LMLEFLG+ + AQ IY+AVD+N+RE+++KTPDLGG ST
Sbjct: 298 GSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNST 357

Query: 361 TQQVVDDILSKI 372
           TQQVV+DILSK+
Sbjct: 358 TQQVVEDILSKL 369

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/372 (80%), Positives = 341/372 (91%), Gaps = 1/372 (0%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLR +A +L   RG + T  A+K+LTIGLIPGDGIGKEVIPAGKQ+L+ + PK  L+F F
Sbjct: 2   MLRSAANKLAGCRGLA-TNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDF 60

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL AG++TFQ+TGKALPDETV++L+  CQGALFGAVQSPTTKVEGYSSPIVALRKAMGL
Sbjct: 61  IDLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           +AN+RPVK+VEG+N+RPVDM+IVRENTEDLYIKIEKTY D ATGTRVAEATKRISE+AT+
Sbjct: 121 YANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQ 180

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           RIATIALDIALQRLQ+ G ATLTVTHKSNVLSQSDGLFRE+C+++YE+NKDKY  I YNE
Sbjct: 181 RIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNE 240

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GIANPIATIRSTALMLEFLG+ EAAQ I+KAVD+N+R+  +KT DLGG +T
Sbjct: 301 GSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNAT 360

Query: 361 TQQVVDDILSKI 372
           TQ VVDDIL+++
Sbjct: 361 TQNVVDDILARL 372

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/374 (81%), Positives = 338/374 (90%), Gaps = 3/374 (0%)

Query: 1   MLRGSATRL--TAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDF 58
           MLR +A+R   +  R +++  L +K LTIGLIPGDGIGKEVIPAGKQ+LE +  K  L F
Sbjct: 1   MLRTAASRFATSTCRTYATNAL-RKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKF 59

Query: 59  KFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAM 118
            FIDL AG++TF +TGKALPDETV+VL+  CQGALFGAVQSPTTKVEGYSSPIVALRK M
Sbjct: 60  DFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEM 119

Query: 119 GLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVA 178
           GLFANVRPVK+V GT DRPVDMVIVRENTEDLYIKIEKTY D ATGTRVAEATKRISE+A
Sbjct: 120 GLFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIA 179

Query: 179 TRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQY 238
           TRRIATIALDIALQRL+  G ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG I Y
Sbjct: 180 TRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITY 239

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 298
           NEQIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP
Sbjct: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 299

Query: 299 CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGK 358
           CHGSAPDIAG+GIANPIATIRSTALMLEFLG+ +AAQ I++AV++N+REN+IKTPDLGG 
Sbjct: 300 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359

Query: 359 STTQQVVDDILSKI 372
           STTQQV +D+L+++
Sbjct: 360 STTQQVTEDVLARL 373

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/372 (81%), Positives = 331/372 (88%), Gaps = 4/372 (1%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           M R S  ++ A R +S    A K++ IGLIPGDGIGKEVIPAGKQ+LE +G K  L F F
Sbjct: 1   MFRSSVAKVAARRAYS----APKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDF 56

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL AGWE FQ  GKALPD+TV+VL+  CQGALFGAVQSPTTKV GYSSPIVALRK +GL
Sbjct: 57  IDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGL 116

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           +ANVRPVK+VE  NDR VDM+IVRENTEDLYIK EKTY D ATGTRVAEA KRISEVATR
Sbjct: 117 YANVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATR 176

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           +IATIALDI+LQRL+SRGHATLTVTHKSNVLSQSDGLFREICKDVYE NKDKYG+++YNE
Sbjct: 177 KIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNE 236

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 237 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 296

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GI+NPIATIRSTALMLEFLG+PE AQ IYKAVD+N+ +  + TPDLGGK+T
Sbjct: 297 GSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKAT 356

Query: 361 TQQVVDDILSKI 372
           TQQVVDDILSKI
Sbjct: 357 TQQVVDDILSKI 368

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/373 (79%), Positives = 341/373 (91%), Gaps = 2/373 (0%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLR +A+RL   RG+++  + +K LTIGLIPGDGIGKEVIPAGKQ+L+ +  K  L+F F
Sbjct: 1   MLRTTASRLATCRGYATNAI-RKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDF 59

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL AG++TF +TGKALPDET++VL+  CQGALFGAVQSPTTKVEGYSSPIVALRK MGL
Sbjct: 60  IDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGL 119

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTED-LYIKIEKTYTDPATGTRVAEATKRISEVAT 179
           +ANVRPVK+VEGT D+PVDMVIVRENT   + IK+E+TY D ATGTRVAEATKRISE+AT
Sbjct: 120 YANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIAT 179

Query: 180 RRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYN 239
           RRIATIALDIALQRL++ G ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG+I YN
Sbjct: 180 RRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYN 239

Query: 240 EQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 299
           EQIVDSMVYRMFREP+CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 240 EQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 299

Query: 300 HGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKS 359
           HGSAPDIAG+GI+NPIATIRSTALMLEFLG+ EAAQ I++AV++N++EN++KTPDLGGKS
Sbjct: 300 HGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKS 359

Query: 360 TTQQVVDDILSKI 372
           TTQ+V +D+L+++
Sbjct: 360 TTQEVTEDVLARL 372

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/372 (79%), Positives = 332/372 (89%), Gaps = 4/372 (1%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLR + ++  A R ++S   A K LTIGLIPGDGIGKEVIPAGK +LE +  K +L F F
Sbjct: 1   MLRSTVSQF-ARRSYAS---AAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNF 56

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL AGW+TF +TGKALPDET+E+L+ DCQGALFGAVQSPT KVEGYSSPIVALRK +GL
Sbjct: 57  IDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGL 116

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           +ANVRPVK+V+GTNDRPVDM+IVRENTEDLYIK EKTY D  TGTRVAEA KRISE AT 
Sbjct: 117 YANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATT 176

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
            IA IAL+I+LQRL++ G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG I YNE
Sbjct: 177 DIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNE 236

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCH
Sbjct: 237 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCH 296

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GI+NPIATIRSTALMLEF+GY EAAQ I+KAVD+NIRENQIKTPDLGGKST
Sbjct: 297 GSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKST 356

Query: 361 TQQVVDDILSKI 372
           TQQVVDDILSK+
Sbjct: 357 TQQVVDDILSKM 368

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/372 (79%), Positives = 333/372 (89%), Gaps = 4/372 (1%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           M+R    +L+  R ++S     K LTIGLIPGDGIGKEVIPAGK+ILE + PK+ L FKF
Sbjct: 1   MMRTRFIQLS-RRAYASN---AKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKF 56

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL AGWETFQNTGKALPDET+++L+  C+GALFGAVQSPTTKVEGYSSPIVALRK +GL
Sbjct: 57  IDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGL 116

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           FANVRPVK+V+GT DR VD+VIVRENTEDLYIK+EK+Y D ATGTRVA+ATKRI+E+AT+
Sbjct: 117 FANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATK 176

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
            IATIAL IA QRL+  GHATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG +QYNE
Sbjct: 177 NIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNE 236

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCH
Sbjct: 237 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCH 296

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GI+NPIATIRSTALMLEFLGYPE A+ I+KAVD+NIRE +  TPDLGG ST
Sbjct: 297 GSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNST 356

Query: 361 TQQVVDDILSKI 372
           TQQV++D+LSK+
Sbjct: 357 TQQVLEDVLSKL 368

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/372 (78%), Positives = 328/372 (88%), Gaps = 2/372 (0%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLR    R  A R  +    A+  LTIGLIPGDGIGKEVIPAGK++LE +G K+ +DFKF
Sbjct: 1   MLRNGVYRACARR--TVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKF 58

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDLHAGW+TF +TGKALPDETV +L++ CQGALFGAVQSPTTKVEGYSSPIVALRK +GL
Sbjct: 59  IDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGL 118

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           +AN+RPVK+V GTNDRPVDMVIVRENTEDLYIK E+TY D ATGT+VAEATKRISEVATR
Sbjct: 119 YANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATR 178

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           +IA IALDIALQRL++ G ATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG + YNE
Sbjct: 179 KIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNE 238

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCH
Sbjct: 239 QIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCH 298

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDI+G+GI+NP+ATIRS ALML+FLGY EAA+ I  AVD NIR  +IKTPDLGG S+
Sbjct: 299 GSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSS 358

Query: 361 TQQVVDDILSKI 372
           T +V DDILSK+
Sbjct: 359 TTEVTDDILSKL 370

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/372 (77%), Positives = 328/372 (88%), Gaps = 5/372 (1%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLR S T+L A R ++S   A K+LTIGLIPGDGIGKEVIPAG+Q+LE +  K  L F F
Sbjct: 1   MLRASFTQL-ARRSYAS---ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDF 56

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL AGW+TFQ TGKALPDET+++LR  CQGALFGAVQSPT KVEGYSSPIVALRK +GL
Sbjct: 57  IDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGL 116

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           +ANVRPVK+V    +RPVDM+IVRENTEDLYIK EKTY D  TGTRVAEA KRISE AT+
Sbjct: 117 YANVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATK 175

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
            IA IAL+IALQR +  G ATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+G I+YNE
Sbjct: 176 NIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNE 235

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCH
Sbjct: 236 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GI+NP+ATIRSTALMLEF+G+PEAAQ I+KAVD+N+R+N IKTPDLGGKST
Sbjct: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKST 355

Query: 361 TQQVVDDILSKI 372
           TQQVV+D+LS++
Sbjct: 356 TQQVVEDVLSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/372 (76%), Positives = 328/372 (88%), Gaps = 5/372 (1%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLR S  +L A R ++S   A K+LTIGLIPGDGIG+EVIPAGK +LE +  K  L F F
Sbjct: 1   MLRTSFNQL-ARRSYTS---ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNF 56

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL AGW+TF +TGKALPDET+++L+ +CQGALFGAVQSPT KVEGYSSPIVALRK +GL
Sbjct: 57  IDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGL 116

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           +ANVRPVK+V  + ++P+DMVIVRENTEDLYIK EKTY D  TGTRVAEA KRISEVATR
Sbjct: 117 YANVRPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATR 175

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
            IA IAL+IALQR +  G ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+G I YNE
Sbjct: 176 NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNE 235

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCH
Sbjct: 236 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAG+GI+NP+ATIRSTALMLEF+G+PEAAQ I+KAVD+N+R+N +KTPDLGGKST
Sbjct: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKST 355

Query: 361 TQQVVDDILSKI 372
           TQQVVDD+LS++
Sbjct: 356 TQQVVDDVLSRM 367

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/366 (77%), Positives = 322/366 (87%), Gaps = 3/366 (0%)

Query: 9   LTAMRGFSSTR--LAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAG 66
           L   RG  STR  +  K+ TIGLIPGDGIGKEVIP G+++LEK+GPK+ +DFK+IDL AG
Sbjct: 2   LRVGRGQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAG 61

Query: 67  WETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRP 126
           W+TF +TGKALPD+TVE LR +CQGALFGAVQSPTTKV+GYSSPIVALRKA+GL+AN+RP
Sbjct: 62  WQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRP 121

Query: 127 VKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIA 186
           VK+V+GT DRPVD+VI RENTEDLYIK E+TY D  TG RVAEA KRISE ATR IA IA
Sbjct: 122 VKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIA 181

Query: 187 LDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSM 246
           L+IALQRL+ +GHATLTVTHKSNVLSQSDGLFREICK VY+SNK K+  +QYNEQIVDSM
Sbjct: 182 LEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSM 240

Query: 247 VYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDI 306
           VYR+F+EP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSAPDI
Sbjct: 241 VYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDI 300

Query: 307 AGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVD 366
            G+GIANPIATIRS AL+LEFLG PEAA+ I K VD NIREN+IKTPDLGG ST +QV +
Sbjct: 301 VGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVAN 360

Query: 367 DILSKI 372
           DILS+I
Sbjct: 361 DILSRI 366

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/366 (77%), Positives = 322/366 (87%), Gaps = 3/366 (0%)

Query: 10  TAMRGFS-STRLAQ--KALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAG 66
           T++R FS S R A   K LTIGLIPGDGIGKEVIPAGKQ+L+ +  K  L F+FIDL AG
Sbjct: 4   TSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAG 63

Query: 67  WETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRP 126
           ++TF +TG ALP +TV++L+  CQGALFGAVQSPTTKVEGYSSPIV LRK +GLFANVRP
Sbjct: 64  YQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRP 123

Query: 127 VKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIA 186
           VK VEGT+ +P+D+VIVRENTEDLYIKIEKTYTDP  G+R+AEATKRI+E AT+RIA  A
Sbjct: 124 VKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTA 183

Query: 187 LDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSM 246
           LDIALQRL+++G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  + YNEQIVDSM
Sbjct: 184 LDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSM 243

Query: 247 VYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDI 306
           VYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCHGSAPDI
Sbjct: 244 VYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSAPDI 303

Query: 307 AGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVD 366
           AG+GIANPIATIRSTA MLE+LGY   AQ IYKAVD+NIR+N+IKT DLGG STTQQV+D
Sbjct: 304 AGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVID 363

Query: 367 DILSKI 372
           DIL K+
Sbjct: 364 DILGKL 369

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/373 (75%), Positives = 326/373 (87%), Gaps = 3/373 (0%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           MLR   T+   +R  S T+   K+LTIGLIPGDGIGKEVIPAGKQ+L+ +  +  L+F F
Sbjct: 1   MLRSVVTKSATIRHLS-TKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNF 59

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
           IDL AG++TF +TGKALPDETV+VL+  CQG LFGAVQSPTT+V+ YSSPIVALRK + L
Sbjct: 60  IDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQL 119

Query: 121 FANVRPVKAVEGTND-RPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVAT 179
           +AN+RPVK+V G +  +PVDMVIVRENTEDLYIKIEK+Y D   G RVAEATKRI+EVAT
Sbjct: 120 YANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKD-QNGMRVAEATKRITEVAT 178

Query: 180 RRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYN 239
           R+IA IALD+ALQRL++ G ATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  I YN
Sbjct: 179 RKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYN 238

Query: 240 EQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 299
           EQI+DSMVYRMFREPE FDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPC
Sbjct: 239 EQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPC 298

Query: 300 HGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKS 359
           HGSAPDIAG+GIANPIATIRSTALMLEFLG+ EAAQ I+KAV+SN+REN+IKTPDLGG S
Sbjct: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNS 358

Query: 360 TTQQVVDDILSKI 372
           +TQ VVDD+L K+
Sbjct: 359 STQNVVDDVLEKL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/375 (74%), Positives = 325/375 (86%), Gaps = 7/375 (1%)

Query: 1   MLRGSATRLTAMRGFSST--RLAQKA-LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLD 57
           MLR    R    R F  T   +++K+ LTIGLIPGDGIGKEVIP+G+Q+LE +GPK  L 
Sbjct: 1   MLR----RSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLT 56

Query: 58  FKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKA 117
           F FIDL AGW+TF +TGKALP ETV+ LR +C GALFGAVQSPTTKVEGYSSPIVALRK 
Sbjct: 57  FNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKE 116

Query: 118 MGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEV 177
           +GL+AN+RPVK+V+   ++ VDMVIVRENTEDLYIK+EKTY D  TGTRVA+ATKRISEV
Sbjct: 117 LGLYANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEV 176

Query: 178 ATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQ 237
           ATRRIA IALDIALQRL++ G+  LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  IQ
Sbjct: 177 ATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQ 236

Query: 238 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGE 297
           YNEQI+DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGE
Sbjct: 237 YNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGE 296

Query: 298 PCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGG 357
           PCHGSAPDIAG+GI+NPIATIRSTALMLEFLG+ +AAQ I  AVDSN+RE++IKTPDLGG
Sbjct: 297 PCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGG 356

Query: 358 KSTTQQVVDDILSKI 372
           K++T  VV+D++ ++
Sbjct: 357 KNSTSDVVNDVIRRL 371

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/372 (69%), Positives = 305/372 (81%), Gaps = 5/372 (1%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60
           M R SAT L       +T    K LTIGLIPGDGIGKEVIPAG+++LE +G K D+ F +
Sbjct: 1   MHRSSATSLI----HKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSY 56

Query: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120
             L AGW+TF  TG ALP  TVE LR  CQGALFGAVQSPTTKVEGYSSPIVALR+ +GL
Sbjct: 57  EHLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGL 116

Query: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180
           +AN+RPVK+V GT  +PVD+VIVRENTEDLY++ E+TY D ATG RVAEA KRISE AT 
Sbjct: 117 YANIRPVKSVSGTG-QPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATE 175

Query: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240
           RIA I+L +ALQR +  G   LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YG I+YNE
Sbjct: 176 RIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNE 235

Query: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300
           QIVDSMVYR+F+EP CFDVVVAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCH
Sbjct: 236 QIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCH 295

