Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0G02541g5.706ON1295129562100.0
ZYRO0B16412g5.706ON137296427720.0
TDEL0B021405.706ON114793727520.0
Smik_11.3605.706ON118095726500.0
KAFR0H001805.706ON124197026340.0
Suva_11.3335.706ON118796026210.0
Skud_11.3365.706ON118894925710.0
YKR096W5.706ON119595225440.0
KNAG0C066305.706ON1281101125410.0
NCAS0A031705.706ON1319102725260.0
SAKL0E15004g5.706ON119696524800.0
Kwal_55.196785.706ON117896224560.0
Kpol_1043.735.706ON126094623950.0
Suva_9.375.706ON111794423740.0
Smik_9.185.706ON111894223590.0
Skud_9.175.706ON111894123520.0
KLTH0E00968g5.706ON114896123500.0
YIL151C5.706ON111894623330.0
CAGL0H06611g5.706ON1282101523290.0
TPHA0E001905.706ON136198122750.0
AFR290W5.706ON121797222160.0
Ecym_40155.706ON125796621570.0
KLLA0A00528g5.706ON122996721240.0
NDAI0E050705.706ON155636811491e-133
TBLA0E017105.706ON152640310281e-116
TPHA0D046405.706ON9624422034e-15
NDAI0D022405.140ON74849810.78
KAFR0J02990singletonON47173753.9
Kpol_449.5singletonON49966745.5
TDEL0H043407.17ON98995737.6
KLTH0F06754gsingletonON76762737.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G02541g
         (1295 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...  2396   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1072   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1064   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1025   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1019   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  1014   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   994   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   984   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   983   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   977   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   959   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   950   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   927   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   919   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   913   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   910   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   909   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   903   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   901   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   880   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   858   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   835   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   822   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   447   e-133
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   400   e-116
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    83   4e-15
NDAI0D02240 Chr4 (524453..526699) [2247 bp, 748 aa] {ON} Anc_5.140     36   0.78 
KAFR0J02990 Chr10 (571614..573029) [1416 bp, 471 aa] {ON}              33   3.9  
Kpol_449.5 s449 (16801..18300) [1500 bp, 499 aa] {ON} (16801..18...    33   5.5  
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    33   7.6  
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...    33   7.6  

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 2396 bits (6210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1176/1295 (90%), Positives = 1176/1295 (90%)

Query: 1    MPQTFIQQPFGLPDSDTGLSRNNSNSPSARDILLEKNVTNEQRYPRKDGYNYSHXXXXXX 60
            MPQTFIQQPFGLPDSDTGLSRNNSNSPSARDILLEKNVTNEQRYPRKDGYNYSH      
Sbjct: 1    MPQTFIQQPFGLPDSDTGLSRNNSNSPSARDILLEKNVTNEQRYPRKDGYNYSHNISKTN 60

Query: 61   XXXXXXXXXXXLREKFSKIGKDTSRYNRTALHILDXXXXXXXXXXXXXXXXXXRRSSLEG 120
                       LREKFSKIGKDTSRYNRTALHILD                  RRSSLEG
Sbjct: 61   TSINTNTNTTNLREKFSKIGKDTSRYNRTALHILDSLKKNKLLLQGQLQDKSSRRSSLEG 120

Query: 121  ENNFEVYTYQNPIDENKQNGEESASPKLMLSRSTSKVNDLNDSILVQFDDRSKLNSRRSS 180
            ENNFEVYTYQNPIDENKQNGEESASPKLMLSRSTSKVNDLNDSILVQFDDRSKLNSRRSS
Sbjct: 121  ENNFEVYTYQNPIDENKQNGEESASPKLMLSRSTSKVNDLNDSILVQFDDRSKLNSRRSS 180

Query: 181  IFEPANVDMGINNDLASKEIGIDNVTKSISRLANSNDYVVSRSHNEEISQIAGNPRVKKY 240
            IFEPANVDMGINNDLASKEIGIDNVTKSISRLANSNDYVVSRSHNEEISQIAGNPRVKKY
Sbjct: 181  IFEPANVDMGINNDLASKEIGIDNVTKSISRLANSNDYVVSRSHNEEISQIAGNPRVKKY 240

Query: 241  LSKRGALKGDSIDNKADQKLYMYGNGENRIESHTETGHFEQHAFGNCNDVVKGNPDINGY 300
            LSKRGALKGDSIDNKADQKLYMYGNGENRIESHTETGHFEQHAFGNCNDVVKGNPDINGY
Sbjct: 241  LSKRGALKGDSIDNKADQKLYMYGNGENRIESHTETGHFEQHAFGNCNDVVKGNPDINGY 300

Query: 301  ENIDDDDGQYPNEPEDCSNEFXXXXXXXXXXXQRKXXXXXXXXXXXXXXXXXXXXXXXXX 360
            ENIDDDDGQYPNEPEDCSNEF           QRK                         
Sbjct: 301  ENIDDDDGQYPNEPEDCSNEFNNDDTDTTDTNQRKNNEESKDDEEEDEDQGNNSNSNDKA 360

Query: 361  XXXXKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNY 420
                KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNY
Sbjct: 361  NNSNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNY 420

Query: 421  VTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQF 480
            VTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQF
Sbjct: 421  VTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQF 480

Query: 481  ITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXX 540
            ITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQA    
Sbjct: 481  ITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYT 540

Query: 541  XXXXXXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNN 600
                    HMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNN
Sbjct: 541  YGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNN 600

Query: 601  TRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPE 660
            TRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPE
Sbjct: 601  TRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPE 660

Query: 661  NLKYFFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTS 720
            NLKYFFRHAPAFAESHILQTVGFGDSKNPFA                      SSGEPTS
Sbjct: 661  NLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTS 720

Query: 721  NESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVL 780
            NESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVL
Sbjct: 721  NESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVL 780

Query: 781  RKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNV 840
            RKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNV
Sbjct: 781  RKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNV 840

Query: 841  LIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSN 900
            LIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSN
Sbjct: 841  LIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSN 900

Query: 901  TDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITL 960
            TDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITL
Sbjct: 901  TDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITL 960

Query: 961  SHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNIT 1020
            SHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNIT
Sbjct: 961  SHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNIT 1020

Query: 1021 MDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASP 1080
            MDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASP
Sbjct: 1021 MDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASP 1080

Query: 1081 ENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDATSWLRHSAH 1140
            ENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDATSWLRHSAH
Sbjct: 1081 ENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDATSWLRHSAH 1140

Query: 1141 IYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDGKVIPLRFTG 1200
            IYKLASNSFLVFSICLTTFQELRFLRKSKDENVME          QLYSDGKVIPLRFTG
Sbjct: 1141 IYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLYSDGKVIPLRFTG 1200

Query: 1201 NIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDSRFFVLVSDDE 1260
            NIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDSRFFVLVSDDE
Sbjct: 1201 NIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDSRFFVLVSDDE 1260

Query: 1261 NMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
            NMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN
Sbjct: 1261 NMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1072 bits (2772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/964 (55%), Positives = 688/964 (71%), Gaps = 36/964 (3%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            + +QALVQKLQDIYK IV+QE+ELQE+C+QLT+SQTT+L ++W+IY+IN +L+ NYVTF+
Sbjct: 412  RSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFL 471

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            +TALL SQ++ D++IG+EIVE YRI RRLWVYGTITFLD+ KNFS+FMDPEVC QFITHV
Sbjct: 472  TTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHV 531

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FISIS ML DIP KY IPW+QRLGDLSRMAIALYPSGFIDWKLS+E+WY +A        
Sbjct: 532  FISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 591

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNS 604
                HMST+QQNTLEAFVNLGKSVFCQDTFIPS QYMQLVIDNIYQRAF+ER + N RN+
Sbjct: 592  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNT 651

Query: 605  QLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKY 664
            QLIEYLKHSEVMLLP+F+ + +LQ+VV+ YF+ KFG D +++NIF  R +F QNP+ L+Y
Sbjct: 652  QLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRY 711

Query: 665  FFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNESV 724
            FFRHAPAFAESHILQ VGFGD KNPFA                      S+   T   S 
Sbjct: 712  FFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTV-TETSST 770

Query: 725  MSLDNI---STDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLR 781
            M++D++    +D + + + +F N+E+++ PY  P   +IW +SL+Y+N+T+++C ++VL+
Sbjct: 771  MAIDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQ 830

Query: 782  KFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVL 841
            KFL GP VVALPH M WTYFIIS+  K + L  E SR FW  F+ R+ P N+IVSFLNVL
Sbjct: 831  KFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVL 890

Query: 842  IAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNT 901
            IAY LDNS+ S+L+ S+  +  SM L++LL  FNNNE LPEVWKCWGTLWFD I +K  +
Sbjct: 891  IAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQS 950

Query: 902  DTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLS 961
                 E +G+ +H+F D+PIDGI FD+ DE+GE FWKRA RIIFLFK +AE F IGITLS
Sbjct: 951  HVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLS 1010

Query: 962  HTAPVYCRRDDVELNHILGSFSFKIEQ----HLLNGN-----TVQVEIENCLGAIIEMTE 1012
              APVYCRR+DV   HIL SFSFK+ +     L+  N     T  +++++ L   +E+ E
Sbjct: 1011 PVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDH-LKNTLEIFE 1069

Query: 1013 MPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQE- 1071
              +  NI MD  P +S+ E E+IF+Y GY+R+ P+  ++DKNGE  SA+ YTSWY+    
Sbjct: 1070 EASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNT 1129

Query: 1072 ----IVPKSAA---SPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLET 1124
                ++P   +   S  ++V        F +Q +E      F ++     +L    +  T
Sbjct: 1130 NNTGVIPAHGSDVDSQRDAVQSVQEMHIF-NQIMEPGYCGGFADDLFLRDALYQTAHSST 1188

Query: 1125 TSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXX 1184
            T FVLD T+WLRH  HIYKLAS+  L F+ICLTTF ELRFLRK KDENV+E         
Sbjct: 1189 TYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITV 1248

Query: 1185 XQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQ----- 1239
             QLYS+GK++PLRFTGN+ATHIEEHLEFEE+ITWRSHVDEFVIE++ KAQ KF +     
Sbjct: 1249 RQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNQLQ 1308

Query: 1240 ------PFVQNPVDNDS--RFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRL 1291
                         D+ S  +F VLV+DD NM++KA ++++RTF+T+FVF+LC+ +G    
Sbjct: 1309 LEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSK 1368

Query: 1292 ICTN 1295
            ICTN
Sbjct: 1369 ICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1064 bits (2752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/937 (57%), Positives = 653/937 (69%), Gaps = 30/937 (3%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            K +QALVQKLQDIYK IV+QE+ELQE+C+QLT+SQTT+L  +W IY++N +L+ NYVTFI
Sbjct: 235  KSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFI 294

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            +TALL  QS  DL IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC+QFITHV
Sbjct: 295  TTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHV 354

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FISIS MLADIP++Y+IPW QRLGDLSRMAIALYPSGFIDWKLS+E+WY +A        
Sbjct: 355  FISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHG 414

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNS 604
                HMST+QQNTLEAFVNLGKSVFCQDTF PS QYMQLVIDNIYQRAF+ER + N RNS
Sbjct: 415  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNS 474

Query: 605  QLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKY 664
            QLIEYLKHSEVMLLP+F+ + +LQ+VV+ YF  KFG D ++ NIF  R +F QNP+ LKY
Sbjct: 475  QLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKY 534

Query: 665  FFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNESV 724
            FFRHAPAFAESHILQ VGFGD KNPFA                      SS   T   S 
Sbjct: 535  FFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVT-TETSSA 593

Query: 725  MSLDNIS-TDSLIS----SDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIV 779
            M++D     DS  S      Q+F N++S+  PYL PP  ++W  SL YLN+T++ C +IV
Sbjct: 594  MAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIV 653

Query: 780  LRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLN 839
            L+KFL GP VVALPHL+ W YFII+V  K + + D  SR FW   + R+ P N+IV+FLN
Sbjct: 654  LKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLN 713

Query: 840  VLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKS 899
            VLIAY LDN + S  I  + EEL +M L +L+  FNNNE+LPEVWKCWG LWFDAI DK 
Sbjct: 714  VLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKD 773

Query: 900  NTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGIT 959
                +SYE  G+ DH+F D PIDGI FD  DE+G KFWKRA R+IFLFK+IAE F   + 
Sbjct: 774  KVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLV 833

Query: 960  LSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNI 1019
            +S  A V+CRR D  +NH+L SF FK+     N N+V       L   IE+ E  ++ N 
Sbjct: 834  VSSQAQVHCRRTD-PMNHVLKSFCFKLRDTFYNSNSV-------LQNTIEVFEEGSDANK 885