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           GSAPDIAGRGIANPIATIRS +LML+FLG  EAA  I +AV  N+++ Q+ +PDLGGK+T
Sbjct: 296 GSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNT 355

Query: 361 TQQVVDDILSKI 372
           TQ+V+DDIL++I
Sbjct: 356 TQEVLDDILARI 367

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  192 bits (487), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 195/354 (55%), Gaps = 27/354 (7%)

Query: 25  LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEV 84
            T+  I GDGIG E+  + KQI +    K  +D++  D+      F N    +P+  V+ 
Sbjct: 37  FTVSFIEGDGIGPEISQSVKQIFDAA--KVPIDWEPCDVSP---LFINGLTTIPEPAVQS 91

Query: 85  LRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVI 142
           + ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T    VD+VI
Sbjct: 92  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148

Query: 143 VRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATL 202
           +RENTE  Y  IE   T P     V ++ K I+  A+ R+   A + A    ++ G   +
Sbjct: 149 IRENTEGEYSGIEHVVT-PG----VVQSIKLITRDASERVIRYAYEYA----RAIGRPRV 199

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VV 260
            V HKS +   +DGLF ++ K++ +    +Y  IQ   +++D+ V  +   P  +   V 
Sbjct: 200 IVVHKSTIQRLADGLFVDVAKELSQ----EYPDIQLETELIDNTVLNVVSNPSSYSNAVS 255

Query: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIR 319
           V PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP A + 
Sbjct: 256 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315

Query: 320 STALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
           S+ +ML  +G    A  I KAV S I    + +T DL GK+TT    D ++ ++
Sbjct: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  190 bits (482), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 139/381 (36%), Positives = 200/381 (52%), Gaps = 31/381 (8%)

Query: 1   MLRGSATRLTAMRGFSSTR---LAQKA---LTIGLIPGDGIGKEVIPAGKQILEKVGPKF 54
           M R + + +T  RG+++ R   L +K     T+ LIPGDGIGKEV  +  QI E      
Sbjct: 1   MFRNTLSHITK-RGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFE--AENV 57

Query: 55  DLDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVAL 114
            +D++ ++L A  E  +   KA     VE L+R+  G L G   +P  +  G+ S  VA 
Sbjct: 58  PVDWESVELSALEENHEGVQKA-----VESLKRNKVG-LKGIWHTPADQT-GHGSLNVAF 110

Query: 115 RKAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATK 172
           RK + +FANV   K+  G  T  + VD+VI+RENTE  Y  +E     P     V E+ K
Sbjct: 111 RKQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESV-PG----VVESLK 165

Query: 173 RISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDK 232
            +++  + RIA  A D AL+         +   HK+N++   DGLFR     V E    +
Sbjct: 166 IMTKAKSERIARFAFDFALKN----NRKAVCAVHKANIMKLGDGLFRNT---VSEIGAKE 218

Query: 233 YGKIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE 292
           Y ++  +  IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G E
Sbjct: 219 YPEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGRE 278

Query: 293 IVIGEP-CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIK 351
             + EP C     DI G+ +ANP A I S+ LML  LG  E A  I +A    I E +  
Sbjct: 279 YAVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRT 338

Query: 352 TPDLGGKSTTQQVVDDILSKI 372
           T D+GG +TT +  + ++ K+
Sbjct: 339 TKDIGGTATTTEFTNAVIDKL 359

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  189 bits (480), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 196/353 (55%), Gaps = 27/353 (7%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+  I GDG+G E+  + K I      K  ++++  D+      F N    +PD  V  +
Sbjct: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIV 143
            ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T    V++V++
Sbjct: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  Y  IE      A G  V ++ K I++ A+ R+   A + A    +S+    + 
Sbjct: 149 RENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYARAVDRSK----VL 199

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVV 261
           V HKS +   +DGLF ++ K +      +Y  I+   +++D+ V +  + PE +D  VVV
Sbjct: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255

Query: 262 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRS 320
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 321 TALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
           + +ML  +G  E A  I KAV + I  + + +T DLGG ++T    D ++ ++
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  188 bits (478), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 133/360 (36%), Positives = 190/360 (52%), Gaps = 39/360 (10%)

Query: 25  LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALP 78
            T+  I GDGIG E+  + K+I           F+  D+   WET      F N    +P
Sbjct: 36  FTVSFIEGDGIGPEISSSVKRI-----------FQAADVPVEWETCDVTPIFVNGLTTIP 84

Query: 79  DETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDR 136
           D  V+ + ++   AL G + +P  K  G+ S  + LRK   LFANVRP K++EG  T   
Sbjct: 85  DPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYE 141

Query: 137 PVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQS 196
            VD+V++RENTE  Y  IE     P     V ++ K I+  A+ R+   A + A    ++
Sbjct: 142 NVDLVLIRENTEGEYSGIEH-LVSPG----VVQSIKLITRDASERVIRYAYEYA----RA 192

Query: 197 RGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPEC 256
            G   L V HKS +   +DGLF  + K++      +Y  IQ   +++D+    +   P  
Sbjct: 193 IGRPRLIVVHKSTIQRLADGLFVNVAKEL----AAEYPDIQLETELIDNTCLNVVSNPSS 248

Query: 257 FD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIAN 313
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  AN
Sbjct: 249 YTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKAN 308

Query: 314 PIATIRSTALMLEFLGYPEAAQPIYKAVDSNIR-ENQIKTPDLGGKSTTQQVVDDILSKI 372
           P A + S+ +ML  +G  E A  I KAV   I   ++ +T DLGG ++T    D I+ K+
Sbjct: 309 PTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  189 bits (479), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 193/353 (54%), Gaps = 27/353 (7%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+  I GDGIG E+  + KQI      K  ++++  D+      F +    +P+  V+ +
Sbjct: 91  TVSFIEGDGIGPEISNSVKQIFSAA--KVPIEWETCDV---TPLFIDGLTTIPEPAVQSI 145

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIV 143
            ++   AL G + +P  K  G+ S  + LRK  GLFANVRP ++V+G  T    VD+V++
Sbjct: 146 NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  Y  IE   T P     V ++ K I+  A+ R+    +  A +  ++ G   L 
Sbjct: 203 RENTEGEYSGIEHVVT-PG----VVQSIKLITREASERV----IRYAFEYCRAIGRPRLV 253

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVV 261
           V HKS +   SDGLF  + K++      +Y  IQ+  +++D+ V ++   P  +   V V
Sbjct: 254 VVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309

Query: 262 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRS 320
            PNLYGDILSD  + L  GSLG+ PS N+G EI I E  HGSAPDIAG+ +ANP A + S
Sbjct: 310 CPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369

Query: 321 TALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
           + +ML  +G  + A  I  AV S I    + +T DL G +TT    D ++ K+
Sbjct: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  184 bits (467), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 192/353 (54%), Gaps = 27/353 (7%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+  I GDGIG E+  + K I      K  +++++ D+      F N    +PD  V+ +
Sbjct: 39  TVSFIEGDGIGPEISQSVKDIFSAA--KVPVEWEYCDV---TPIFINGLTTIPDPAVQSI 93

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIV 143
            ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T    VD+V++
Sbjct: 94  NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 150

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  Y  IE   + P     V ++ K I+  A+ R+   A + A    ++ G   + 
Sbjct: 151 RENTEGEYSGIEHVVS-PG----VVQSIKLITRDASERVIRYAFEYA----RAVGRPKVV 201

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVV 261
           V HKS +   +DGLF  + ++V      +Y  I+   +++D+ V  +  +PE +   V V
Sbjct: 202 VVHKSTIQRLADGLFVNVAQEV----GKEYPDIELQPELIDNTVLNVVSKPEKYSDSVAV 257

Query: 262 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRS 320
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 258 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLS 317

Query: 321 TALMLEFLGYPEAAQPIYKAVDSNI-RENQIKTPDLGGKSTTQQVVDDILSKI 372
           + +ML  +G  E A  I  AV + +  + + +T DL G +TT      ++ ++
Sbjct: 318 SVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  184 bits (466), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 135/385 (35%), Positives = 206/385 (53%), Gaps = 36/385 (9%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQK-----ALTIGLIPGDGIGKEVIPAGKQILEKVGPKFD 55
           + +GS   L ++R  S  R A K       T+  I GDG+G E+  + K I         
Sbjct: 6   LFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFS--AASVP 63

Query: 56  LDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALR 115
           +++++ D+        N    +P+  V  + ++   AL G + +P  K  G+ S  + LR
Sbjct: 64  VEWEYCDVTP---LLVNGLTTIPEPAVASINKNLV-ALKGPLATPIGK--GHRSLNLTLR 117

Query: 116 KAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKR 173
           K  GLFANVRP K++EG  T    VD+V++RENTE  Y  IE   + P     V ++ K 
Sbjct: 118 KTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVS-PG----VVQSIKL 172

Query: 174 ISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKY 233
           I+  A+ R+   A + A    ++ G   + V HKS +   +DGLF  + +++      +Y
Sbjct: 173 ITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREY 224

Query: 234 GKIQYNEQIVDSMVYRMFREPECFDVVVA--PNLYGDILSDGAAAL-VGSLGVVPSANVG 290
             I+   +++D+ V  +  +PE +  VVA  PNLYGDILSD  + L  GSLG+ PSAN+G
Sbjct: 225 PDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIG 284

Query: 291 PEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNI---RE 347
            ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I KAV S I   RE
Sbjct: 285 HQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRE 344

Query: 348 NQIKTPDLGGKSTTQQVVDDILSKI 372
           N  +T DL G ++T    + ++ ++
Sbjct: 345 N--RTADLAGTASTSSFTNAVIERL 367

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  184 bits (466), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 126/350 (36%), Positives = 186/350 (53%), Gaps = 25/350 (7%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+ LIPGDG+GKEV  +  +I E       +D++ ID+ +G E  +N  +A     VE L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFEN--ENIPIDWETIDI-SGLENTENVQRA-----VESL 82

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDR--PVDMVIV 143
           +R+  G L G   +P  +  G+ S  VALRK + +FANV   K++ G   R   +DMVI+
Sbjct: 83  KRNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  Y  +E     P     V E+ K ++   + RIA  A D AL+        ++ 
Sbjct: 141 RENTEGEYSGLEHESV-PG----VVESLKIMTRAKSERIARFAFDFALKN----NRKSVC 191

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVVVAP 263
             HK+N++   DGLFR    ++     ++Y ++     IVD+   +   +P  FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 264 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIATIRSTA 322
           NLYG IL +  +AL+G  G+VP AN G E  + EP       DI G+ +ANP A I S+ 
Sbjct: 249 NLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 308

Query: 323 LMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
           LML  LG    A  I KA    I E +  T D+GG ++T +  + ++ K+
Sbjct: 309 LMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  184 bits (466), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 202/390 (51%), Gaps = 39/390 (10%)

Query: 1   MLRGSATRLTAMRGFSSTRL------------AQKALTIGLIPGDGIGKEVIPAGKQILE 48
           MLR +  R T+ R  S+ +             +    T+  I GDGIG E+  + K+I  
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 49  KVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYS 108
                  ++++F D++     F N    +PD  V+ + ++   AL G + +P  K  G+ 
Sbjct: 61  AA--DVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112

Query: 109 SPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTR 166
           S  + LRK  GLFANVRP K++EG  T    VD+V++RENTE  Y  IE     P     
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVC-PG---- 167

Query: 167 VAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVY 226
           V ++ K I+  A+ R+   A + A    ++ G   + V HKS +   +DGLF  + K++ 
Sbjct: 168 VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL- 222

Query: 227 ESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 283
                +Y  I +  +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 223 ---SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 284 VPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDS 343
            PSAN+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I  AV S
Sbjct: 280 TPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLS 339

Query: 344 NIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
            I    + +T DL G +TT    + ++ ++
Sbjct: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  183 bits (465), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 184/353 (52%), Gaps = 31/353 (8%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDET---V 82
           T+ LIPGDGIGKEV  +  +I    G   D           WE     G +  +E    V
Sbjct: 30  TVTLIPGDGIGKEVTDSVVKIFASQGLPID-----------WERIDVPGMSNENEVKKAV 78

Query: 83  EVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDR--PVDM 140
           E L+R+  G     +   +    GY S  VALRK + +FANV   K+++G   +   VD+
Sbjct: 79  ESLKRNKIG--LKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDL 136

Query: 141 VIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHA 200
           V++RENTE  Y  +E     P     V E+ K I++  T RIA  A D AL+  +S    
Sbjct: 137 VVIRENTEGEYSGLEHESV-PG----VVESLKIITKPKTERIARFAFDFALENNRS---- 187

Query: 201 TLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVV 260
           T+T  HK+N++  SDGLF+    +V E    +Y  I+ N  IVD+   +   +P  FDV+
Sbjct: 188 TVTAVHKANIMKLSDGLFKNTVAEVGEK---EYPDIKVNTIIVDNASMQAVAKPHQFDVM 244

Query: 261 VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIATIR 319
           V P++YG IL +  AAL+G  G++P AN G E  + EP       DI  + IANP A I 
Sbjct: 245 VTPSMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMIL 304

Query: 320 STALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
           S  LML  LG  E ++ I  AV + I E +  T D+GG ++T +  D ++ K+
Sbjct: 305 SATLMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  182 bits (463), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 128/352 (36%), Positives = 193/352 (54%), Gaps = 27/352 (7%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVLR 86
           +  I GDGIG E+  + K I +    +  ++++F D+      F N    +PD  V  + 
Sbjct: 43  VSFIEGDGIGPEISQSVKDIFKAA--EVPINWEFCDVTP---IFVNGLTTIPDPAVASIN 97

Query: 87  RDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIVR 144
           ++   AL G + +P  K  G+ S  + LRK   LFANVRP K++EG  T    VD+V++R
Sbjct: 98  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154

Query: 145 ENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTV 204
           ENTE  Y  IE      A G  V ++ K I+  A+ R+   A + A    ++ G   + V
Sbjct: 155 ENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205

Query: 205 THKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVVA 262
            HKS +   +DGLF  + K++ +    +Y +I+   +++D+ V  +   P  +   V V 
Sbjct: 206 VHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261

Query: 263 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRST 321
           PNLYGDILSD  + L  GSLG+ PSAN+G EI I E  HGSAPDIAG+  ANP A + S+
Sbjct: 262 PNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321

Query: 322 ALMLEFLGYPEAAQPIYKAVDSNI-RENQIKTPDLGGKSTTQQVVDDILSKI 372
            +ML  +G  + A  I +AV + I   ++ +T DLGG +TT    D ++  +
Sbjct: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  182 bits (462), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 190/353 (53%), Gaps = 27/353 (7%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+  I GDGIG E+  + K+I         ++++F D++     F N    +PD  V+ +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFSAA--NVPIEWEFCDVNP---IFVNGLTTIPDPAVQSI 92

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIV 143
            ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K+VEG  T    VD+V++
Sbjct: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  Y  IE     P     V ++ K I+  A+ R+   A + A    ++ G   + 
Sbjct: 150 RENTEGEYSGIEHIVC-PG----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVI 200

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVV 261
           V HKS +   +DGLF  + K++      +Y  I    +++D+ V ++   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITLETELIDNSVLKVVTNPSAYTNAVSV 256

Query: 262 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRS 320
            PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316

Query: 321 TALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
           + +ML  +G    A  I  AV S I    + +T DL G +TT    + ++ ++
Sbjct: 317 SVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  182 bits (462), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 129/359 (35%), Positives = 190/359 (52%), Gaps = 39/359 (10%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79
           T+  I GDG+G E+  + K I           F   ++   WE+      F N    +P 
Sbjct: 38  TVSFIEGDGVGPEISKSVKDI-----------FAAAEVPVEWESCDVTPLFINGLTTIPQ 86

Query: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137
             V+ + ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K+VEG  T    
Sbjct: 87  PAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143

Query: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197
           VD+V++RENTE  Y  IE   + P     V ++ K I+  A+ R+   A + A    ++ 
Sbjct: 144 VDLVLIRENTEGEYSGIEHVVS-PG----VVQSIKLITRDASERVIRYAFEYA----RAV 194

Query: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257
           G   + V HKS +   +DGLF ++ K++      +Y  IQ   Q++D+ V  +   P  +
Sbjct: 195 GRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAY 250

Query: 258 --DVVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANP 314
              V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP
Sbjct: 251 ADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANP 310

Query: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
            A + S+ +ML  +G  E A  I KAV S I    + +T DL G ++T    + ++ ++
Sbjct: 311 TALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  182 bits (461), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 134/380 (35%), Positives = 196/380 (51%), Gaps = 29/380 (7%)