Query: 1020 TMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAAS 1079
             M  TP +S+ ENE+IF Y GYKR+  +L  +D+ GE  S + YTSW            +
Sbjct: 886  DMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW---------GNET 936

Query: 1080 PENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLD-GLNLETTSFVLDATSWLRHS 1138
             +N +  S P +   + + +  I  + T+  E +    +  +N + T FVLDATSWLRH 
Sbjct: 937  SKNEIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRHF 996

Query: 1139 AHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDGKVIPLRF 1198
            AH+YKLASN  L F+ICLTTFQELRFLRKSKDENV+E          QLY++ +++PLRF
Sbjct: 997  AHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRF 1056

Query: 1199 TGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDSRFFVLVSD 1258
            TGN+ATHIEEHLEFEEQITWRSHVDEFV E+I KAQ +  Q       + D    VLV+D
Sbjct: 1057 TGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE------NRDFHHVVLVTD 1110

Query: 1259 DENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
            D NM+RKA +  I T +TRFVFA C+ +G    ICTN
Sbjct: 1111 DANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/957 (53%), Positives = 664/957 (69%), Gaps = 61/957 (6%)

Query: 369  ALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTAL 428
            AL+QKLQ++Y+ IV+QE+ELQE+C+QLT+SQTT+L S+W+IY+IN ELV NYVTFI+TAL
Sbjct: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314

Query: 429  LSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFISI 488
            L SQ  +DL+IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC QFITHVFIS+
Sbjct: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374

Query: 489  STMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXXXXXX 548
            STM++DIP+KYSI W+QRLGDLSRMAIALYPS FIDWKLS+E+WY +A            
Sbjct: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434

Query: 549  HMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLIE 608
            HMST+QQNTLEAFVNLGKSVFCQ+TF PSPQYMQLVIDNIYQRAF+ER + N RNS LIE
Sbjct: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 494

Query: 609  YLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFFRH 668
            YLKHSE MLLP+F+ + +LQ VV++YF  KFG D +  NIF   D+F+QNP+  KYFFRH
Sbjct: 495  YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFKYFFRH 554

Query: 669  APAFAESHILQTVGFGDSKNPFA--------------XXXXXXXXXXXXXXXXXXXXXXS 714
             P+FA+SHILQ VGFG+ KNPFA                                     
Sbjct: 555  GPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTESSTGNSR 614

Query: 715  SGEPTSNESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRY-DIWLKSLSYLNLTAV 773
            +G    +E++ S  ++S   L+   ++F+++++++ P LP     + WL++L +LN+T++
Sbjct: 615  NGNEDDDETMSSTTSMSDPDLLV--EFFNDIDTLRRPILPSMLTNEAWLETLKFLNMTSL 672

Query: 774  QCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNS 833
            +CG+IVLRKFLHGP  VALPH++ W YFIIS+CLKS  L D  S+ FW   ++R+ P ++
Sbjct: 673  KCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDT 732

Query: 834  IVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFD 893
            +V+F+NVLIAY LDN   +++I  +  E   ++L ELL  FN NE+LPE+W CWGTLWFD
Sbjct: 733  MVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGTLWFD 792

Query: 894  AITDKSNTDTNS---YEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKI 950
            AI  K+    +S   +++IG+ D++  DSP DGI+FD KDENGEKFWKRA RIIFLF+++
Sbjct: 793  AICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREV 852

Query: 951  AETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEM 1010
            + +F +G+ + H   V C    ++ N+IL    +K+E   L      V + + L +I ++
Sbjct: 853  SRSFPLGVIVRHDPLVNC--SSLQSNNILRDLVYKLEP--LTNIRSSVPVLSTLESIFDI 908

Query: 1011 TEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQ 1070
            +E  +E+N  + A P +S+   +NIF Y GYK++ P+   FDKNGE  SA+ YTSWY   
Sbjct: 909  SEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWY--- 965

Query: 1071 EIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGL---------- 1120
              VP    + E +++                    + NE EN    L+ +          
Sbjct: 966  --VPNCNNNLETNIS--------------------YANERENEALFLECMKSVHPEIAYP 1003

Query: 1121 --NLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXX 1178
              + +TT FV DATSWLRHSA I+KLA N  L F+ICLTTFQELRFLRKSKDENVME   
Sbjct: 1004 EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAAT 1063

Query: 1179 XXXXXXXQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFL 1238
                   QLY + KV+PLRFTGN+ATHIEE+LEFEEQITWR+HVDEFVIESI KAQ+K  
Sbjct: 1064 RGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1123

Query: 1239 QPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
                 N   +   + VL+SDD+ MK+KA EK+IRT +TRFVF+LC+++G+ R +CT+
Sbjct: 1124 NAKQPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/970 (53%), Positives = 678/970 (69%), Gaps = 46/970 (4%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            K ++ L++KLQ+IYK IV+QE+ELQ++C+QLT+SQTT+L ++WSIY++N +L+ NY+TFI
Sbjct: 279  KTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFI 338

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            +TALL SQS  D+ IG+EIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVCSQFITHV
Sbjct: 339  TTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 398

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FIS+STML D+P K+SIPW+QRLGDLSRMAIALYPSGFIDWKLS+E+WY +A        
Sbjct: 399  FISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 458

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSN-NTRN 603
                HMST+QQNTLEAFVNLGKSVFCQDTF PS QYMQLVIDNIYQR F++R  N N RN
Sbjct: 459  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRN 518

Query: 604  SQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLK 663
            S LI+YLKHSEVMLLP+F+ NE+LQ+VV+ YF  +FG D +D NIF+ +D+F Q P +L+
Sbjct: 519  SDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLR 578

Query: 664  YFFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNES 723
            ++FRHAPAFAESHILQ VGFG+ KNPFA                      SS E     S
Sbjct: 579  FYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEI----S 634

Query: 724  VMSLDN-------ISTDSLISSD----QYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTA 772
             MS+D        ++T + ++      +YF N++S++ P +  P   +WLKSL +LN+T+
Sbjct: 635  TMSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLP-IDHPNILVWLKSLEHLNMTS 693

Query: 773  VQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLN 832
            ++C VIVLRKFL GP ++ALPH++ WTYFII+  LK+++  +  S  FW+  MRR+LP N
Sbjct: 694  LKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWN 753

Query: 833  SIVSFLNVLIAYALDNSYYSTLISSISEELDSMD-LQELLTKFNNNEELPEVWKCWGTLW 891
            ++ SFLNVL+AY LDN Y +  I+ + E   + +   ELL  FN NE LPE+WKCWGTLW
Sbjct: 754  TLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLW 813

Query: 892  FDAITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIA 951
            FD I++K   + +++  +G+ DH+F D P+DGI FD  DE GE FW RALRI+FLFK IA
Sbjct: 814  FDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIA 873

Query: 952  ETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMT 1011
            E    G+ +S TAPV+CRRDD++ NHIL SFSFK+E    + ++   +  + +  ++ + 
Sbjct: 874  ENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEG--FDESSYSGQPFSTINKLLPLF 931

Query: 1012 EMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSW----- 1066
            E  +E N+  DA P +S+ + ENIFEY GYK++     +FD+NGEL S++ YT+W     
Sbjct: 932  ENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDND 991

Query: 1067 ----------YSAQEIVPKSAASPENSVAGSSPGRSFQS-QDVEENI-FSVFTNEEENS- 1113
                      Y++   + +           +   R+F S +D E++  F ++ N E+ + 
Sbjct: 992  NSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPEKLNK 1051

Query: 1114 --------TSLLDGLNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFL 1165
                    T+  D +N   T FV DATSWLRH AHIYKL++N+ L F++CLTTFQELRFL
Sbjct: 1052 NMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFL 1111

Query: 1166 RKSKDENVMEXXXXXXXXXXQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEF 1225
            RKSKDENV+           QLYS+GK++PLRFTGN+AT IEEHLEFEEQITWRSHVDEF
Sbjct: 1112 RKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEF 1171

Query: 1226 VIESISKAQKKFLQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSE 1285
            VIE++ KAQ KF+       +       VLV+DD NMKRKA E+ I+TFTT F+F++C +
Sbjct: 1172 VIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFSVCRK 1231

Query: 1286 MGKGRLICTN 1295
            +G    +CTN
Sbjct: 1232 LGIQDNVCTN 1241

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 1014 bits (2621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/960 (54%), Positives = 675/960 (70%), Gaps = 64/960 (6%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            K + AL+QKLQ++YK IV+QE+ELQE+C+QLT+SQTT+L S+W+IYRIN ELV NYVTFI
Sbjct: 263  KSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFI 322

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            +TALL SQ Q+DL+IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC QFITHV
Sbjct: 323  TTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 382

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            F+S+STM++DIP+KYSI W+QRLGDLSRMAIALYPS FIDWKLS+E+WY +A        
Sbjct: 383  FVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHG 442

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNS 604
                HMST+QQNTLEAFVNLGKSVFCQ+TF PSPQYMQLVIDNIYQRAF+ER + N RNS
Sbjct: 443  KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNS 502

Query: 605  QLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKY 664
             LIEYLKHSE MLLP+F+ + +LQ VV++YF  KFG D +  NIF P D+F+QNP+  KY
Sbjct: 503  LLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKY 562

Query: 665  FFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSS--------- 715
            FFRHAP+FA+SHILQ VGFG+ KNPFA                      ++         
Sbjct: 563  FFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESST 622

Query: 716  ----GEPTSNESVMSLDNISTDSLISSD---QYFSNLESMQHPYLPPPRY-DIWLKSLSY 767
                 E   N+ +MS    ST S+   D   ++F+++++++ P +      + WL+SL +
Sbjct: 623  SNSRNENDDNDEIMS----STTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKF 678

Query: 768  LNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRR 827
            LN+T+++CG+IVLRKFLHGP  +ALPH + W YFIIS+CLKS  L D  S+ FW   ++R
Sbjct: 679  LNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKR 738

Query: 828  LLPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCW 887
            + P +++V+F+N+LIA  LDN   S +I S+ +E   ++L ELL  F   EELPE+W CW
Sbjct: 739  IFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCW 798

Query: 888  GTLWFDAITDKSNTDTNS---YEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRII 944
            GTLWFD I  K+    +S   +E++G+ D++  DSPIDGI+FD  DENGEKFWKRA R I
Sbjct: 799  GTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTI 858

Query: 945  FLFKKIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCL 1004
            FLF++++ +F IG+ +++ + +   R  ++ N+ILG+ S+K+E     G+++     N L
Sbjct: 859  FLFRELSRSFQIGVIINNESSI--NRSSLQSNNILGNLSYKLEPLSTLGSSIPT--LNTL 914

Query: 1005 GAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYT 1064
              II++ E  +E NI + A P +S+ +  +IF YTGYK++ P    FDKNGE  SA+ YT
Sbjct: 915  EGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYT 974

Query: 1065 SWYSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGL---- 1120
            SWY     VP  + +PE ++  +                     E+EN    L+ L    
Sbjct: 975  SWY-----VPNGSNNPETNINSNC--------------------EKENEGQFLECLKSDD 1009

Query: 1121 ---NLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXX 1177
               +L TT FV DATSWLRHSA I+KLA N  L F+ICLTTFQELRFLRKSKDENVME  
Sbjct: 1010 REIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAA 1069

Query: 1178 XXXXXXXXQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF 1237
                    QLY + KV+PLRFTGN+ATHIEE+LEFEEQITWR+HVDEFVIESI KAQ+K 
Sbjct: 1070 TRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK- 1128

Query: 1238 LQPFVQNPVDNDSRF--FVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
            L+   Q PV +  RF   +L+SDD+ MK+KA EK+I+T +TRFVF+LC+++G+ R +CT+
Sbjct: 1129 LENANQLPV-SSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/949 (52%), Positives = 665/949 (70%), Gaps = 50/949 (5%)

Query: 369  ALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTAL 428
            AL+QKLQ++YK IV+QE+ELQE+C+QLT+SQTT+L S+W+IYRIN EL+ NYVTFI+TAL
Sbjct: 268  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFITTAL 327

Query: 429  LSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFISI 488
            L SQ  +DL+IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC QFITHVF+S+
Sbjct: 328  LPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 387

Query: 489  STMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXXXXXX 548
            STM++DIP+KYSI W+QRLGDLSRMAIALYPS FIDWKLS+E+WY +A            
Sbjct: 388  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 447

Query: 549  HMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLIE 608
            HMST+QQNTLEAFVNLGKSVFCQ+TF PSPQYMQLVIDNIYQRAF+ER + N RNS LIE
Sbjct: 448  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 507

Query: 609  YLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFFRH 668
            YLKHSE MLLP+F+ + +LQ VV++YF  KFG D +  NIF P D+F+QNP+  KYFFRH
Sbjct: 508  YLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRH 567