Query: 1   MLRGSATRLTAMR-GFSSTRLAQKAL----TIGLIPGDGIGKEVIPAGKQILEKVGPKFD 55
           MLR +  +++  R   +S +L  K      T+ LIPGDG+GKEV  +   I E       
Sbjct: 1   MLRNTFVQISKRRFALASGQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVNIFE--AENVP 58

Query: 56  LDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALR 115
           +D++ ++L    E  +   KA     VE L+R+  G L G   +P  +  G+ S  VA R
Sbjct: 59  IDWESVELSGLEENMEGVQKA-----VESLKRNKVG-LKGIWSTPADQT-GHGSLNVAFR 111

Query: 116 KAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKR 173
           K + +FANV   K+  G  T  + VD+VI+RENTE  Y  +E     P     V E+ K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESV-PG----VVESLKI 166

Query: 174 ISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKY 233
           +++  + RIA  A D AL+        ++   HK+N++   DGLFR    ++      +Y
Sbjct: 167 MTKAKSERIARFAFDFALKN----NRRSVCAVHKANIMKLGDGLFRNTVNEI---GAKEY 219

Query: 234 GKIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEI 293
            +++    IVD+   +   +P  FDV+V PNLYG IL +  AAL+GS G+VP AN G E 
Sbjct: 220 PELEVKSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNVGAALIGSPGLVPGANFGREY 279

Query: 294 VIGEP-CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKT 352
            + EP       DI G+ +ANP A I S+ LML  LG  + A  I KA    I E +  T
Sbjct: 280 AVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKHTT 339

Query: 353 PDLGGKSTTQQVVDDILSKI 372
            D+GG ++T Q    I+ K+
Sbjct: 340 KDIGGHASTTQFTKAIVDKL 359

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  181 bits (459), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 129/376 (34%), Positives = 196/376 (52%), Gaps = 33/376 (8%)

Query: 8   RLTAMRGFSSTRLAQKAL--------TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFK 59
           R  A R  ++   A++AL        T+ LIPGDG+GKE+  + K I E    K  +D++
Sbjct: 4   RTIAKRTLATAAQAERALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFE--AEKIPVDWE 61

Query: 60  FIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMG 119
            +++       Q   K    E VE L+R+  G L G   +P  +  G+ S  VALRK + 
Sbjct: 62  TVNIK------QTDHKEGVYEAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLD 113

Query: 120 LFANVRPVKAVEGTNDR--PVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEV 177
           ++ANV   K+++G   R   +D++++RENTE  +  +E     P     V E+ K ++  
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESV-PG----VVESLKIMTRP 168

Query: 178 ATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQ 237
            T RIA  A D A    +      +T  HK+N++   DGLFR I  ++    + +Y  I 
Sbjct: 169 KTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDID 221

Query: 238 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGE 297
            +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  + E
Sbjct: 222 VSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFE 281

Query: 298 P-CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLG 356
           P       DI G+ +ANP A I S+ LML  LG  E A  I KAV   I E +  T D+G
Sbjct: 282 PGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIG 341

Query: 357 GKSTTQQVVDDILSKI 372
           G S+T    ++I++K+
Sbjct: 342 GSSSTTDFTNEIINKL 357

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  180 bits (456), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 182/353 (51%), Gaps = 31/353 (8%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTG---KALPDETV 82
           T+ LIPGDG+GKEV  +   I E      D           WET + +G   +    + V
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFESENIPID-----------WETVEISGLDNQEGVQKAV 79

Query: 83  EVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRP--VDM 140
           E L+R+  G L G   +P+ +  G+ S  VALRK + +FANV   K+V G   R   VDM
Sbjct: 80  ESLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDM 137

Query: 141 VIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHA 200
           V++RENTE  Y  +E     P     V E+ K +++  + RI   A D A++        
Sbjct: 138 VVIRENTEGEYSGLEHESV-PG----VVESLKIMTKAKSERIGRFAFDFAVKN----NRK 188

Query: 201 TLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVV 260
           ++   HK+N++   DGLFR    +V      +Y +I     IVD+   +   +P  FDV+
Sbjct: 189 SVCAVHKANIMKLGDGLFRNCINEV---GAKEYPEIDVKNIIVDNASMQAVAKPHQFDVL 245

Query: 261 VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIATIR 319
           V PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI G+ +ANP A I 
Sbjct: 246 VTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMIL 305

Query: 320 STALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
           S++LML  LG    A  I KA    I E +  T D+GG ++T +  + I+SK+
Sbjct: 306 SSSLMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSASTTEFTEAIISKL 358

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  180 bits (456), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/398 (34%), Positives = 199/398 (50%), Gaps = 53/398 (13%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKAL--------------TIGLIPGDGIGKEVIPAGKQI 46
           MLR    R T  R  +S    Q ++              T+  I GDG+G E+  + K I
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 47  LEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPDETVEVLRRDCQGALFGAVQSP 100
                      F    +   WE+        N    +P++  E + R+   AL G + +P
Sbjct: 61  -----------FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLV-ALKGPLATP 108

Query: 101 TTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTY 158
             K  G+ S  + LRK  GLFANVRP K+VEG  T    VD+V++RENTE  Y  IE   
Sbjct: 109 IGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVI 166

Query: 159 TDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLF 218
             P     V ++ K I+  A+ R+   A + A    ++ G   L V HKS +   +DGLF
Sbjct: 167 V-PG----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLF 217

Query: 219 REICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF-DVV-VAPNLYGDILSDGAAA 276
             + K++     D    IQ   +++D+ V  +   P  + DVV V PNLYGDILSD  + 
Sbjct: 218 VTVAKELAHEFPD----IQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSG 273

Query: 277 L-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQ 335
           L  GSLG+ PS N+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A 
Sbjct: 274 LSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHAS 333

Query: 336 PIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
            I KAV + I    + +T DL G ++T    + ++S++
Sbjct: 334 KIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  179 bits (453), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 129/379 (34%), Positives = 192/379 (50%), Gaps = 39/379 (10%)

Query: 8   RLTAMRGFSSTRLAQKAL--------TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFK 59
           R  A R  ++   A++ L        T+ LIPGDG+GKE+  + + I E      D    
Sbjct: 4   RTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPID---- 59

Query: 60  FIDLHAGWETF---QNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRK 116
                  WET    Q   K    E VE L+R+  G L G   +P  +  G+ S  VALRK
Sbjct: 60  -------WETINIKQTDHKEGVYEAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRK 110

Query: 117 AMGLFANVRPVKAVEGTNDR--PVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRI 174
            + ++ANV   K+++G   R   +D++++RENTE  +  +E     P     V E+ K +
Sbjct: 111 QLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESV-PG----VVESLKVM 165

Query: 175 SEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG 234
           +   T RIA  A D A    +     ++T  HK+N++   DGLFR I  ++    + +Y 
Sbjct: 166 TRPKTERIARFAFDFA----KKYNRKSVTAVHKANIMKLGDGLFRNIITEI---GQKEYP 218

Query: 235 KIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIV 294
            I  +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  
Sbjct: 219 DIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYA 278

Query: 295 IGEP-CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTP 353
           + EP       DI G+ +ANP A I S+ LML  LG  E A  I KAV   I E +  T 
Sbjct: 279 VFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTR 338

Query: 354 DLGGKSTTQQVVDDILSKI 372
           D+GG S+T    ++I++K+
Sbjct: 339 DIGGSSSTTDFTNEIINKL 357

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  179 bits (454), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 130/394 (32%), Positives = 207/394 (52%), Gaps = 43/394 (10%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKA----------------LTIGLIPGDGIGKEVIPAGK 44
           MLR  A + +A R FS++   + +                 T+  I GDG+G E+  + K
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 45  QILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKV 104
            I +    +  +D+++ D+        N    +P+  V+ + +  + AL G + +P  K 
Sbjct: 61  DIFKAA--QVPVDWEYCDVSP---LLINGLTTIPEPAVQQINKH-KIALKGPLATPIGK- 113

Query: 105 EGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPA 162
            G+ S  + LRK  GLFANVRP +++ G  T  + VD+V++RENTE  Y  IE      A
Sbjct: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV---A 169

Query: 163 TGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREIC 222
            G  V ++ K I+  A+ R+   A + A    ++ G   L V HKS +   +DGLF  I 
Sbjct: 170 PG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIA 223

Query: 223 KDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VG 279
           K++      ++  I+   +++D+ V  + R+P  +   V V PNLYGDILSD  + L  G
Sbjct: 224 KEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAG 279

Query: 280 SLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYK 339
           SLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML ++G    +  I  
Sbjct: 280 SLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIEN 339

Query: 340 AVDSNIRE-NQIKTPDLGGKSTTQQVVDDILSKI 372
           A+ + I   ++ +T DL G +TT    + ++  +
Sbjct: 340 AILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  178 bits (452), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 128/359 (35%), Positives = 188/359 (52%), Gaps = 37/359 (10%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79
           T+  I GDGIG E+  + K I           F+   +   WET        +    +PD
Sbjct: 45  TVSFIEGDGIGPEISRSVKDI-----------FQAASVPITWETCDVSPILVDGLTTIPD 93

Query: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137
           E V+ + ++  G L G + +P  K  G+ S  + LRK   LFANVRP K+V G  T    
Sbjct: 94  EAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDN 150

Query: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197
           VD+V++RENTE  Y  IE   T P     V ++ K I+  A+ R+   A + A    ++ 
Sbjct: 151 VDLVLIRENTEGEYSGIEHVVT-PG----VVQSIKLITRDASERVIRYAFEYA----KAI 201

Query: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257
           G   + V HKS +   SDGLF  + K++ +  +  +  I+ + +++D+ V  +   P  +
Sbjct: 202 GRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKY 259

Query: 258 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANP 314
              V V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  ANP
Sbjct: 260 SDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANP 319

Query: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNI-RENQIKTPDLGGKSTTQQVVDDILSKI 372
            A + S+ +ML  +G  E    I  AV   I   ++ +T DLGG +TT    + ++  +
Sbjct: 320 TALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  177 bits (450), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 197/376 (52%), Gaps = 33/376 (8%)

Query: 8   RLTAMRGFSSTRLAQKAL--------TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFK 59
           R  A R  ++   A++ L        T+ LIPGDG+GKE+  + + I E    +  +D++
Sbjct: 4   RTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFE--AERIPVDWE 61

Query: 60  FIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMG 119
            I++       Q   K    E VE L+R+  G L G   +P  +  G+ S  VALRK + 
Sbjct: 62  TINIK------QTDHKEGVYEAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLD 113

Query: 120 LFANVRPVKAVEGTNDR--PVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEV 177
           ++ANV   K+++G   R   +D++++RENTE  +  +E     P     V E+ K +++ 
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESV-PG----VVESLKVMTKP 168

Query: 178 ATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQ 237
            T RIA  A D A    +      +T  HK+N++   DGLFR I  ++ ++   +Y  I 
Sbjct: 169 KTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQT---EYPDID 221

Query: 238 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGE 297
            +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  + E
Sbjct: 222 VSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFE 281

Query: 298 P-CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLG 356
           P       DI G+ +ANP A I S+ LML  LG  E A  I KAV   I E +  T D+G
Sbjct: 282 PGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKHTTRDIG 341

Query: 357 GKSTTQQVVDDILSKI 372
           G S+T    +++++K+
Sbjct: 342 GSSSTTDFTNEVINKL 357

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  178 bits (451), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 189/359 (52%), Gaps = 39/359 (10%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79
           T+  I GDGIG E+  + K+I           F   ++   WE+      F N    +PD
Sbjct: 38  TVSFIEGDGIGPEISKSVKKI-----------FSAANVPIEWESCDVSPIFVNGLTTIPD 86

Query: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137
             V+ + ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T    
Sbjct: 87  PAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYEN 143

Query: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197
           VD+V++RENTE  Y  IE     P     V ++ K I+  A+ R+   A + A    ++ 
Sbjct: 144 VDLVLIRENTEGEYSGIEHIVC-PG----VVQSIKLITRDASERVIRYAFEYA----RAI 194

Query: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257
           G   + V HKS +   +DGLF  + K++ +    +Y  +    +++D+ V ++   P  +
Sbjct: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSK----EYPDLTLETELIDNSVLKVVTNPSAY 250

Query: 258 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANP 314
              V V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  ANP
Sbjct: 251 TDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANP 310

Query: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
            A + S+ +ML  +G    A  I  AV S I    + +T DL G +TT    + ++ ++
Sbjct: 311 TALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  177 bits (450), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 192/353 (54%), Gaps = 27/353 (7%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+  I GDG+G E+  A K I      K  + ++  D+      F N    +P    + +
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIF--AAAKAPIQWESCDVSP---LFINGLTTIPQPAQDSI 91

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIV 143
            ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K+V+G  T    VD+V++
Sbjct: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLI 148

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  Y  IE   + P     V ++ K I++ A+ R+   A + A  R   R    + 
Sbjct: 149 RENTEGEYSGIEHVVS-PG----VVQSIKLITQDASERVIRYAFEYA--RAVER--PKVV 199

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVV 261
           V HKS +   +DGLF  + + + +    +Y  I+   +++D+ V    R+P  +   VVV
Sbjct: 200 VVHKSTIQRLADGLFVSVAEQLSK----EYPDIELQTELIDNTVLHTVRDPTKYSDVVVV 255

Query: 262 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRS 320
            PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 321 TALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
           + +ML  +G  E A  I KAV + I    + +T DLGG ++T    + ++S++
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  177 bits (450), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 129/359 (35%), Positives = 188/359 (52%), Gaps = 39/359 (10%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79
           T+  I GDGIG E+  + K+I           F   ++   WE+      F N    +PD
Sbjct: 38  TVSFIEGDGIGPEISKSVKKI-----------FNAANVPIEWESCDVNPIFVNGLTTIPD 86

Query: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137
             V+ +  +   AL G + +P  K  G+ S  + LRK  GLFANVRP K+VEG  T    
Sbjct: 87  AAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143

Query: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197
           VD+V++RENTE  Y  IE     P     V ++ K I+  A+ R+   A + A    ++ 
Sbjct: 144 VDLVLIRENTEGEYSGIEHIVC-PG----VVQSIKLITRDASERVIRYAFEYA----RAI 194

Query: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257
           G   + V HKS +   +DGLF  + K++ +    +Y  I    +++D+ V ++   P  +
Sbjct: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSK----EYPDIILETELIDNSVLKVVTNPSAY 250

Query: 258 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANP 314
              V V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  ANP
Sbjct: 251 TNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANP 310

Query: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
            A + S+ +ML  +G    A  I  AV S I    + +T DL G +TT    + ++ ++
Sbjct: 311 TALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  177 bits (448), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 177/353 (50%), Gaps = 31/353 (8%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPD---ETV 82
           T+ LIPGDG+GKEV  +   I E      D           WET   TG    +   + V
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFEAENVPID-----------WETINITGVDSEEGVQKAV 79

Query: 83  EVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDR--PVDM 140
           E L+R+  G L G   +P  +  G+ S  VA RK + +FANV   K V G   +   +D+
Sbjct: 80  ESLKRNKIG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDL 137

Query: 141 VIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHA 200
           V++RENTE  Y  +E     P     V E+ K I++  + RIA  A D AL+        
Sbjct: 138 VVIRENTEGEYSGLEHESV-PG----VVESLKIITKAKSERIARFAFDFALKN----NRK 188

Query: 201 TLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVV 260
           ++   HK+N++   DGLFR    +V  S   +Y +I     IVD+   +   +P  FDV+
Sbjct: 189 SVCAVHKANIMKLGDGLFRNTVNEVGAS---EYPEIDVKNIIVDNASMQAVAKPHQFDVL 245

Query: 261 VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIATIR 319
           V PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI G+ +ANP A I 
Sbjct: 246 VTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMIL 305

Query: 320 STALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
           S+ LML  LG    A  I KA    I E +  T D+GG S+T +    ++ K+
Sbjct: 306 SSTLMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTTEFTKSVIDKL 358

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 130/359 (36%), Positives = 188/359 (52%), Gaps = 39/359 (10%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79
           T+  I GDG+G E+  A K I                    WET      F N    +P 
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFAAAKAPIQ-----------WETCDVTPLFINGLTTIPQ 85

Query: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137
              + + ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K+++G  T    
Sbjct: 86  PAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDN 142

Query: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197
           VD+V++RENTE  Y  IE      A G  V ++ K I++ A+ R+   A + A  R   R
Sbjct: 143 VDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA--RAVER 195

Query: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257
               + V HKS +   +DGLF  + + + +    +Y  I+   +++D+ V    R+P  +
Sbjct: 196 --PKVLVVHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKY 249

Query: 258 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANP 314
              VVV PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP
Sbjct: 250 SDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANP 309