Query: 669  APAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNES----- 723
            AP+FA+SHILQ VGFG+ KNPFA                      ++    +  S     
Sbjct: 568  APSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSR 627

Query: 724  --------VMSLDNISTDSLISSD---QYFSNLESMQHPYLPPP-RYDIWLKSLSYLNLT 771
                    +MS    ST S+   D   ++F+++++++ P LP     + WL++L +LN+T
Sbjct: 628  NDNNDDDEIMS----STASISDHDFLAEFFNDIDTLRRPILPSMLTSEAWLETLKFLNMT 683

Query: 772  AVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPL 831
            +++CG+IVLRKFLHGP  +ALPH++ W YFII+ CLKS  L D  S+ FW   ++R+ P 
Sbjct: 684  SLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPW 743

Query: 832  NSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLW 891
            ++IV+F+NVLIAY LDN   + +I  +  +  +++L  LL  FN +EELPE+W CWGTLW
Sbjct: 744  DTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLW 803

Query: 892  FDAITDK---SNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFK 948
            FD I  K   S +  +++++IG+ D++  D+P DGI+FD KDE+GEKFWKRA RIIFLF+
Sbjct: 804  FDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFR 863

Query: 949  KIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIE--QHLLNGNTVQVEIENCLGA 1006
            +++ TF IG+ +S+   + C      +  IL +  +K+E   ++ +   +   +EN    
Sbjct: 864  ELSRTFPIGVIVSNDPLIKCSSSQSSI--ILRNLVYKLEPLSNIRSNTPILTALENS--- 918

Query: 1007 IIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSW 1066
             ++++E  ++ NI + A P +S+   +NIF YTGYK++ P+   FD+NGE  SA+ YT W
Sbjct: 919  -VDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRW 977

Query: 1067 YSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTS 1126
            Y     +P           G++   +  + D+E+    +F    E       G++ ETT 
Sbjct: 978  Y-----LPN----------GNNISEALVNSDIEKGDEDLFL---ECMKPDCPGIDFETTY 1019

Query: 1127 FVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQ 1186
            FV DATSWLRHSA I+KLA N  L F+ICLTTFQELRFLRKSKDENVME          Q
Sbjct: 1020 FVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQ 1079

Query: 1187 LYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPV 1246
            LY + KV+PLRFTGN+ATHIEE+LEFEEQITWR+HVDEFVIESI KAQ+K       +  
Sbjct: 1080 LYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVT 1139

Query: 1247 DNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
               S + VL+SDD+ MK+KA EKEI+T +T+FVF+LC+++G+ R +CT+
Sbjct: 1140 PRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  984 bits (2544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/952 (53%), Positives = 668/952 (70%), Gaps = 55/952 (5%)

Query: 369  ALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTAL 428
            AL+QKLQ++YK IV+QE+ELQE+C+QLT+SQTT+L S+W+IY+IN +LV NYVTFI+TAL
Sbjct: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333

Query: 429  LSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFISI 488
            L SQ  +DL+IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC QFITHVF+S+
Sbjct: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393

Query: 489  STMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXXXXXX 548
            STM++DIP+KYSI W+QRLGDLSRMAIALYPS FIDWKLS+E+WY +A            
Sbjct: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453

Query: 549  HMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLIE 608
            HMST+QQNTLEAFVNLGKSVFCQ+TF PSPQYMQLVIDNIYQRAF+ER + N RNS LIE
Sbjct: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 513

Query: 609  YLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFFRH 668
            YLKHSE MLLP+F+ + +LQ VV++YF  KFG D +  NIF   D+F+QNP+  KYFFRH
Sbjct: 514  YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRH 573

Query: 669  APAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNESVMSL- 727
             P+FA+SHILQ VGFG+ KNPFA                      ++    +  S  +  
Sbjct: 574  GPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSR 633

Query: 728  -DNISTDSLISSD----------QYFSNLESMQHPYLPPPRY-DIWLKSLSYLNLTAVQC 775
             DN   D ++SS           ++F+++++++ P LP     + WL++L +LN+T+++C
Sbjct: 634  NDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFLNMTSLKC 693

Query: 776  GVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIV 835
            G+IVLRKFLHGP  +ALPH++ W YFIIS+CLKS  L D  S+ FW   ++R  P +++V
Sbjct: 694  GIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMV 753

Query: 836  SFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAI 895
            +F+NVLI Y LDN   +++I  + ++ D + L ELL  FN  EELPE+  CWGTLWFD I
Sbjct: 754  TFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTLWFDTI 813

Query: 896  TDK---SNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAE 952
             +K   S +  +++++IG+ D++  DSP DGI+FD KDENGEKFWKRA R IFLF++++ 
Sbjct: 814  CEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFRELSR 873

Query: 953  TFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTE 1012
            +F IG+ + +   +Y  R   +  +ILGS  FK+E  L N +   + +   L +II+++E
Sbjct: 874  SFPIGVIIRNDPLIY--RSSFQNTNILGSLVFKLEP-LCNIHN-NIPVLGALESIIDISE 929

Query: 1013 MPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEI 1072
              +E N  + A P +S+ E +NIF Y GYK++  +   FDKNGE  SA+ YT+WY     
Sbjct: 930  ARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWY----- 984

Query: 1073 VPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDG-------LNLETT 1125
            VP S                  + ++E+NI   + +E+EN    L+        ++ +TT
Sbjct: 985  VPNS-----------------NNTNIEDNI--NYNSEKENEGLFLECIKSDYPEIDFKTT 1025

Query: 1126 SFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXX 1185
             FV DATSWLRHSA I+KLA N  L F+ICLTTFQELRFLRKSKDENVME          
Sbjct: 1026 YFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIR 1085

Query: 1186 QLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNP 1245
            QLY + KV+PLRFTGN+ATHIEE+LEFEEQITWR+HVDEFVIES+ KAQ+K        P
Sbjct: 1086 QLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLES--ASEP 1143

Query: 1246 VDNDSRF--FVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
              +  RF   VL+SDD+ MK+KA EKEI+T +TRFVF+LC+++G+ R +CT+
Sbjct: 1144 RLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1011 (50%), Positives = 669/1011 (66%), Gaps = 95/1011 (9%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            K +QALVQKLQDIYK IV+QE+ELQE+C+QLT+SQTT+L ++W+IY+IN +L+ NY TFI
Sbjct: 286  KSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFI 345

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            +TALL SQ   D++IG+EIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVCSQFITHV
Sbjct: 346  TTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 405

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FIS+S +L DIP K++IPW+QRLGDLSRMAIALYPSGFIDWKLS+E+WY +A        
Sbjct: 406  FISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 465

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGS-NNTRN 603
                HMST+QQNTLEAFVNLGKSVFCQDTF PS QYMQLVIDNIYQR F++R +  N RN
Sbjct: 466  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRN 525

Query: 604  SQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLK 663
              LI+YLKHSEVMLLP+F+G+++LQ+VV+ YF+ +FG D  + NIF  +D+F Q P  L+
Sbjct: 526  PDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLR 585

Query: 664  YFFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXS-SGEPTSNE 722
            +FFRHAPAFAESHILQ VGFG+ KNPFA                      S S    S+ 
Sbjct: 586  FFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSST 645

Query: 723  SVMSLDNISTDSL-------------ISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLN 769
            +  ++D+ +TD++             +S  +Y  N+E++++  +  P    W+KSL ++N
Sbjct: 646  APKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYA-IETPDICTWIKSLDFIN 704

Query: 770  LTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLL 829
            +T+++C +IVL+KFLHGP ++ALPH + WT FII+  +K   L +E++  FW   M+R+ 
Sbjct: 705  MTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIF 764

Query: 830  PLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGT 889
            P ++I SFLNVL+AY LDN   +T+I  +  +   MDL ++L  FN +E+LPEVWKCWGT
Sbjct: 765  PWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGT 824

Query: 890  LWFDAITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKK 949
            LW+DAI +K++ D +++   G+ DH+F D PIDGI FD++DE G KFWKRALR+IFLFK 
Sbjct: 825  LWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKG 884

Query: 950  IAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIE 1009
            I++ FD G+ +SH A VYCR +    +  L  F+FK+E +            +     I 
Sbjct: 885  ISKKFDFGLKISHEAGVYCRNEKAA-DSPLRRFTFKLESY-------DEPTSSKFNEFIP 936

Query: 1010 MTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYS- 1068
            + E  + +N    ATP +S+ + ENIFEY GY+ +  +  +FDKNGE+ S++ YTSW   
Sbjct: 937  LCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMID 996

Query: 1069 ------------------------AQEIVPKSAASPENSVAGSS----------PG---- 1090
                                    A    P SA+    S AG +          PG    
Sbjct: 997  TGEAAAAASSATDNNAVSEGQGDLAANGTPISASL---SAAGKTTTSHVTDDQDPGLNEN 1053

Query: 1091 ---RSFQS------QDVEENIFS----VFTNEEENSTSLLDGLNLETTSFVLDATSWLRH 1137
               + F S      ++V  N+ +    +  N  E+S   LD L    T F+ DATSWLRH
Sbjct: 1054 DLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLK---TFFIFDATSWLRH 1110

Query: 1138 SAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDGKVIPLR 1197
             AHIYK+A+N  L F +CLTTFQELRFLRKSKDENV+E          QLY + +++PLR
Sbjct: 1111 FAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLR 1170

Query: 1198 FTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFL------QPFVQN------P 1245
            FTGN+A  IEEHLEFEEQITWRSHVDEFVIE++ KAQ KF       QP  +       P
Sbjct: 1171 FTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVP 1230

Query: 1246 VDNDSRFFV-LVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
            +      +V LV++D+NMKRKA ++ I+TF+T FVF+LCS++G    +CTN
Sbjct: 1231 LGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1027 (50%), Positives = 677/1027 (65%), Gaps = 98/1027 (9%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            K  +ALV+KLQDIYK IV+QE+ELQE+C+QLT+SQTTDL ++W+IY++N++L+ NYVTFI
Sbjct: 295  KTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFI 354

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            +TALLSSQSQ DL IG+EI+E YRI RRLWVYGTITFLDVLKNFS+FMDPEVC QFITHV
Sbjct: 355  TTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 414

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FIS+STMLADIPTKYSIPW+QRLGDLSRMAIALYPSGFIDWKLS+E WY +A        
Sbjct: 415  FISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHG 474

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNS 604
                HMST+QQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF+ER + N RN 
Sbjct: 475  KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNL 534

Query: 605  QLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFG-------------------TDLHD 645
            QLIEYLKHSEVMLLP F+ N  LQ+VV+ YF+ KFG                    +   
Sbjct: 535  QLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRT 594

Query: 646  LNIFQPRDIFLQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFA--------XXXXXX 697
            +++F+ RD+F+QNPE LKYFFRHAPAFAESHILQ VGFGD KNPFA              
Sbjct: 595  IDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERKD 654

Query: 698  XXXXXXXXXXXXXXXXSSGEPTSNESVMSLD----------NISTDSL---ISSDQYFSN 744
                            ++     + S+MS+D          N+ +D++   ++S+++F N
Sbjct: 655  KKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQN 714

Query: 745  LESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIIS 804
            +E ++  Y  P   +IW+ SL+++NL +++C +IVL+KFLHGP ++ALPHL+ W YFIIS
Sbjct: 715  IEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIIS 774

Query: 805  VCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDNSYYST----------- 853
            + LK E L  E+S+ FW   ++ + P N I++FLNVL+ Y LDN    T           
Sbjct: 775  ILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKD 834

Query: 854  ---LISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSYEKIG 910
                I  +  +  +M   +LL  FN NE+LPEVWKCWGTLWFD I++K+  D +S+E +G
Sbjct: 835  MNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLG 894

Query: 911  VSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFD-IGITLSHTAPVYCR 969
            + DH+F D PIDGI +  +DE GE FWKR LRIIFLFK IAE FD +G+ +S+ A    R
Sbjct: 895  IKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYR 954

Query: 970  RDDVELNHILGSFSFK--------IEQHLLNGNTVQV---EIENCLGAIIEMTEMPNEVN 1018
             ++V +++IL  FSFK        ++ +L  G+ +++    I N +   +++ E  +E N
Sbjct: 955  NNNVPMDNILKMFSFKWAGSNADYVDANL--GDELEIYTNTIINRITEFVDIKEPIHETN 1012

Query: 1019 ITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAA 1078
            +  +  P  S+  NE+IF+YTGYK++ P  ++FDKNGE  S + YT+W    + +  +  
Sbjct: 1013 LNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQN 1072

Query: 1079 SPENSVAGSSPGRSFQSQ-DVEENIFSVFTNEE-ENSTSLLDGLNLE-----TTSFVLDA 1131
            +  N+ A       F     ++E  F      E  + ++LL   + E      T FV DA
Sbjct: 1073 NNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFVFDA 1132