Query: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372
            A + S+ +ML  +G  E A  I KAV S I    + +T DL G ++T    + ++S++
Sbjct: 310 TALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  176 bits (447), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 193/358 (53%), Gaps = 27/358 (7%)

Query: 21  AQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDE 80
           A    T+  I GDG+G E+  + K+I      K  +++   D+      F N    +P+ 
Sbjct: 32  ATGKFTVPFIEGDGVGPEISESVKKIFSAA--KVPIEWVPCDV---GPIFVNGQTTIPEP 86

Query: 81  TVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPV 138
            VE++ +    AL G + +P  K  G+ S  + LRK   LFANVRP +++    +    V
Sbjct: 87  AVELINKHLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENV 143

Query: 139 DMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRG 198
           D+V++RENTE  Y  IE   T P     V ++ K I+  AT R+    +  A +  Q+ G
Sbjct: 144 DLVLIRENTEGEYSGIEHVIT-PG----VIQSIKLITREATERV----VRYAFEYTQAIG 194

Query: 199 HATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD 258
              L V HKS +   +DGLF ++ +++      +Y  I+   +I+D  +  +  +PE + 
Sbjct: 195 RPRLLVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPELYS 250

Query: 259 --VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPI 315
             V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP 
Sbjct: 251 DAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPT 310

Query: 316 ATIRSTALMLEFLGYPEAAQPIYKAVDSNIRE-NQIKTPDLGGKSTTQQVVDDILSKI 372
           A + S+ +ML+ +G  E A  I  AV + I   ++ +T DL G ++T    ++++ ++
Sbjct: 311 ALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  176 bits (446), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 191/353 (54%), Gaps = 27/353 (7%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+  I GDG+G E+  + K I      K  ++++  D+      F N    +PD  V+ +
Sbjct: 37  TVPFIEGDGVGPEISKSVKDIF--AAAKVPIEWEPCDV---GPIFVNGLTTIPDAAVQSI 91

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIV 143
            +    AL G + +P  K  G+ S  + LRK   LFANVRP ++V    T  + VD+V++
Sbjct: 92  NKHLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLI 148

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  Y  IE   + P     V ++ K I++ A+ R+    +  A +  ++ G   L 
Sbjct: 149 RENTEGEYSGIEHVIS-PG----VIQSIKLITKDASERV----IRYAFEYTRAIGRPRLV 199

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVV 261
           V HKS +   +DGLF  + K++      +Y  I+   +++D+ +  +   PE +   V V
Sbjct: 200 VVHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPESYTDAVSV 255

Query: 262 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRS 320
            PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 321 TALMLEFLGYPEAAQPIYKAVDSNIRE-NQIKTPDLGGKSTTQQVVDDILSKI 372
           + +ML  +G  E A  I  A+ S I   ++ +T DL G +TT    + +++K+
Sbjct: 316 SVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  176 bits (445), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 130/355 (36%), Positives = 181/355 (50%), Gaps = 35/355 (9%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDE----- 80
           T+ LIPGDG+GKEV  +   I E      D           WET + +G  L +E     
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFESENVPID-----------WETVEISG--LDNEEGVQK 76

Query: 81  TVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRP--V 138
            V+ L+R+  G L G   +P+ +  G+ S  VALRK + +FANV   K V G   R   V
Sbjct: 77  AVDSLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNV 134

Query: 139 DMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRG 198
           D+V++RENTE  Y  +E     P     V E+ K +++  + RI   A D AL+      
Sbjct: 135 DLVVIRENTEGEYSGLEHESV-PG----VVESLKIMTKAKSDRIGRFAFDFALKN----N 185

Query: 199 HATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD 258
             ++   HK+N++   DGLFR  C  + E    +Y +I+    IVD+   +   +P  FD
Sbjct: 186 RKSVCAVHKANIMKLGDGLFRN-C--INEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFD 242

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIAT 317
           V+V PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI G+ +ANP A 
Sbjct: 243 VLVTPNLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAM 302

Query: 318 IRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
           I S+ALML  LG    A  I KA    I E +  T D+GG ++T      I+ K+
Sbjct: 303 ILSSALMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  174 bits (440), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 183/352 (51%), Gaps = 30/352 (8%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPD--ETVE 83
           T+ L+PGDG+G+E+  +   I E      D           WE  + +G    D    VE
Sbjct: 30  TVTLLPGDGVGREITDSVVSIFEAENLPID-----------WERVELSGLEQEDVHTAVE 78

Query: 84  VLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDR--PVDMV 141
            L+R+  G     +   +   +G++S  VALRK + ++ANV   K+ +G + R   VD+V
Sbjct: 79  SLKRNKIG--LKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLV 136

Query: 142 IVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHAT 201
           I+RENTE  Y  +E   + P     V E+ K ++   T RIA  A D A++        +
Sbjct: 137 IIRENTEGEYSGLEHE-SVPG----VVESLKIMTAQKTERIARFAFDYAMKY----NRKS 187

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVVV 261
           +T  HK+N++   DGLFR +   V E    +Y ++  +  IVD+   +   +P  FDV+V
Sbjct: 188 VTAVHKANIMKLGDGLFRNL---VTEIGAKEYPEVGVSSIIVDNASMQAVAKPHQFDVMV 244

Query: 262 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIATIRS 320
           AP++YG IL +  AAL+G  G+VP AN G +  + EP       DI  + IANP A I S
Sbjct: 245 APSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILS 304

Query: 321 TALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
             LML  LG+   A  I KAV   I E +  T D+GG +TT +  + +++K+
Sbjct: 305 ATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKL 356

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  173 bits (438), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 128/370 (34%), Positives = 188/370 (50%), Gaps = 39/370 (10%)

Query: 15  FSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWE------ 68
           F+    +    T+  I GDG+G E+  + K I           F   ++   W+      
Sbjct: 34  FTGKTNSSGTYTVPFIEGDGVGPEISKSVKDI-----------FSAANVPIQWQPCDVGP 82

Query: 69  TFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVK 128
            F N    +P+  V+ ++     AL G + +P  K  G+ S  + LRK   LFANVRP K
Sbjct: 83  IFVNGLTTIPEPAVKAIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAK 139

Query: 129 AVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIA 186
           +V    +    VD+V++RENTE  Y  IE   T P     V ++ K I+  A+ ++   A
Sbjct: 140 SVPNYKSTYENVDLVLIRENTEGEYSGIEHIVT-PG----VVQSIKLITREASEKVIRYA 194

Query: 187 LDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSM 246
            + A+    + G   L V HKS +    DGLF +I  ++    + +Y  I+   QI+D+ 
Sbjct: 195 YEYAI----AVGRPRLIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILDNT 246

Query: 247 VYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSA 303
           V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSA
Sbjct: 247 VLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSA 306

Query: 304 PDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQ 362
           PDIAG+  ANP A + S+ +ML  +G  E A  I  AV S I    + +T DLGG +TT 
Sbjct: 307 PDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTS 366

Query: 363 QVVDDILSKI 372
              + ++ K+
Sbjct: 367 SFTECVIKKL 376

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  172 bits (436), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 131/389 (33%), Positives = 198/389 (50%), Gaps = 38/389 (9%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKALT-----------IGLIPGDGIGKEVIPAGKQILEK 49
           M +    R    R FSS + +    T           +  I GDGIG E+  + K I   
Sbjct: 1   MFKSQVCRRAVARMFSSKQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIF-- 58

Query: 50  VGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSS 109
              K  +DF+ + +        N   ++P+E  + +  +   AL G + +P  K  G+ S
Sbjct: 59  AAAKVPVDFESVVVKP---ILVNGVTSIPEEAQKSINTNLV-ALKGPLATPVGK--GHRS 112

Query: 110 PIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRV 167
             + LRK  GLFAN+RP K+VEG  T    V++V++RENTE  Y  IE      A    V
Sbjct: 113 MNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEH-----AIVPGV 167

Query: 168 AEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYE 227
            ++ K I+  A+ R+   A + A    + R    L V HKS +   SDGLF ++ K++  
Sbjct: 168 VQSIKLITREASERVIRFAYEYARAAERPR----LIVVHKSTIQRLSDGLFVDVAKEL-- 221

Query: 228 SNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVV 284
             + ++  I+   +++D+ V     +P  +   V V PNLYGDILSD  + L  GSLG+ 
Sbjct: 222 --QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLT 279

Query: 285 PSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSN 344
           PS N+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I KAV + 
Sbjct: 280 PSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTT 339

Query: 345 IREN-QIKTPDLGGKSTTQQVVDDILSKI 372
           I    + +T DL G ++T    + ++ K+
Sbjct: 340 IAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  170 bits (431), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 183/354 (51%), Gaps = 32/354 (9%)

Query: 25  LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPD---ET 81
           +T+ L+PGDG+GKE+  +   I +      D           WET   +     D     
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAENVPID-----------WETVDISQLDHEDGVNAA 77

Query: 82  VEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDR--PVD 139
           VE L+R+  G L G   +   +V G+ S  VA RK + ++ANV   K++ G   +   VD
Sbjct: 78  VESLKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVD 135

Query: 140 MVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGH 199
           +VI+RENTE  Y  +E     P     V E+ K +++V + RIA  A D A++  +    
Sbjct: 136 LVIIRENTEGEYSGLEHESV-PG----VVESLKIVTKVNSERIAKFAFDFAMRHDRK--- 187

Query: 200 ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDV 259
             +T  HK+N++  SDGLFR     V E+    Y +I+ +  IVD+   +   +P  FDV
Sbjct: 188 -MVTAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDV 242

Query: 260 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIATI 318
           +V P++YG IL +  AAL+G  G+VP  N G E  + EP       DI G+ +ANP A I
Sbjct: 243 MVTPSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMI 302

Query: 319 RSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
            S+ L+L+ LG  + A  I KAV   I+E    T D+GG ++T +    ++ K+
Sbjct: 303 LSSTLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  170 bits (431), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 132/383 (34%), Positives = 194/383 (50%), Gaps = 36/383 (9%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKAL--------TIGLIPGDGIGKEVIPAGKQILEKVGP 52
           MLR +  +    R F+S   A+K L         + LIPGDG+GKEV  +   I E    
Sbjct: 1   MLRSAVGK----RMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFE--AE 54

Query: 53  KFDLDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIV 112
              +D+  +D+ +G +  +    A     V+ L+R+  G L G   +      G  S  V
Sbjct: 55  NLPIDWDRVDI-SGLDHEEGVQAA-----VDSLKRNKIG-LKGIWHTSAADQAGKGSLNV 107

Query: 113 ALRKAMGLFANVRPVKAVEGTNDR--PVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEA 170
           ALRK + ++ANV   K+V G   +   VD+V++RENTE  Y  +E     P     V E+
Sbjct: 108 ALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESV-PG----VVES 162

Query: 171 TKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNK 230
            K ++E  T RIA  A D A +  +   HA +T  HK+N++   DGLFR +   V E   
Sbjct: 163 LKIMTEDKTERIARFAFDFAKKYNR---HA-VTAVHKANIMKLGDGLFRNVVTRVGEQ-- 216

Query: 231 DKYGKIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVG 290
            +Y  ++    IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G
Sbjct: 217 -EYPDVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYG 275

Query: 291 PEIVIGEP-CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQ 349
            E  + EP       DI  + IANP A I S +LML+ LG   +A  I  AV   I E +
Sbjct: 276 REYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEGK 335

Query: 350 IKTPDLGGKSTTQQVVDDILSKI 372
             TPD+GG ++T +    ++ K+
Sbjct: 336 STTPDIGGSASTTEFTQAVIEKL 358

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  170 bits (430), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 123/381 (32%), Positives = 197/381 (51%), Gaps = 34/381 (8%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKA---LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLD 57
           M + S T+ + +     T + +K     T+ L+PGDG+GKE+  +   I           
Sbjct: 1   MFKHSVTKRSLVTLAKETIIPKKYGGRFTVTLLPGDGVGKEITDSVVSI----------- 49

Query: 58  FKFIDLHAGWETFQNTGKALPD---ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVAL 114
           FK  ++   WET   +G    +     V+ L+R+  G L G   +P  +V G+ S  VA 
Sbjct: 50  FKSENVPIDWETVDISGLDHTEGVKAAVDSLKRNKIG-LKGIWHTPADQV-GHGSLNVAF 107

Query: 115 RKAMGLFANVRPVKAVEGTNDR--PVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATK 172
           RK + ++ANV   K++EG   +   VD+V++RENTE  Y  +E     P     V E+ K
Sbjct: 108 RKQLDIYANVAIFKSIEGVKTKIPNVDLVVIRENTEGEYSGLEHESV-PG----VVESLK 162

Query: 173 RISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDK 232
            I++  + RIA  A D A    +     ++T  HK+N++  SDGLFR     + E   ++
Sbjct: 163 IITKSKSERIARFAFDFA----KRNNRKSVTAVHKANIMKLSDGLFRNTVSKIGE---EE 215

Query: 233 YGKIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE 292
           Y +IQ +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+VP  N G +
Sbjct: 216 YPEIQTSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIVGNIGAALIGGPGLVPGVNYGRD 275

Query: 293 IVIGEP-CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIK 351
             + EP       DI G+ +ANP A + S  L+L+ LG  ++A  I  AV   I E +  
Sbjct: 276 YAVFEPGSRHVGLDIKGQNVANPTAMLLSATLLLDHLGLEKSANRIKSAVYDVIAEGKAT 335

Query: 352 TPDLGGKSTTQQVVDDILSKI 372
           T D+GG ++T +    +++K+
Sbjct: 336 TQDIGGSASTTEFTQAVINKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  170 bits (430), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 184/350 (52%), Gaps = 25/350 (7%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+ LIPGDG+GKE+  +   I E       +D++ +D+    +  Q+  +A     VE L
Sbjct: 28  TVTLIPGDGVGKEITDSVVSIFE--AENIPVDWERVDISTS-DNIQDVSQA-----VESL 79

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDR--PVDMVIV 143
           +R+  G     +   +  +  + S  VALRK + +FA+V   K+V G   +   VD+V++
Sbjct: 80  KRNKIG--LKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVVI 137

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  Y  +E     P     V E+ K I++  + RIA  A D A    +     ++ 
Sbjct: 138 RENTEGEYSGLEHESV-PG----VVESLKIITKAKSERIARFAFDFA----KKYNRKSVC 188

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVVVAP 263
             HK+N++   DGLFR     V E   ++Y  IQ +  IVD+   +   +P  FDV+V P
Sbjct: 189 AVHKANIMKMGDGLFRNT---VTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFDVMVTP 245

Query: 264 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIATIRSTA 322
           ++YG I+ +  AAL+G  G+V  A+ G E  + EP       DI G+ +ANP A I S+ 
Sbjct: 246 SMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSST 305

Query: 323 LMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
           LML+ LG  E+A+ I KA    I   Q+ T D+GG ++T +  + I+ ++
Sbjct: 306 LMLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGSASTTEFTEAIIKRL 355

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  167 bits (422), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 127/376 (33%), Positives = 193/376 (51%), Gaps = 28/376 (7%)

Query: 3   RGSATR-LTAMRGFSSTRLAQKA--LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFK 59
           RG AT   T  RGF +    +     T+ LIPGDG+GKEV  +   I         +D++
Sbjct: 9   RGLATVPATGFRGFLNPLPKEYGGRYTVTLIPGDGVGKEVTDSVVSIFN--AENLPIDWE 66

Query: 60  FIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMG 119
            +D+ +G +  +    A     V  L+R+  G     +   +     + S  VALRK + 
Sbjct: 67  RVDI-SGLDHEEGVEAA-----VNSLKRNKIG--LKGIWHTSAGQSDHGSLNVALRKQLD 118

Query: 120 LFANVRPVKAVEGTNDR--PVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEV 177
           ++ANV   K + G   R   VD+VI+RENTE  Y  +E     P     V E+ K I++ 
Sbjct: 119 IYANVAHFKTLPGVKTRIPDVDLVIIRENTEGEYSGLEHESV-PG----VVESLKIITKE 173

Query: 178 ATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQ 237
            + RIA  A D A +R   +    +T  HK+N++   DGLFR     + E+   +Y  I+
Sbjct: 174 KSERIARFAFDFA-KRFDRK---LVTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIK 226

Query: 238 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGE 297
            +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+VP AN G E  + E
Sbjct: 227 VSSIIVDNASMQSVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFE 286

Query: 298 P-CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLG 356
           P       DI G+ +ANP A I S+ L+L+ LG    A+ I  AV   I E ++ T D+G
Sbjct: 287 PGSRHVGLDIKGQNVANPTAMILSSTLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIG 346

Query: 357 GKSTTQQVVDDILSKI 372
           G ++T +  ++I+ K+
Sbjct: 347 GSASTTEFTNEIIKKL 362

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  164 bits (414), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 119/353 (33%), Positives = 183/353 (51%), Gaps = 28/353 (7%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+  I GDG+G E+  + + I +    K  +D+   D+        N    +P   V+ +
Sbjct: 46  TVPFIEGDGVGPEISKSVRTIFKAA--KVPIDWVNCDI---GPLLINGETTIPQTAVDQI 100

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVE--GTNDRPVDMVIV 143
                 AL G + +P    +G+ S  + LRK  GLFANVRP K++    +    VD++++
Sbjct: 101 NNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLIVI 157

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  Y  IE     P     V ++ K I+  A+ ++    +  A +  +S G + L 
Sbjct: 158 RENTEGEYSGIEHEIV-PG----VVQSIKLITRKASEKV----IKYAFEYTRSIGRSNLI 208

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF--DVVV 261
           V HK+ +  + DGLF +  +++     DKY  +    +++D+ V      PE +   V V
Sbjct: 209 VVHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEKYADSVSV 264

Query: 262 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRS 320
            PNLYGDILSD  + L  GSLG+ PSAN+G E V+ E  HGSAPDIAG+  ANP A + S
Sbjct: 265 CPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALLLS 323

Query: 321 TALMLEFLGYPEAAQPIYKAVDSNIRE-NQIKTPDLGGKSTTQQVVDDILSKI 372
           + +ML  +G  + A  I  AV + I    + +T DLGG +TT      ++  +
Sbjct: 324 SVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  162 bits (411), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 186/351 (52%), Gaps = 30/351 (8%)

Query: 25  LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEV 84
             I LIPG+GIGKEV  + + I +       +D++ +++ +  +  +          V+ 
Sbjct: 23  FQITLIPGNGIGKEVTDSVRSIFQ--AENLPIDWEIVNIESHRDGIKTA--------VDS 72

Query: 85  LRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDR--PVDMVI 142
           ++R+ + AL G   S    ++G  S  VALRK + +FANV   K+ +  N R   VD+V+
Sbjct: 73  IKRN-KIALKGIWSS--DPIDG--SLNVALRKQLDIFANVAIFKSFDNVNTRIPNVDLVV 127

Query: 143 VRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATL 202
           +RENTE  +  +E    D      V E+ K +++  T RIA  A D A  +  +R H  +
Sbjct: 128 IRENTEGEFSGLEHESVDG-----VVESLKIVTKPKTERIARFAFDFA--KKHNRNH--V 178

Query: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVVVA 262
           T  HK+N++   DGLF+ I   +     ++Y +I+ +  IVD+   +   +P  FDV+V+
Sbjct: 179 TAVHKANIMKLGDGLFKNIVAHI---GNNEYPEIKNSSIIVDNASMQAVAKPHQFDVLVS 235

Query: 263 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIATIRST 321
           P++YG IL +  AAL+G  G+VP AN G +  + EP       DI G+ +ANP A I S 
Sbjct: 236 PSMYGTILGNIGAALIGGPGLVPGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSA 295

Query: 322 ALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
             ML  LG    A+ I  AV   I +    T D+GG ++T +  D +++++
Sbjct: 296 TWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDIGGTASTTEFTDAVINEL 346

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  162 bits (409), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 121/379 (31%), Positives = 196/379 (51%), Gaps = 28/379 (7%)

Query: 1   MLRGSATRLTAMRGFSSTRLAQKAL----TIGLIPGDGIGKEVIPAGKQILEKVGPKFDL 56
           M R S T+ T     ++ ++  K      T+ LIPGDG+GKEV  +   I +       +
Sbjct: 1   MFRHSLTKRTLATVATTEKMLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFK--AENVPV 58

Query: 57  DFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRK 116
           D+  +D+ +G +  ++   A     VE L+R+  G L G   +      G+ S  VALRK
Sbjct: 59  DWDRVDI-SGVDRAEDVKSA-----VESLKRNRIG-LKGIWHTSPADQAGHGSLNVALRK 111

Query: 117 AMGLFANVRPVKAVEGTNDR--PVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRI 174
            + ++ANV   K++ G   +   VD+V++RENTE  +  +E     P     V E+ K +
Sbjct: 112 ELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESV-PG----VVESLKIM 166

Query: 175 SEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG 234
           ++    RIA  A D A    +      +   HK+N++   DGLF+ + ++V E    +Y 
Sbjct: 167 TQDNIERIARFAFDYA----KKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEK---EYP 219

Query: 235 KIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIV 294
           ++Q    IVD+   +    P  FDV+V P++YG IL +  AAL+G  G+V  AN G ++ 
Sbjct: 220 ELQVGNIIVDNASMQTVANPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGRDVA 279

Query: 295 IGEP-CHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTP 353
           + EP       DI G+ +ANP A I S+ L+L  LG   +A  I KAV + I E +  T 
Sbjct: 280 LFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEGKSVTR 339

Query: 354 DLGGKSTTQQVVDDILSKI 372
           D+GG ++T +  + +++K+
Sbjct: 340 DIGGTASTTEFTEAVINKL 358

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 178/350 (50%), Gaps = 24/350 (6%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           T+ L+PGDG+GKE   +   +         +D++ +++ +G +  +    A     V+ L
Sbjct: 28  TVTLLPGDGVGKECTDSVVSVFN--AENIPIDWEIVNI-SGLDHKEGVAAA-----VQSL 79

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDR--PVDMVIV 143
           RR+  G L G   +      G+ S  VA RK + ++ANV   K+++G       VD+V++
Sbjct: 80  RRNKIG-LKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDLVVI 138

Query: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203
           RENTE  +  +E    +      V E+ K  +   T RIA  A + A    Q  G   + 
Sbjct: 139 RENTEGEFSGLEHESVEG-----VVESLKVTTLPKTERIARFAFNYA----QKNGRKAVC 189

Query: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVVVAP 263
             HK+N++   DGLFR     + E    +Y  I+ +  IVD+   +   +P  FDV+V P
Sbjct: 190 AVHKANIMKLGDGLFRNTVTSIGEK---EYPDIETSSIIVDNASMQAVAKPHQFDVLVTP 246

Query: 264 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANPIATIRSTA 322
           ++YG I+ +  AAL+G  G+V  AN G E  + EP       DI G+ IANP A + S+A
Sbjct: 247 SMYGTIIGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSA 306

Query: 323 LMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
           LML  LG  ++ + I  AV   I E  ++T D+GG +TT +    ++ K+
Sbjct: 307 LMLNHLGLTKSGKRISDAVREVIAEGDVRTKDIGGDATTTEFTQAVIEKL 356

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  143 bits (361), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 151/296 (51%), Gaps = 31/296 (10%)

Query: 25  LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETF---QNTGKALPDET 81
            T+ LIPGDG+GKEV  + K I E      D           WET    Q   K   +E 
Sbjct: 29  FTVTLIPGDGVGKEVTDSVKTIFEAENIPID-----------WETINIKQTDHKEGVNEA 77

Query: 82  VEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDR--PVD 139
           VE LRR+  G L G   +P  +  G+ S  VALRK + ++ANV   K+++G   R   +D
Sbjct: 78  VESLRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 140 MVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGH 199
           ++++RENTE  +  +E     P     V E+ K +++  T RIA  A D A    +    
Sbjct: 136 LIVIRENTEGEFSGLEHESV-PG----VVESLKIMTKPKTERIARFAFDFA----KKYNR 186

Query: 200 ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDV 259
             +T  HK+N++   DGLFR I   + E  + +Y  I  +  IVD+   +   +P  FDV
Sbjct: 187 KAVTAVHKANIMKLGDGLFRNI---ITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFDV 243

Query: 260 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGRGIANP 314
           +V P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ +ANP
Sbjct: 244 LVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  145 bits (365), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 116/376 (30%), Positives = 195/376 (51%), Gaps = 52/376 (13%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKV-----GPKFDLDFKFIDLHAGWETFQNTGKALPDE 80
            I ++PGD +G+E++    ++L+ V     G KF+  +  I    G +    TG  LPDE
Sbjct: 6   NIVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLI----GGDAIDKTGDPLPDE 61

Query: 81  TVEVLRRDCQGALFGAVQSP---TTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRP 137
           T+E  ++     L GAV  P   T KV      ++ +RK +GL+ N+RP K +   +D+ 
Sbjct: 62  TLEAAKQ-SDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFI---SDKL 116

Query: 138 V-------------DMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIAT 184
           +             D V+VRE    +Y   E+   D   G+ VA  +++ S    +RI  
Sbjct: 117 IGLSPLKEEVCKGTDFVVVRELVGGIYFG-ERQEDD---GSGVAWDSEKYSIEEVKRITK 172

Query: 185 IALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVD 244
           +A   A   LQ+     +    K+NVL+ S      + +   +    ++  ++   Q++D
Sbjct: 173 MA---AFLSLQNDPPLPIWSLDKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLID 224

Query: 245 SMVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGE 297
           S    + + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + E
Sbjct: 225 SAAMMLVKNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYE 284

Query: 298 PCHGSAPDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLG 356
           PCHGSAPD+A RG  NP+ATI S A+ML+  L   +  + I +AV S + +  I+T DLG
Sbjct: 285 PCHGSAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAV-SVVLDRGIRTADLG 342

Query: 357 GKSTTQQVVDDILSKI 372
           G STT ++ D +  ++
Sbjct: 343 GNSTTSELGDAVAQEL 358

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  144 bits (362), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 191/364 (52%), Gaps = 41/364 (11%)

Query: 29  LIPGDGIGKEVIPAGKQILEKVG---PKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           ++PGD IG+EVI    ++L  +    P  + +F++  +  G      TG  L D+T+E  
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLI--GGAAINATGAPLSDKTIEAA 66

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPV----KAVEGTND-RP 137
           +      L GAV  P     G   P   ++A+RK +GL+AN+RP     K++ G +  +P
Sbjct: 67  KA-ADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKP 124

Query: 138 -----VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQ 192
                 D VI+RE    +Y   E+   D   G  VA  +++ +     RI  +   +ALQ
Sbjct: 125 EIAQGTDFVILRELVGGIYFG-ERKEDD---GDGVAWDSEKYTVSEVERITRMGAFLALQ 180

Query: 193 RLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFR 252
                    L    K+NVL+ S  L+R   + V E+ K ++ ++    Q++DS    M +
Sbjct: 181 H---DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIK 233

Query: 253 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE------IVIGEPCHGSAPD 305
            P  F+ +V+  N++GDI+SD A+ + GSLG++PSA++  E        + EPCHGSAPD
Sbjct: 234 NPRKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPD 293

Query: 306 IAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQV 364
           +  +G ANPIA I S A+ML+  L   +  + I  AV   I E+ I+T DLGG +TT +V
Sbjct: 294 LE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQVI-ESGIRTGDLGGNNTTTEV 351

Query: 365 VDDI 368
            D +
Sbjct: 352 GDAV 355

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  141 bits (356), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 191/364 (52%), Gaps = 37/364 (10%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGPKF-DLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           I ++PGD IG+EV+    ++L  V     D+ F F     G      TG ALPDE +   
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGA- 65

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPVK-----AVEGTNDRP 137
            ++    L GAV  P  +  G   P   ++ LR+ +G++AN+RP        +E +  RP
Sbjct: 66  AKEADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSPLRP 124

Query: 138 -----VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQ 192
                 D+++VRE     Y    + + D   G  VA  T + +    +RIA +A  +ALQ
Sbjct: 125 EIARDTDIMVVRELLGGSYFG--ERHEDEGDG--VAWDTDKYTVKEVQRIARMAGFLALQ 180

Query: 193 RLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFR 252
                   +L    K+NVL+ S  L+R+  ++ ++S   ++  +Q   Q++DS    + +
Sbjct: 181 HDPPLPVWSLD---KANVLASSR-LWRKTVEETFQS---EFPNVQLQHQLIDSAAMILVK 233

Query: 253 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 305
            P  F+ VVV  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPD 293

Query: 306 IAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQV 364
           +   G ANPI  I S A+ML+  L    A + + +AV   + ++ ++T DL G S+T +V
Sbjct: 294 LPA-GKANPIGCILSAAMMLKLSLNMVAAGEAVEQAV-QEVLDSGVRTGDLLGSSSTSEV 351

Query: 365 VDDI 368
            D I
Sbjct: 352 GDAI 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  139 bits (350), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 112/368 (30%), Positives = 189/368 (51%), Gaps = 37/368 (10%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGP-KFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           I ++PGD +G+E+     ++L+ +   + D++F F +   G      TG  LPDE +E  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRP----------VKAVEG 132
           ++     L GAV  P     G   P   ++ +RK + L+AN+RP          +  ++ 
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 133 TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQ 192
              +  D V+VRE    +Y    K       G  VA  +++ +    +RI  +A   A  
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKE----DDGDGVAWDSEQYTVPEVQRITRMA---AFM 177

Query: 193 RLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFR 252
            LQ      +    K+NVL+ S  L+R   K V E+ K+++  ++   Q++DS    + +
Sbjct: 178 ALQHEPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 253 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 305
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 306 IAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQV 364
           +    + NPIATI S A+ML+  L  PE  + I  AV   + +  I+T DLGG ++T +V
Sbjct: 294 LPKNKV-NPIATILSAAMMLKLSLNLPEEGKAIEDAV-KKVLDAGIRTGDLGGSNSTTEV 351

Query: 365 VDDILSKI 372
            D +  ++
Sbjct: 352 GDAVAKEV 359

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  139 bits (349), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 188/365 (51%), Gaps = 37/365 (10%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGP-KFDLDFKFIDLHAGWETFQNTGKALPDETVEV 84
            I ++PGD +GKEV     ++L  +   + ++ F F     G      TG  LPDE +E 
Sbjct: 4   NIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEA 63

Query: 85  LRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRP----------VKAVE 131
            ++     L GAV  P     G   P   ++ +RK +GL+AN+RP          +  ++
Sbjct: 64  SKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSPLK 121

Query: 132 GTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIAL 191
               +  D V+VRE    +Y    K       G  VA  +++ S    +RI  +A  +AL
Sbjct: 122 PEYAKGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAFLAL 177

Query: 192 QRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMF 251
           Q+       +L    K+NVL+ S  L+R   K V E+ K ++ ++    Q++DS    + 
Sbjct: 178 QQNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMILV 230

Query: 252 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P   + VV+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 231 KSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAP 290

Query: 305 DIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQ 363
           D+    + NPIATI S A+ML+  L   E  + + +AV  N+ +  ++T DLGG ++T +
Sbjct: 291 DLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAV-RNVLDAGVRTGDLGGSNSTTE 348

Query: 364 VVDDI 368
           V D I
Sbjct: 349 VGDAI 353

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  138 bits (347), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 115/364 (31%), Positives = 189/364 (51%), Gaps = 37/364 (10%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGP-KFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           I ++PGD +G+E+     ++L+ +   +  + F+F     G      TG+ LPD ++E  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRP----------VKAVEG 132
           ++     L GAV  P     G   P   ++ +RK + L+AN+RP          +  ++ 
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 133 TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQ 192
            + R  D V+VRE    +Y    K       G  VA  +++ S    +RI  +A  +ALQ
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 193 RLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFR 252
                   +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    M +
Sbjct: 181 HNPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVK 233

Query: 253 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 305
            P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 306 IAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQV 364
           +  +G  NPIATI S A+MLE  L   E    + +AV   + ++ I+T DL G ++TQ+V
Sbjct: 294 LE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAV-RRVLDSGIRTGDLRGSNSTQEV 351

Query: 365 VDDI 368
            D +
Sbjct: 352 GDAV 355

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  139 bits (349), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 121/380 (31%), Positives = 194/380 (51%), Gaps = 47/380 (12%)

Query: 16  SSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGP-KFDLDFKFIDLHAGWETFQNTG 74
           S+T +AQ    I ++PGD +G+E+     ++L  +   + +++F F     G      TG
Sbjct: 79  STTAMAQTTKHIVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATG 138

Query: 75  KALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPV---- 127
             LPDE +E  ++     L GAV  P     G   P   ++ +RK + L+AN+RP     
Sbjct: 139 VPLPDEALEASKK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFAS 196

Query: 128 -----------KAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISE 176
                      + V+GT     D+ IVRE    +Y    K       G  VA  +++ S 
Sbjct: 197 DSLLDLSPLKPEIVKGT-----DICIVRELVGGIYFGERKE----DEGDGVAWDSEKYSV 247

Query: 177 VATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKI 236
              +RI  +A  +ALQ        +L    K+NVL+ S  L+R   K V E+ K+++  +
Sbjct: 248 SEVQRITRMAGFLALQHNPPLPVWSLD---KANVLASSR-LWR---KTVEETIKNEFPTL 300

Query: 237 QYNEQIVDSMVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE- 292
               Q++DS    + + P   + VV+A N++GDI+SD A+ + GSLG++PSA++   P+ 
Sbjct: 301 TVQHQLIDSAAMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDT 360