Query: 1132 TSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDG 1191
            TSWLRH AHIYKLASN  L F++CLTTFQELRFLRKSKD NV+E          QLYSDG
Sbjct: 1133 TSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDG 1192

Query: 1192 KVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDS- 1250
             ++PLRFTGN+AT IEEHLEFEEQITWRSHVDEFVIE++ KAQ+KF++      ++  S 
Sbjct: 1193 NLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSN 1252

Query: 1251 ----------------------RFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGK 1288
                                  ++ VL++DD++M+ KA  K I TF T+ VF++CS MG 
Sbjct: 1253 WGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGI 1312

Query: 1289 GRLICTN 1295
               +CTN
Sbjct: 1313 DEGVCTN 1319

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/965 (52%), Positives = 657/965 (68%), Gaps = 47/965 (4%)

Query: 367  TQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFIST 426
            +QALVQKLQDIY++IV+QE+ELQE+C+QLT+SQTTD+ ++W IY++N EL+ NY++FI+T
Sbjct: 243  SQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITT 302

Query: 427  ALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFI 486
            ALL SQ + DL+IGQEIVE YR+ RRLWVYGTITFLDVLKNFS+FMDPEVC QFI+HVF+
Sbjct: 303  ALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFM 362

Query: 487  SISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXXXX 546
            SIS ML D+P +YSIPW++RLGDLSRMAIALYPSGFIDWKLS+E+WY+QA          
Sbjct: 363  SISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKL 422

Query: 547  XXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQL 606
              HMST+QQNTLEAFVNLGKSVFCQDTFIPS QYMQLVIDNIYQRAF ER   ++RN  +
Sbjct: 423  YYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPI 482

Query: 607  IEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFF 666
            +EYLKHSEVMLLP+F+ +  LQKVV+T+F+ +FG   ++++ F  + IF+Q+ E L+YFF
Sbjct: 483  VEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFF 542

Query: 667  RHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNESVMS 726
             HAPAFAESHILQ VGFGD +NPFA                      SS    +N     
Sbjct: 543  SHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTN----- 597

Query: 727  LDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHG 786
            LD+ +  S IS D YF N++S + PY  P    IW +SLSYLNLT+++C + VL+KFLH 
Sbjct: 598  LDDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHA 657

Query: 787  PFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYAL 846
            P + ALPHL+ W +F++SV ++  +L  +  + FW  FMRR+ P NS+VSFLN L+A+ L
Sbjct: 658  PLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLL 717

Query: 847  DNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSY 906
            DNS   + +  + EE + MDL  L+  F N+EELPEVWKCWGTLWFD I++KS    +S 
Sbjct: 718  DNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSV 777

Query: 907  EKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPV 966
            +  G+ DHLF D+PIDGI FD  DE+G KFWKRA R+IF+FK +A+ F  GI +S T P+
Sbjct: 778  QSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDT-PI 836

Query: 967  YCRRDDVELNHILGSFSFKIEQHLLN-GNTVQVEIENCLGAIIEMTEMPNEVNITMDATP 1025
              RRD   L H L  FSFK E+      N V ++ +N     I++ E  + +N   +A P
Sbjct: 837  STRRDVTTL-HALKRFSFKFEELPQEWDNEVFLQSDN----FIKVFEPISPINSNFEAVP 891

Query: 1026 PMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKS-----AASP 1080
             +S+ + E+IFE+ GY+R+ P+   F+KNG+L + + YTS    +  +            
Sbjct: 892  SLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHV 951

Query: 1081 ENSV---AGSSP---------------GRSFQSQDVEENIFSVFTNEEENSTSLLDGLNL 1122
            EN V   A +SP                R + +  ++        +       L    + 
Sbjct: 952  ENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADS 1011

Query: 1123 ETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXX 1182
              T FVLDATSWLRH AH+YKLA+N+ L F+ICLTTFQELRFLRKSKDE+V+E       
Sbjct: 1012 NVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVI 1071

Query: 1183 XXXQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF----L 1238
               QLY + K++PLRFTGNIATH+EEHLEFEEQITWRSHVDEFVIE++ K+Q+KF    L
Sbjct: 1072 TARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNL 1131

Query: 1239 QPFVQ-------NPVDNDS-RFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGR 1290
            Q   Q       +P D+D   F VLV+DD NM+ KA   +I  F++RF+FA C+++G  +
Sbjct: 1132 QARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQ 1191

Query: 1291 LICTN 1295
             +C N
Sbjct: 1192 KVCIN 1196

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/962 (52%), Positives = 645/962 (67%), Gaps = 57/962 (5%)

Query: 367  TQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFIST 426
            +QALVQKLQDIY+NIV+QEVELQE+CAQLT+SQTTDL ++W IY+IN+EL+ NYV FI+T
Sbjct: 241  SQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITT 300

Query: 427  ALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFI 486
            ALL SQ + DL+IGQEIV  YRI RRLWV+GTITFLDVLKNFS+FMDPEVC QFITHVFI
Sbjct: 301  ALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFI 360

Query: 487  SISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXXXX 546
            SISTML D+P K+S PW +RLGDLSRMAIALYPSGFIDWKLS+E+WY+QA          
Sbjct: 361  SISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKL 420

Query: 547  XXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQL 606
              HMST+QQNTLEAFVNLGKSVFC+DTFIPSPQYMQLVIDNIYQRAF ER   N RNS +
Sbjct: 421  YYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLM 480

Query: 607  IEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFF 666
            +EYLKHSEVMLL +F+ +  LQKVV+++F+HKFG    + + F PRD+FLQ+ E +KYFF
Sbjct: 481  VEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFF 540

Query: 667  RHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNESVMS 726
            RHAPAFAESHILQTVGFGD KNPFA                             ++S  S
Sbjct: 541  RHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKER---------RKSKSSHS 591

Query: 727  LDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHG 786
              +I T S +S  +Y  N++S ++ Y  P    IW +SLS++N+T+ +C  IV +KFL G
Sbjct: 592  FTSIETTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRG 651

Query: 787  PFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYAL 846
            P VVA+ H++ W+YF++S+ LK ++L   E + FW + +R++ P NSIV FLN+L+A+ L
Sbjct: 652  PLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVL 711

Query: 847  DNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSY 906
            DN++ ++ I ++ E+LDS+D + L+  F+ +E+LPE+W+CWG LWFD I DKSN +    
Sbjct: 712  DNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDV 771