Query: 293 ---IVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIREN 348
                + EPCHGSAPD+  +G  NP+ATI S A+ML+  L   E    + KAV   + ++
Sbjct: 361 NTAFGLYEPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAV-KQVLDS 418

Query: 349 QIKTPDLGGKSTTQQVVDDI 368
            ++T DL G ++T +V D I
Sbjct: 419 GVRTADLRGSNSTSEVGDAI 438

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  136 bits (343), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 114/365 (31%), Positives = 188/365 (51%), Gaps = 37/365 (10%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGP-KFDLDFKFIDLHAGWETFQNTGKALPDETVEV 84
            I ++PGD +G+E+     ++L+ +   + +  F F     G      TG  LPDE +E 
Sbjct: 4   NIVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEA 63

Query: 85  LRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRP----------VKAVE 131
            ++     L GAV  P     G   P   ++ +RK + L+AN+RP          +  ++
Sbjct: 64  SKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSPLK 121

Query: 132 GTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIAL 191
               +  D V+VRE    +Y    K       G  VA  +++ S    +RI  +A  +AL
Sbjct: 122 AQYAQGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEQYSVPEVQRITRMAAFLAL 177

Query: 192 QRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMF 251
           Q        +L    K+NVL+ S  L+R   K V ++ K+++  +  N Q++DS    + 
Sbjct: 178 QHNPPLPIWSL---DKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMILV 230

Query: 252 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 231 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 290

Query: 305 DIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQ 363
           D+A +G  NP+ATI S A+ML+  L   E    I KAV   + ++ I+T DLGG ++T +
Sbjct: 291 DLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAV-KKVLDDGIRTGDLGGSNSTSE 348

Query: 364 VVDDI 368
           V D +
Sbjct: 349 VGDAV 353

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  136 bits (343), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 114/368 (30%), Positives = 189/368 (51%), Gaps = 37/368 (10%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGP-KFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           I ++PGD +G+E+     ++L+ +   + ++ F F +   G      TG  LPDE +E  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPVK-AVEGTND------ 135
           ++     L GAV  P     G   P   ++ +RK + L+AN+RP   A E   D      
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 136 ---RPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQ 192
              +  D V+VRE    +Y   E+   D   G  VA   ++ +    +RI  +A   A  
Sbjct: 125 QFAKGTDFVVVRELVGGIYFG-ERKEDD---GDGVAWDCEQYTVPEVQRITRMA---AFM 177

Query: 193 RLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFR 252
            LQ      +    K+NVL+ S  L+R   K V E+ K+++  ++   Q++DS    + +
Sbjct: 178 ALQHEPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 253 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 305
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 306 IAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQV 364
           +    + NP+ATI S A+ML+  L  PE  + I  AV   + +  I+T DLGG ++T +V
Sbjct: 294 LPKNKV-NPVATILSAAMMLKLSLNLPEEGKAIEDAV-KRVLDAGIRTGDLGGSNSTTEV 351

Query: 365 VDDILSKI 372
            D +  ++
Sbjct: 352 GDAVAKEV 359

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  136 bits (342), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 111/368 (30%), Positives = 188/368 (51%), Gaps = 37/368 (10%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGP-KFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85
           I ++PGD +G+E+     ++L+ +   + ++ F F +   G      TG  LPDE +E  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 86  RRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRP----------VKAVEG 132
           ++     L GAV  P     G   P   ++ +RK + L+AN+RP          +  ++ 
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 133 TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQ 192
              +  D V+VRE    +Y    K       G  VA  +++ +    +RI  +A   A  
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKE----DDGDGVAWDSEQYTVPEVQRITRMA---AFM 177

Query: 193 RLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFR 252
            LQ      +    K+NVL+ S  L+R   K V E+ K+++  ++   Q++DS    + +
Sbjct: 178 ALQHEPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 253 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 305
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 306 IAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQV 364
           +    + NPIATI S A+ML+  L  PE  + I  AV   + +  I+T DLGG ++T +V
Sbjct: 294 LPKNKV-NPIATILSAAMMLKLSLNLPEEGKAIEDAV-KKVLDAGIRTGDLGGSNSTTEV 351

Query: 365 VDDILSKI 372
            D +  ++
Sbjct: 352 GDAVAEEV 359

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  134 bits (338), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/368 (31%), Positives = 189/368 (51%), Gaps = 45/368 (12%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGP-----KFDLDFKFIDLHAGWETFQNTGKALPDET 81
           I ++PGD +G+E+     ++L+ +        FD  +  I    G      TG  LPDE 
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLI----GGAAIDATGVPLPDEA 61

Query: 82  VEVLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPV----KAVEGTN 134
           +E   ++    L GAV  P     G   P   ++ +RK +GL+AN+RP     +++ G +
Sbjct: 62  LEA-SKNSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLS 119

Query: 135 D-RP-----VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALD 188
             RP      D ++VRE    +Y    K       G  VA  +++ S    +RI  +A  
Sbjct: 120 PLRPEIAKGTDFMVVRELVGGIYFGKRKE----DEGDGVAWDSEQYSVPEVQRITRMAAF 175

Query: 189 IALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVY 248
           +ALQ        +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS   
Sbjct: 176 LALQHNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAM 228

Query: 249 RMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHG 301
            + + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHG
Sbjct: 229 ILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHG 288

Query: 302 SAPDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           SAPD+  +G  NPIATI S A+ML+  L   +    I +AV   + +  I+T DLGG ++
Sbjct: 289 SAPDLP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAV-KKVLDAGIRTGDLGGSNS 346

Query: 361 TQQVVDDI 368
           T +V D I
Sbjct: 347 TTEVGDAI 354

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  134 bits (337), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 117/362 (32%), Positives = 189/362 (52%), Gaps = 41/362 (11%)

Query: 27  IGLIPGDGIGKEVIPAGKQILE---KVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVE 83
           I ++PGD +G+E+     ++L+   +V P+   +F++  +  G      TG+ LPD ++E
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLI--GGAAIDATGEPLPDASLE 64

Query: 84  VLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPVK-AVEGTND---- 135
             ++     L GAV  P     G   P   ++ +RK + L+AN+RP   A E   D    
Sbjct: 65  AAKK-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPL 122

Query: 136 -----RPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIA 190
                R  D V+VRE    +Y    K      TG  VA  +++ S    +RI  +A  +A
Sbjct: 123 KPECARGTDFVVVRELVGGIYFGERKE----DTGDGVAWDSEQYSVPEVQRITRMAAFLA 178

Query: 191 LQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRM 250
           LQ        +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    +
Sbjct: 179 LQHSPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIL 231

Query: 251 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSA 303
            + P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSA
Sbjct: 232 VKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSA 291

Query: 304 PDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQ 362
           PD+  +G  NPIATI S A+ML+  L   E    + +AV   + ++ ++T DL G STT 
Sbjct: 292 PDLP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAV-RKVLDSGVRTADLKGTSTTS 349

Query: 363 QV 364
           +V
Sbjct: 350 EV 351

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  133 bits (335), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 187/362 (51%), Gaps = 41/362 (11%)

Query: 27  IGLIPGDGIGKEVIPAGKQILE---KVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVE 83
           I + PGD IG E++    ++L+   +V P  ++ FK+     G      TG+ L DE ++
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSP--NVSFKYNYQLIGGAAIDATGEPLTDEALQ 64

Query: 84  VLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPVKAVEGT--NDRPV 138
           V  ++    L GAV  P     G   P   ++ +RK +G++AN+RP + V  T  +  P+
Sbjct: 65  V-AKNSDAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPL 122

Query: 139 --------DMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIA 190
                   D VIVRE    +Y    +   D      VA   +  S    +RI  +A  +A
Sbjct: 123 KREIVQGTDFVIVRELVGGIYFGERQEAGDDG----VAWDKESYSVPEIQRITRMAAFLA 178

Query: 191 LQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRM 250
           LQ        +L    K+NVL+ S  L+R   K V E+ K+++  +  N  ++DS    +
Sbjct: 179 LQHNPPLPVWSL---DKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDSAAMTL 231

Query: 251 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSA 303
            + P   + VV+  N++GDI+SD A+ + GSLG++PSA++   P+    + + EPCHGSA
Sbjct: 232 VQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSA 291

Query: 304 PDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQ 362
           PD+     ANPIATI S A+M +  L   +    I +AV   I +  IKT DLGGK+TT 
Sbjct: 292 PDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDLGGKNTTT 349

Query: 363 QV 364
           +V
Sbjct: 350 EV 351

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  133 bits (334), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 186/366 (50%), Gaps = 38/366 (10%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGP--KFDLDFKFIDLHAGWETFQNTGKALPDETVE 83
           TI ++PGD +G+E+     ++L  +       ++FKF     G      TG  LPDE +E
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 84  VLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPVK-AVEGTND---- 135
             ++     L GAV  P     G   P   ++ +RK + L+AN+RP   A +   D    
Sbjct: 66  ASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 136 -----RPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIA 190
                R  D V+VRE    +Y    K       G  VA  +++ S    +RI  +A   A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMA---A 176

Query: 191 LQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRM 250
              LQ      +    K+NVL+ S  L+R   K V E+ K+++ ++    Q++DS    +
Sbjct: 177 FMALQHNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMIL 232

Query: 251 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSA 303
            + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 304 PDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQ 362
           PD+  +G  NP+ATI S A+ML+  L   E  + I +AV   + ++ I+T DL G ++T 
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAV-KKVLDSGIRTADLKGTNSTT 350

Query: 363 QVVDDI 368
           +V D +
Sbjct: 351 EVGDAV 356

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  131 bits (329), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 112/372 (30%), Positives = 186/372 (50%), Gaps = 45/372 (12%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGP-----KFDLDFKFIDLHAGWETFQNTGKALPDET 81
           I ++PGD +G+E+     ++L+ +       KFD ++  I    G      TG  L DE 
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLI----GGAAIDATGVPLTDEA 62

Query: 82  VEVLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRP----------VK 128
           +E  ++     L GAV  P     G   P   ++ +RK + L+AN+RP          + 
Sbjct: 63  LEASKK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELS 120

Query: 129 AVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALD 188
            ++    R  D V+VRE    +Y    K       G  VA  +++ +    +RI  +A  
Sbjct: 121 PIKPQFARGTDFVVVRELVGGIYFGKRKE----DDGDGVAWDSEQYTVPEVQRITRMA-- 174

Query: 189 IALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVY 248
            A   LQ +    +    K+NVL+ S  L+R   K V E+ K+++  ++   Q++DS   
Sbjct: 175 -AFMALQHQPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAM 229

Query: 249 RMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHG 301
            + + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHG
Sbjct: 230 ILVKNPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHG 289

Query: 302 SAPDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           SAPD+    + NPIATI S A+ML+  L      Q I  AV   + +  I+T DLGG ++
Sbjct: 290 SAPDLPKNKV-NPIATILSAAMMLKLSLNMTAEGQAIEDAV-KKVLDAGIRTGDLGGSNS 347

Query: 361 TQQVVDDILSKI 372
           T +V D +  ++
Sbjct: 348 TIEVGDAVAKEV 359

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  127 bits (320), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 113/365 (30%), Positives = 184/365 (50%), Gaps = 38/365 (10%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGPKFD--LDFKFIDLHAGWETFQNTGKALPDETVEV 84
           I ++PGD +G+E++    ++LE V       + F+F     G  +   TG  LPDE ++ 
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 85  LRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPVKAVEGTN------- 134
             ++    L GAV  P     G   P   ++ +RK + L+AN+RP   V  +        
Sbjct: 66  -AKNSDAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 135 ---DRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIAL 191
               +  D  +VRE    +Y    K   D   G+        I EV  +RI  +A  +AL
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGSAWDCEKYTIPEV--QRITRMAAFLAL 179

Query: 192 QRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMF 251
           Q        +L    K+NVL+ S  L+R   K V E+ K+++  ++   Q++DS    + 
Sbjct: 180 QHDPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILV 232

Query: 252 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 304
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 305 DIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQ 363
           D+  +G  NPIATI S A+ML+  L   +    I +AV   + +  I+T DL G ++T +
Sbjct: 293 DLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAV-KQVLDAGIRTADLKGSNSTSE 350

Query: 364 VVDDI 368
           V D +
Sbjct: 351 VGDAV 355

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  127 bits (318), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 191/369 (51%), Gaps = 45/369 (12%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILE---KVGP--KFDLDFKFIDLHAGWETFQNTGKALPDE 80
            I ++PGD  G+E+     ++LE   +V P  KF+     I    G      TG  LPD+
Sbjct: 4   NIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLI----GGAAIDATGSPLPDD 59

Query: 81  TVEVLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRP----------V 127
            +   ++     L GAV  P     G   P   ++ +RK + L+AN+RP          +
Sbjct: 60  ALAAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDL 117

Query: 128 KAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIAL 187
             ++  + +  D V+VRE    +Y    K       G  VA  +++ ++   +R+  +A 
Sbjct: 118 SPLKPQHAKGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYTKPEVQRLTRMAA 173

Query: 188 DIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMV 247
            +ALQ        +L    K+NVL+ S  L+R   K V E+ K+++ +++ N Q++DS  
Sbjct: 174 FLALQHNPPLPIWSLD---KANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAA 226

Query: 248 YRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCH 300
             + + P   + +V+  NL+GDI+SD A+ + GSLG++PSA++   P+      + EPCH
Sbjct: 227 MILVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCH 286

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKS 359
           GSAPD+  +G  NPIA I S A+ML+  L   +  + + KAV   + ++ ++T DLGG +
Sbjct: 287 GSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAV-KQVLDSGVRTGDLGGSN 344

Query: 360 TTQQVVDDI 368
           +T +V D I
Sbjct: 345 STSEVGDAI 353

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  124 bits (311), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 186/369 (50%), Gaps = 46/369 (12%)

Query: 27  IGLIPGDGIGKEVIPAGKQIL------EKVGPKFDLDFKFIDLHAGWETFQNTGKALPDE 80
           I ++PGD +G E+     ++L      E    KFD  +  I    G       G  L DE
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLI----GGAAIDAAGVPLTDE 62

Query: 81  TVEVLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRPV----KAVEGT 133
            +E  ++     L GAV  P     G   P   ++ +RK +GL+AN+RP     + + G 
Sbjct: 63  ALEASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGL 120

Query: 134 ND-RP-----VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIAL 187
           +  RP      D ++VRE    +Y   E+   D   G  VA  +++ S     RI  +A 
Sbjct: 121 SPLRPEIAKGTDFMVVRELVGGIYFG-ERKEDD---GDGVAWDSEKYSVPEVERITRMAA 176

Query: 188 DIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMV 247
            +ALQ        +L    K+NVL+ S  L+R   K V  + K+++  +    Q++DS  
Sbjct: 177 FLALQHNPPLPIWSL---DKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAA 229

Query: 248 YRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCH 300
             + + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCH
Sbjct: 230 MILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCH 289

Query: 301 GSAPDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKS 359
           GSAPD+    + NP+ATI S A+ML+  L   +  + + +AV   + +  ++T DLGG +
Sbjct: 290 GSAPDLPKNKV-NPVATILSAAMMLKLSLNMVKEGEAVEEAV-RRVLDAGVRTGDLGGSN 347

Query: 360 TTQQVVDDI 368
           +TQ+V D I
Sbjct: 348 STQEVGDAI 356

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  124 bits (310), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 112/372 (30%), Positives = 188/372 (50%), Gaps = 45/372 (12%)

Query: 27  IGLIPGDGIGKEVIPAGKQILEKVGP-----KFDLDFKFIDLHAGWETFQNTGKALPDET 81
           I ++PGD +G+E+     ++L+ +       KFD  +  I    G      TG  LPDE 
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLI----GGAAIDATGVPLPDEA 62

Query: 82  VEVLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRP----------VK 128
           ++  ++     L GAV  P     G   P   ++ +RK + L+AN+RP          + 
Sbjct: 63  LDAAKKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLS 120

Query: 129 AVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALD 188
            ++    +  D V+VRE    +Y    K       G  VA  +++ S    +RI  +A  
Sbjct: 121 PLKPEYAKGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAF 176

Query: 189 IALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVY 248
           +ALQ+       +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS   
Sbjct: 177 LALQQNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAM 229

Query: 249 RMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHG 301
            + + P   + +V+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHG
Sbjct: 230 ILVKSPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHG 289

Query: 302 SAPDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360
           SAPD+    + NPIATI S A+ML+  L   E    + +AV   + +  I+T DL G+++
Sbjct: 290 SAPDLPKNKV-NPIATILSAAMMLKLSLNLVEEGNAVEEAV-RRVLDAGIRTADLRGENS 347

Query: 361 TQQVVDDILSKI 372
           T +V D ++  +
Sbjct: 348 TSEVGDAVVKAV 359

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  117 bits (292), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 109/372 (29%), Positives = 180/372 (48%), Gaps = 50/372 (13%)

Query: 26  TIGLIPGDGIGKEVIPAGKQILEKVGP------KFDLDFKFIDLHAGWETFQNTGKALPD 79
            I ++PGD +G EV     +IL+ +        KF+ ++  I    G      TG  LPD
Sbjct: 6   NIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLI----GGAAIDATGNPLPD 61

Query: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSP---IVALRKAMGLFANVRP---------- 126
           E++E  +R     L GAV  P     G   P   ++ +RK + L+AN+RP          
Sbjct: 62  ESLEASKR-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLD 119

Query: 127 VKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIA 186
           +  ++    +  D  +VRE    +Y    K       G  VA  +++ S    +RI  +A
Sbjct: 120 LSPLKEKYAKGTDFTVVRELVGGIYFGKRKE----DDGDGVAWDSEQYSVPEVQRITRMA 175

Query: 187 LDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSM 246
             +A+Q        +L    K+NVL+ S  L+R   K V E+ ++++  ++ + Q++DS 
Sbjct: 176 AFLAMQHNPPLPIWSL---DKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSA 228

Query: 247 VYRMFREPECFD-VVVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPEIVIGE 297
              + + P   + +++  N++GDI+SD A+ + G        SL  +P  N      + E
Sbjct: 229 AMILVKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLYE 286

Query: 298 PCHGSAPDIAGRGIANPIATIRSTALMLEF-LGYPEAAQPIYKAVDSNIRENQIKTPDLG 356
           PCHGSAPD+  +G  NPI TI S A+ML+  L   E    + +AV   + +N I+T DLG
Sbjct: 287 PCHGSAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAV-RRVLDNNIRTADLG 344

Query: 357 GKSTTQQVVDDI 368
           G ++T  + D +
Sbjct: 345 GSNSTSDIGDAV 356

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 122/271 (45%), Gaps = 31/271 (11%)

Query: 104 VEGYSSPIVALRKAMGLFANVRPVKAVEGTND-RPVDMVIVRENTEDLYIKIEKTYTDPA 162
           V G+  PI+  R A G       V A+EG  + R V      +  +DL +++   Y  P 
Sbjct: 121 VPGWQRPIIIGRHAFGDQYKATDV-AIEGAGELRLVFRSRDGDQAKDLDLQV---YEFPE 176

Query: 163 TGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREIC 222
           +G  VA A    +E + R  A  + ++ALQR        L  T K+ +L + DG F++  
Sbjct: 177 SGG-VALAMYNTTE-SIRGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEF 229

Query: 223 KDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVG 279
           + +YE+  ++++ +  I Y  +++D MV +M +    F V+   N  GD+ SD  A   G
Sbjct: 230 EAMYEAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFG 288

Query: 280 SLGVVPSANVGPE--IVIGEPCHGS----------APDIAGRGIANPIATIRSTALMLEF 327
           SLG++ S  V P+      E  HG+            + +   IA+  A  R        
Sbjct: 289 SLGLMTSVLVTPDGRAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRL 348

Query: 328 LGYPEA---AQPIYKAVDSNIRENQIKTPDL 355
            G PE    A+ +  A  + + E+ I T DL
Sbjct: 349 DGTPEVEGFARALETATVATVNEDGIMTKDL 379

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 113/270 (41%), Gaps = 29/270 (10%)

Query: 104 VEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPAT 163
           V G+  PI+  R A G        +A +   ++   + +V    +    KI + +    T
Sbjct: 129 VPGWQKPIIIGRHAHG-----DQYRATDAIIEKAGKLELVHRPADGSEPKILQVHEFKGT 183

Query: 164 GTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICK 223
           G R        ++ + R  A  +  +AL +        L ++ K+ +L Q DG F++I +
Sbjct: 184 GARGVALAMYNTDESIRGFAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFKDIFQ 238

Query: 224 DVYESNKDKYGK---IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 280
           +VY        +   I Y  +++D MV +M +    F V+   N  GD+LSD  A   GS
Sbjct: 239 EVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFGS 297

Query: 281 LGVVPSANVGPE--IVIGEPCHGS----------APDIAGRGIANPIATIRSTALMLEFL 328
           LG++ S  V P+      E  HG+            + +   IA+  A  R      E  
Sbjct: 298 LGLMTSMLVTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKRGELD 357

Query: 329 GYP---EAAQPIYKAVDSNIRENQIKTPDL 355
           G P   E A+ +  A    ++++ I T DL
Sbjct: 358 GTPDVVEFARKLEAATIETVQQHGIMTKDL 387

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 118/270 (43%), Gaps = 32/270 (11%)

Query: 104 VEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPAT 163
           V G+  PIV  R A G        KA +     P  + +V + T+    K  + Y     
Sbjct: 140 VPGWEKPIVIGRHAHG-----DQYKATDLVVPGPGKLELVYKPTDGSETKTLEVYDYKGP 194

Query: 164 GTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICK 223
           G  +A      ++ + R  A  +  +A+ +        L ++ K+ +L + DG F++I +
Sbjct: 195 GIALAMYN---TDESIRGFAHASFKLAITK-----KLNLYLSTKNTILKKYDGRFKDIFQ 246

Query: 224 DVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 280
           ++Y+S  K ++ K  I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 247 EIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGS 305

Query: 281 LGVVPSANVGPE--IVIGEPCHGS----------APDIAGRGIANPIATIRSTALMLEFL 328
           LG++ S  V P+      E  HG+            + +   IA+  A  R  A   E  
Sbjct: 306 LGLMTSVLVTPDGKAFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGELD 365

Query: 329 GYPEA---AQPIYKAVDSNIRENQIKTPDL 355
             PE    A  + K+  + ++E+ I T DL
Sbjct: 366 NTPEVVEFANLLEKSTLNTVQEDGIMTKDL 395

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 94/200 (47%), Gaps = 24/200 (12%)

Query: 175 SEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY 233
           ++ + R  A  +  +ALQ+        L ++ K+ +L + DG F++I ++VY+S  K K+
Sbjct: 197 TDESIRGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKF 251

Query: 234 GK--IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 291
            +  I Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 252 AELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITP 310

Query: 292 E--IVIGEPCHGS----------APDIAGRGIANPIATIRSTALMLEFLGYPEA---AQP 336
           +      E  HG+            + +   IA+  A  R  A   E  G P+    A  
Sbjct: 311 DGKTFESEAAHGTVTRHYRKHQQGEETSTNSIASIFAWTRGLAKRGELDGTPDVVRFANI 370

Query: 337 IYKAVDSNIRENQIKTPDLG 356
           +  A  + ++++ I T DL 
Sbjct: 371 LESATLNTVQQDGIMTKDLA 390

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 83/173 (47%), Gaps = 19/173 (10%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG--KIQYNEQIVDSMVYRMFREPECFD 258
           L ++ K+ +L + DG F+++ ++V++S  KDK+    I+Y  +++D MV +M +    + 
Sbjct: 229 LFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY- 287

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----------APDI 306
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+              
Sbjct: 288 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQT 347

Query: 307 AGRGIANPIATIRSTALMLEFLGYPEA---AQPIYKAVDSNIRENQIKTPDLG 356
           +   IA+  A  R  A   E    P+    AQ + KA    ++E+ I T DL 
Sbjct: 348 STNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKDLA 400

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 93/213 (43%), Gaps = 34/213 (15%)

Query: 104 VEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPAT 163
           V  +  PI+  R A G                +  D+VI  E  +   I   K    PA 
Sbjct: 122 VRHWEKPIIIGRHAFG-------------DQYKATDVVIPEEEGKLKLIFQPKDTNKPAI 168

Query: 164 GTRVAEATKR----ISEVATRR----IATIALDIALQRLQSRGHATLTVTHKSNVLSQSD 215
            T V E        ++   TR+     A  + ++AL+R        L  T K+ VL + D
Sbjct: 169 ATDVFEFDGDGGVALAMYNTRKSIKGFARASFEMALKR-----KMPLFFTTKNTVLKRYD 223

Query: 216 GLFREICKDVYESNK----DKYGKIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILS 271
           G F++I +++YES+     D+ G I Y  +++D MV +M +    F ++   N  GD+ S
Sbjct: 224 GKFKDIFQEMYESDYKVQFDEIG-ILYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQS 281

Query: 272 DGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           D  A   GSLG++ S  V P+      E  HG+
Sbjct: 282 DIVAQGFGSLGLMTSMLVAPDGKTFESEAAHGT 314

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 25/211 (11%)

Query: 164 GTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICK 223
           G  VA A     E + R  A  +  +AL +        L ++ K+ +L + DG F++I +
Sbjct: 187 GAGVALAMYNTDE-SIRGFAHASFKLALNK-----KLNLFLSTKNTILKKYDGRFKDIFQ 240

Query: 224 DVYESN-KDKY--GKIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 280
           +++++  K ++    I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 241 EIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 299

Query: 281 LGVVPSANVGPE--IVIGEPCHGS----------APDIAGRGIANPIATIRSTALMLEFL 328
           LG++ S  V P+      E  HG+            + +   IA+  A  R  A   E  
Sbjct: 300 LGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGELD 359

Query: 329 GYPEA---AQPIYKAVDSNIRENQIKTPDLG 356
           G PE    A  +  A  + ++E+ I T DL 
Sbjct: 360 GTPEVTKFANLLESATLNTVQEDGIMTKDLA 390

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L ++ K+ +L + DG F++I ++VYE+  K K+ K  I Y  +++D MV +M +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKGGF- 283

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 24/192 (12%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY--GKIQY 238
            A  + ++ALQR        L  T K+ +L + DG F++I + +Y +  K+K+    I Y
Sbjct: 194 FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 297 EPCHGS----------APDIAGRGIANPIATIRSTALMLEFLGYPEA---AQPIYKAVDS 343
           E  HG+            + +   IA+  A  R      +  G P+     + + K+   
Sbjct: 308 EAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGIIHRGKVDGTPDVVKFGELLEKSTLD 367

Query: 344 NIRENQIKTPDL 355
            ++E+ I T DL
Sbjct: 368 TVQEDNIMTKDL 379

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 113/280 (40%), Gaps = 49/280 (17%)

Query: 104 VEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEK------- 156
           V G+  PI+  R A G                +  D+VI  E T  L  K +        
Sbjct: 121 VSGWKEPIIIGRHAFG-------------DQYKATDVVIPGEGTLKLVFKSKDGDESKDI 167

Query: 157 ---TYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQ 213
               +  P  G  VA +    +E  T   A  + ++AL+R        L  T K+ +L +
Sbjct: 168 DLDVFEFPKDGG-VAMSMYNTAESITG-FAKSSFELALER-----KMPLYSTTKNTILKK 220

Query: 214 SDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDIL 270
            DG F++I + +YE   K K+    I Y  +++D MV +M +    F ++   N  GD+ 
Sbjct: 221 YDGQFKDIFEGMYEREYKQKFEAVGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQ 279

Query: 271 SDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----------APDIAGRGIANPIATI 318
           SD  A   GSLG++ S  V P+      E  HG+            + +   IA+  A  
Sbjct: 280 SDIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGTVTRHYRLHQQGKETSTNSIASIFAWS 339

Query: 319 RSTALMLEFLGYPEA---AQPIYKAVDSNIRENQIKTPDL 355
           R      +  G P+     Q +  A    ++E+ I T DL
Sbjct: 340 RGIIQRGKLDGTPDVVKFGQLLESATLDTVQEDGIMTKDL 379

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYE----SNKDKYGKIQ 237
            A  + ++AL+R Q      L  T K+ +L + DG F++I + +YE    S  +K G I 
Sbjct: 193 FAKASFELALERKQP-----LYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLG-IW 246

Query: 238 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 295
           Y  +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 247 YEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 305

Query: 296 GEPCHGS 302
            E  HG+
Sbjct: 306 SEAAHGT 312

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 94/198 (47%), Gaps = 28/198 (14%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L ++ K+ +L + DG F++I +++YES+ K ++    I Y  +++D MV +M +    F 
Sbjct: 218 LFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQMIKSKGGF- 276

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----------APDI 306
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+            + 
Sbjct: 277 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYEQGKET 336

Query: 307 AGRGIANPIATIRSTALMLEFLGYPEA---AQPIYKAVDSNIRENQIKTPDLG---GKS- 359
           +   IA+  A  R  A   E    P+    A  +  A  + ++++ I T DL    GK+ 
Sbjct: 337 STNSIASIFAWSRGLAKRGELDSTPDVIKFANLLESATLNTVQQDGIMTKDLALACGKTE 396

Query: 360 -----TTQQVVDDILSKI 372
                TT + +D + +++
Sbjct: 397 RSAYVTTDEFLDAVATRL 414

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L ++ K+ +L + DG F++I ++VYE+  K K+ +  I Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 128/298 (42%), Gaps = 46/298 (15%)

Query: 104 VEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRP--VDMVIVRENTEDLYIKIEKTYTDP 161
           V G+  PI+  R A G        KA +     P  +++V   EN  +   K+ + Y   
Sbjct: 133 VPGWEKPIIIGRHAHG-----DQYKATDAVIPGPGKLELVYKPENGPE---KVMEVYDYK 184

Query: 162 ATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREI 221
             G  +A      +E + R  A  +  +AL +        L ++ K+ +L + DG F++I
Sbjct: 185 GPGVALAMYN---TEESIRGFAHASFKLALTK-----KLNLYLSTKNTILKKYDGRFKDI 236

Query: 222 CKDVYESNKDKY---GKIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALV 278
            +++Y++   K      I Y  +++D MV +M +    F ++   N  GD+ SD  A   
Sbjct: 237 FQELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 295

Query: 279 GSLGVVPSANVGPE--IVIGEPCHGS----------APDIAGRGIANPIATIRSTALMLE 326
           GSLG++ S  V P+      E  HG+            + +   IA+  A  R  A   E
Sbjct: 296 GSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGLAKRGE 355

Query: 327 FLGYPEA---AQPIYKAVDSNIRENQIKTPDL---GGKS------TTQQVVDDILSKI 372
               P+    A  +  A  + ++++ I T DL   GG +      TT + +D + +++
Sbjct: 356 LDNTPQVVRFANILEAATLNTVQQDGIMTKDLALAGGNTDRSAYVTTNEFLDAVEARL 413

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 97/218 (44%), Gaps = 33/218 (15%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG--KIQY 238
            A  + ++AL+R        L  T K+ +L + DG F++I + +Y S+ +DK+    I Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMYASDYQDKFEVIGIWY 246

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMSSVLVTPDGKTFES 305

Query: 297 EPCHGS----------APDIAGRGIANPIATIRSTALMLEFLGYPEA---AQPIYKAVDS 343
           E  HG+            + +   IA+  A  R      +    PE     Q +  A  +
Sbjct: 306 EAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGIIQRGKIDETPEVVKFGQLLEDATTN 365

Query: 344 NIRENQIKTPDL---------GGKSTTQQVVDDILSKI 372
            ++E+ I T DL         G   TT++ +D +  ++
Sbjct: 366 TVQEDGIMTKDLALILGKTDRGSYVTTEEFIDAVEKRL 403

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 91/204 (44%), Gaps = 19/204 (9%)

Query: 104 VEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPAT 163
           +  +  PI+  R A   F +    K +   N   + +V   E  ED+   ++  +  P  
Sbjct: 124 IPNWEKPIIIGRHA---FGDQYMAKDIVVPNKGKLKIVFENEVGEDI---VKDVFQFPEN 177

Query: 164 GTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICK 223
           G  VA      ++ A    A  +  +AL+R        L  T K+ +L + DG F+ + +
Sbjct: 178 GG-VAMMMYNTTD-AIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFE 230

Query: 224 DVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 280
           D+YE   K ++    I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 231 DMYEREYKQQFEDLGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGS 289

Query: 281 LGVVPSANVGPE--IVIGEPCHGS 302
           LG++ S  V P+      E  HG+
Sbjct: 290 LGLMTSVLVAPDGKTFESEAAHGT 313

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGK--IQY 238
            A  + ++A++R        L  T K+ +L + DG F++I + +Y E  K K+ +  I Y
Sbjct: 193 FARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISY 247

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  I   
Sbjct: 248 EHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFES 306

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 307 EAAHGT 312

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 100/218 (45%), Gaps = 33/218 (15%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGK--IQY 238
            A  + ++A++R        L  T K+ +L + DG F+++ + +Y ES K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 297 EPCHGS----------APDIAGRGIANPIATIRSTALMLEFLGYPEA---AQPIYKAVDS 343
           E  HG+            + +   IA+  A  R      +    P+     Q +  A  +
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 344 NIRENQIKTPDLG---GKS------TTQQVVDDILSKI 372
            ++E+ I T DL    GK+      TT++ +D + S++
Sbjct: 366 TVQEDGIMTKDLALILGKTERSAYVTTEEFIDAVESRL 403

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L  T K+ +L + DG +++I  D+YE + KDK+    I Y  +++D MV +M +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           V+   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 6/107 (5%)

Query: 201 TLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECF 257
            L ++ K+ +L + DG F++I + +YE++ K K+ +  I Y  +++D MV +M +    F
Sbjct: 223 NLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKGGF 282

Query: 258 DVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
            ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 -IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 91/210 (43%), Gaps = 36/210 (17%)

Query: 107 YSSPIVALRKAMGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTD------ 160
           +S PIV  R A G                +  DMV+  E    L  K +    D      
Sbjct: 124 WSKPIVIGRHAFG-------------DQYKASDMVVKGEGDLKLVFKSKNGDNDSELDVF 170

Query: 161 --PATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLF 218
             P TG  VA A    SE +    A  + ++ALQR        L  T K+ +L + DG F
Sbjct: 171 HFPPTGG-VALAMYNTSE-SIAGFARASFELALQR-----RMPLYSTTKNTILKKYDGKF 223

Query: 219 REICKDVY----ESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGA 274
           +++ + +Y    +S  ++ G I Y  +++D MV +M +    F ++   N  GD+ SD  
Sbjct: 224 KDVFEAMYAAEYQSRFEELG-IWYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIV 281

Query: 275 AALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           A   GSLG++ S  V P+      E  HG+
Sbjct: 282 AQGFGSLGLMTSVLVTPDGKTFESEAAHGT 311

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L  T K+ +L + DG+F++I + +YE   K+K+ +  I Y  +++D MV +M +    + 
Sbjct: 210 LYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWYEHRLIDDMVAQMLKSSGGY- 268

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 269 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 314

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L  T K+ +L Q DG F++I K VYE+  K+ + +  I Y  +++D MV +M +    F 
Sbjct: 205 LYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWYEHRLIDDMVAQMLKSKGGF- 263

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           ++   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 264 IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFESEAAHGT 309

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYG--KIQY 238
            A  + + AL+R        L  T K+ +L Q DG F++I +++Y +  +DK+    I Y
Sbjct: 198 FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWY 252

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 253 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFES 311

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 312 EAAHGT 317

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 19/172 (11%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L ++ K+ +L + DG F+++ ++++++  K ++ +  IQY  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQYQHRLIDDMVAQMIKSKGGF- 282

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDI---AGRG--- 310
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+         RG   
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRKYQRGEET 342

Query: 311 IANPIATI----RSTALMLEFLGYPEA---AQPIYKAVDSNIRENQIKTPDL 355
             NPIA+I    R  A   E  G P+    A  +  A  + ++E+   T DL
Sbjct: 343 STNPIASIFAWTRGIAKRGELDGTPDVVRFANILESATLNTVQEDGKMTKDL 394

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L  T K+ +L + DG F++I  ++Y    KD++ K  I Y  +++D MV +M +    F 
Sbjct: 211 LYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQMLKSKGGF- 269

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 270 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGT 315

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 95/205 (46%), Gaps = 17/205 (8%)

Query: 104 VEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRPVDMVIV-RENTEDLYIKIEKTYTDPA 162
           V  +  PI+  R A G   +      +E   ++ + ++I  + + ED   KI   ++ P 
Sbjct: 121 VSNWEKPIIIGRHAYG---DQYKATDLEIPPNKDIKLLIQDKADKEDS--KIINVFSFPN 175

Query: 163 TGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREIC 222
            GT         +  + +  A  +  +AL+R        L +  K+ +L + DG F+ I 
Sbjct: 176 DGTGGIAMVMYNTVDSIKGFAKASFIMALKR-----KLPLFLATKNTILKKYDGRFKSIF 230

Query: 223 KDVYESN-KDKYGKI--QYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVG 279
            D+Y++  K+K+ K+   Y  +++D MV +M +    F ++   N  GD+ SD  A   G
Sbjct: 231 DDMYQNEFKEKFEKLGLTYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFG 289

Query: 280 SLGVVPSANVGPE--IVIGEPCHGS 302
           SLG++ S  + P+      E  HG+
Sbjct: 290 SLGLMTSQLITPDGKTFQSEAAHGT 314

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L ++ K+ +L + DG F++I +++YE+  K K+ +  I Y  +++D MV +M +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF- 283

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 106/236 (44%), Gaps = 34/236 (14%)

Query: 164 GTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICK 223
           G+ VA A     E + R  A  +  +AL +        L ++ K+ +L + DG F++I +
Sbjct: 190 GSGVALAMYNTDE-SIRGFAHSSFKLALTK-----KLNLFLSTKNTILKKYDGRFKDIFQ 243

Query: 224 DVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 280
           ++++   K K+    I Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 244 EIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 302

Query: 281 LGVVPSANVGPE--IVIGEPCHGS----------APDIAGRGIANPIATIRSTALMLEFL 328
           LG++ S  V P+      E  HG+            + +   IA+  A  R  A   E  
Sbjct: 303 LGLMTSILVTPDGKTFESEAAHGTVTRHYRKFQKGEETSTNSIASIFAWSRGLAKRGELD 362

Query: 329 GYPEA---AQPIYKAVDSNIRENQIKTPDLG---GKS------TTQQVVDDILSKI 372
           G P+    A  +  A  + ++++ I T DL    GK+      TT + +D +  ++
Sbjct: 363 GTPDVVRFANLLEAATLNTVQQDGIMTKDLALAQGKTDRSSYVTTDEFIDAVEKRL 418

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L ++ K+ +L + DG F++I + VYE+  K K+    I Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQY 238
            A  + ++AL+R      AT     K+ +L + DGLF++I + +Y+ + K K+ +  I +
Sbjct: 195 FAKSSFELALKRKLPLFFAT-----KNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITF 249

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+  +   
Sbjct: 250 EHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFES 308

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 309 EAAHGT 314

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 99/218 (45%), Gaps = 33/218 (15%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGK--IQY 238
            A  + ++A++R        L  T K+ +L + DG F+++ + +Y  S K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 297 EPCHGS----------APDIAGRGIANPIATIRSTALMLEFLGYPEA---AQPIYKAVDS 343
           E  HG+            + +   IA+  A  R      +    P+     Q +  A  +
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 344 NIRENQIKTPDLG---GKS------TTQQVVDDILSKI 372
            ++E+ I T DL    GKS      TT++ +D + S++
Sbjct: 366 TVQEDGIMTKDLALILGKSERSAYVTTEEFIDAVESRL 403

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 91/199 (45%), Gaps = 24/199 (12%)

Query: 175 SEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY 233
           +E + R  A  +  +AL +        L ++ K+ +L Q DG F+++ +++Y++  K ++
Sbjct: 202 TEESIRGFAHASFRLALAK-----QLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEF 256

Query: 234 GK--IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 291
            +  I Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 257 ERLGIYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 292 E--IVIGEPCHGS----------APDIAGRGIANPIATIRSTALMLEFLGYPEA---AQP 336
           +      E  HG+            + +   IA+  A  R  A   E    P+    A  
Sbjct: 316 DGKTFESEAAHGTVTRHFRQHQAGKETSTNSIASIFAWTRGLAKRGELDNTPDVVNFAHA 375

Query: 337 IYKAVDSNIRENQIKTPDL 355
           +  A  + ++ + I T DL
Sbjct: 376 LEAATTNTVQLDGIMTKDL 394

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 13/127 (10%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICK----DVYESNKDKYGKIQ 237
            A  + ++AL+R        L  T K+ +L + DG F+++ +    D Y+S  ++ G I 
Sbjct: 191 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELG-IW 244

Query: 238 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 295
           Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 245 YEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFE 303

Query: 296 GEPCHGS 302
            E  HG+
Sbjct: 304 SEAAHGT 310

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 19/182 (10%)

Query: 193 RLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYR 249
           RL       L +  K+ +L Q DG F+++ + +Y++  ++ + +  I Y  +++D MV +
Sbjct: 207 RLALSKQLNLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQ 266

Query: 250 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----- 302
           M +    F V+   N  GD+ SD  A   GSLG++ S  + P+      E  HG+     
Sbjct: 267 MIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFESEAAHGTVTRHF 325

Query: 303 -----APDIAGRGIANPIATIRSTALMLEFLGYP---EAAQPIYKAVDSNIRENQIKTPD 354
                  + +   IA+  A  R  A   +  G P   + A  +  A    ++++ I T D
Sbjct: 326 RLHQQGKETSTNSIASIFAWTRGLARRADLDGTPAVADFAHALEGATLRTVQDDAIMTKD 385

Query: 355 LG 356
           L 
Sbjct: 386 LA 387

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 75/152 (49%), Gaps = 13/152 (8%)

Query: 156 KTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSD 215
           K Y  P +G  +A A    ++ + +  A  + ++AL+R        L  T K+ +L   D
Sbjct: 168 KVYEFPKSGG-IAMAMFNTND-SIKGFAKASFELALKR-----KLPLFFTTKNTILKNYD 220

Query: 216 GLFREICKDVYESN-KDKYG--KIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSD 272
             F++I  ++++   K+K+   KI Y  +++D MV +M +    F ++   N  GD+ SD
Sbjct: 221 NQFKQIFDNLFDKEYKEKFQALKITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSD 279

Query: 273 GAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
             A   GSLG++ S  + P+      E  HG+
Sbjct: 280 IVAQGFGSLGLMTSILITPDGKTFESEAAHGT 311

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 103/228 (45%), Gaps = 45/228 (19%)

Query: 178 ATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK- 235
           + R  A  + ++AL+         L  T K+ +L + DG F++  + +YE+  K+++   
Sbjct: 188 SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 236 -IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 292
            I Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 293 IVIGEPCHGS----------APDIAGRGIANPIATIR---------STALMLEFLGYPEA 333
               E  HG+            + +   IA+  A  R          TA +++F      
Sbjct: 302 TFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGIIQRGKLDETADVVKF------ 355

Query: 334 AQPIYKAVDSNIRENQIKTPDLG---GKS------TTQQVVDDILSKI 372
            + + +A    ++E+ I T DL    GK+      TT++ +D + ++I
Sbjct: 356 GELLERATVDTVQEDGIMTKDLALILGKTDRSAYVTTEEFIDAVENRI 403

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 78/173 (45%), Gaps = 19/173 (10%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGK---IQYNEQIVDSMVYRMFREPECFD 258
           L  T K+ +L + DG F+++ + +YES      +   I Y  +++D MV +M +    + 
Sbjct: 210 LYSTTKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY- 268

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----------APDI 306
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+            + 
Sbjct: 269 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKET 328

Query: 307 AGRGIANPIATIRSTALMLEFLGYPEA---AQPIYKAVDSNIRENQIKTPDLG 356
           +   IA+  A  R      +    P+    A+ +  A  + ++E++I T DL 
Sbjct: 329 STNSIASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLA 381

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 78/173 (45%), Gaps = 19/173 (10%)

Query: 201 TLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECF 257
            L +  K+ +L + DG F++I + +Y    K K+ +  I Y  +++D MV +M +    F
Sbjct: 218 NLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITYEHRLIDDMVAQMIKSKGGF 277

Query: 258 DVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----------APD 305
            ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+            +
Sbjct: 278 -IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFESEAAHGTVTRHFRRHQMGEE 336

Query: 306 IAGRGIANPIATIRSTALMLEFLGYPEA---AQPIYKAVDSNIRENQIKTPDL 355
            +   IA+  A  R  A   E  G  +    A  +  A   +++E+ I T DL
Sbjct: 337 TSTNSIASIFAWSRGLAKRGELDGTKDVIAFANKLEAATLDSVQEDGIMTKDL 389

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 81/173 (46%), Gaps = 19/173 (10%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQYNEQIVDSMVYRMFREPECFD 258
           L ++ K+ +L + DG F++I +++Y++  K ++ K  I Y  +++D MV +M +    F 
Sbjct: 218 LYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEKAGIFYEHRLIDDMVAQMVKSKGGF- 276

Query: 259 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP----------DI 306
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+            + 
Sbjct: 277 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHYRQHQQGRET 336

Query: 307 AGRGIANPIATIRSTALMLEFLGYPEA---AQPIYKAVDSNIRENQIKTPDLG 356
           +   IA+  A  R  A   E    PE    A  +  A    ++++ I T DL 
Sbjct: 337 STNSIASIFAWSRGLAKRGELDSTPEVTKFANLLESATLDTVQKDGIMTKDLA 389

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQY 238
            A  + ++A++R        L  T K+ +L + DG F+++ + +Y  N K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQY 238
            A  + ++AL+R        L  T K+ +L   D  F+EI   ++++  K+K+    I Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F +V   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGK--IQY 238
            A  + ++AL+R        L  T K+ +L + DG F+++ + +Y E  K+K+    I Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWY 246

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 65/130 (50%), Gaps = 11/130 (8%)

Query: 178 ATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGK-- 235
           + R  A  + ++A+ +     +  L +  K+ +L + DG F++I +++YE+   K  +  
Sbjct: 203 SIRGFAYSSFNLAVNK-----NMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERL 257

Query: 236 -IQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 292
            I Y  +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S    P+  
Sbjct: 258 NITYEHRLIDDMVAQMIKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGK 316

Query: 293 IVIGEPCHGS 302
               E  HG+
Sbjct: 317 TFESEAAHGT 326

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGK--IQY 238
            A  + ++AL+R        L  T K+ +L   D  F++I   ++ E  ++K+    I+Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYG--KIQY 238
            A  + + AL+R        L  T K+ +L + DG F++I + +Y E  ++K+    I Y
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 317 EAAHGT 322

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGK--IQY 238
            A  + ++AL+R        L  T K+ +L   D  F++I   ++++  K+++    I Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITY 246

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 306 EAAHGT 311

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%), Gaps = 8/107 (7%)

Query: 202 LTVTHKSNVLSQSDGLFREICKDVYESNK----DKYGKIQYNEQIVDSMVYRMFREPECF 257
           L ++ K+ +L   DG F++I +++Y++      + +G I Y  +++D MV +M +    F
Sbjct: 220 LFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHG-IYYEHRLIDDMVAQMIKSKGGF 278

Query: 258 DVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 302
            ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 279 -IMALKNYDGDVQSDIVAQGFGSLGLMTSILATPDGKTFESEAAHGT 324

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 182 IATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGK---IQY 238
            A  +  +AL+R        L  T K+ +L + DG F++I +++YE    +  +   I Y
Sbjct: 200 FALSSFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWY 254

Query: 239 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 296
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 255 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFES 313

Query: 297 EPCHGS 302
           E  HG+
Sbjct: 314 EAAHGT 319

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 30/50 (60%)

Query: 323 LMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372
           LML  LG  E+A  I KAV   I E +  T D+GG S+T    ++I++K+
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.531
           YBR202W
          Length = 830

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 4/96 (4%)

Query: 111 IVALRKAMGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEA 170
           I+ L +A+   A +R V  VE   D    + +VR + E LY    KT  D    TR+   
Sbjct: 695 IIRLAQAL---AKLRLVNRVE-VEDVEEALRLVRVSKESLYQDNTKTREDQNPTTRIYNL 750

Query: 171 TKRISEVATRRIATIALDIALQRLQSRGHATLTVTH 206
            KR+S+       T++ D  ++ ++SRG   L + +
Sbjct: 751 IKRMSQDTLENRGTLSYDTIVKTVRSRGFTMLQLNN 786

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON}
           Anc_3.455 YPR122W
          Length = 1201

 Score = 33.5 bits (75), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 3/83 (3%)

Query: 193 RLQSRGHATLTVT--HKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRM 250
           ++ +  H TL     ++ N++ Q   L+R + KD  E   D  G +Q N Q++D + Y  
Sbjct: 406 KILTTKHTTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLD-IKYLF 464

Query: 251 FREPECFDVVVAPNLYGDILSDG 273
              P    +    N Y + ++DG
Sbjct: 465 KGSPSITQLYSGKNQYSESMTDG 487

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 10/42 (23%), Positives = 24/42 (57%)

Query: 220 EICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVVV 261
           ++C D  E+ KD+Y K++ N+++    +Y ++     +  +V
Sbjct: 39  QVCLDTLEAYKDEYKKLKRNDEVSQEQIYHIYESAYVYYKIV 80

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,073,368
Number of extensions: 1506540
Number of successful extensions: 4468
Number of sequences better than 10.0: 143
Number of HSP's gapped: 4236
Number of HSP's successfully gapped: 147
Length of query: 372
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 261
Effective length of database: 40,753,473
Effective search space: 10636656453
Effective search space used: 10636656453
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)