Query: 907  EKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPV 966
               G  DH F+D P DGI FD  DE GEKFWKRA R+IF+FK IA+ F +G+TLS  AP 
Sbjct: 772  INSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQ 831

Query: 967  YCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNITMDATPP 1026
               R  +   H L +FSF  E+        Q +I++ +   I + E     N+  +  P 
Sbjct: 832  --SRRPMTAGHPLQNFSFNFEE-----IPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPG 884

Query: 1027 MSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASPENSVAG 1086
             S+ E E+IF++ GY+++  +   F+K+G L S + YTS     E  P       N+   
Sbjct: 885  QSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTS--GKLERGPIQGGDDFNT--- 939

Query: 1087 SSPGRSFQSQDVEENIFSVFTNEEENSTSLLDG-LNLE---------------------- 1123
               GRS  S   E    +  T  E      LD  +N E                      
Sbjct: 940  ERYGRSEDSNKPEN---AQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSG 996

Query: 1124 TTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXX 1183
             + FVLDATSWLRH AH++KLA+N+ L F ICLTTFQELRFLRKSKDE+V+E        
Sbjct: 997  VSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVIT 1056

Query: 1184 XXQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF------ 1237
              QLYSD K++PLRFTGN+ATH+EEHLEFEEQITWRSHVDEFVIE++ KAQKKF      
Sbjct: 1057 VRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQ 1116

Query: 1238 ----LQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLIC 1293
                   F+    +    F  LVSDD NM+ KAH + I+TF+TRF+FA+C+++G     C
Sbjct: 1117 AKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQAC 1176

Query: 1294 TN 1295
            TN
Sbjct: 1177 TN 1178

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/946 (52%), Positives = 649/946 (68%), Gaps = 43/946 (4%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            K +QALVQKLQDIYK I++QEVELQE+C+QLT+SQTT++ ++W IY++N +L+ NYVTFI
Sbjct: 313  KSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFI 372

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            +TAL  SQS+ DL+IG+EIV+ Y+I RRLWVYGTITFLDVLKNFS+FMDPEVC QFITHV
Sbjct: 373  TTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 432

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FISIS+ML DIP KY+IPW+Q+LGDLSRMA+AL+PSGFIDWKLS+E WY  A        
Sbjct: 433  FISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYG 492

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIER-GSNNTRN 603
                HMST+QQNTLEAFVNLGKSVFCQ+TF+PS QY+QLVIDNIYQRAF +R  S+N+RN
Sbjct: 493  KLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRN 552

Query: 604  SQ-LIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNI--FQPRDIFLQNPE 660
             Q L++YLKHSEVMLLPNF+ + +LQ+VV+ YF  KFG D ++ N+  FQPR +F+QN +
Sbjct: 553  CQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNND 612

Query: 661  NLKYFFRHAPAFAESHILQTVGFGDSKNPFAX-----XXXXXXXXXXXXXXXXXXXXXSS 715
             LK++FRHA AFAE+ ILQ VG+G+ KNPFA                             
Sbjct: 613  QLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGED 672

Query: 716  GEPTSNESVMSLD---NISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTA 772
            G  T+  SV  ++   N+ T+  + S+ +F+N++ +      P    +W  SL Y N TA
Sbjct: 673  GSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTA 732

Query: 773  VQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLN 832
             +C +IVL+KFL+GP +VALPH++ W YF+IS+ L+ E   D     FW +F++R+ P N
Sbjct: 733  TKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWN 792

Query: 833  SIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWF 892
            S+V FLNVL+AY +DN + ++ ++ + ++  S++L+ELL  FN NE+LPEVWKC G+LWF
Sbjct: 793  SMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWF 852

Query: 893  DAITDKSNT-DTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIA 951
            D I +K N+ + +SY + G+ D+ F D P+DGI FD  DE G KFWKR++R+IFLF+ I 
Sbjct: 853  DIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIV 912

Query: 952  ETFD--IGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIE 1009
            E F+    + +S+ APV  RR     +H++G +SFK     L   +  +  ++ L +  E
Sbjct: 913  ERFNGFGNLAISYNAPVINRRGLGVNSHLVG-YSFK-----LMAKSDDIMFDDMLVSNFE 966

Query: 1010 MTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSA 1069
              +  N      +A P +S+   ENIFEY GYKRI  +  +FDKNG+L S + Y +W   
Sbjct: 967  EIDSNNS---DFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSIN 1023

Query: 1070 QEI----VPKSAASPENSVAGSSP-------GRSFQSQDVEENIFSVFTNEE-ENSTSLL 1117
            Q+      P S  S  ++ A S P        + F   D E +    F N+E  +     
Sbjct: 1024 QDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCF---DPEYDSVDEFWNKEIYDDIGRK 1080

Query: 1118 DGLNL-ETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEX 1176
             G+ L E T F+LDATSWLRH AH+YK+A+NS L FSICLTTFQELRFLRKSKDENV+E 
Sbjct: 1081 FGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEA 1140

Query: 1177 XXXXXXXXXQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKK 1236
                     QL+S+GK++PLRFTGN+ATHIEEHLEFEEQITWRSHVDEFVIE++ KA+ K
Sbjct: 1141 ATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK 1200

Query: 1237 FLQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFAL 1282
              +  + N         VLV+DD NMK KA EK  +TF+TRFVFA+
Sbjct: 1201 RKEQEMHNM---KGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAI 1243

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/944 (49%), Positives = 630/944 (66%), Gaps = 40/944 (4%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            +P Q  ++KLQ+IYK IV QE ELQ++C  LT+SQTT+L S+W+IY++N EL+ NY+ FI
Sbjct: 201  QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFI 260

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
             TALL++Q   DL++GQEI++ YRI +RLWVYG ITFLDVLK+FS+FMDPEVC QFIT+ 
Sbjct: 261  ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYA 320

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FI IS ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LS+EYWY ++        
Sbjct: 321  FICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 380

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNT--- 601
                H++TIQQN+LEAFVNLGKSVFCQD F PS Q +QL+I+NIYQ AFI+R S NT   
Sbjct: 381  KLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNN 440

Query: 602  ----RNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQ 657
                RNSQLI+YLKH+EVMLLP+F+ N +LQ VV+ YF+ KFG D +  ++F  +D+F Q
Sbjct: 441  ETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQ 500

Query: 658  NPENLKYFFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGE 717
            NPE+L+Y+FRHAPAFAES ILQ +GFG+ KNPFA                      ++  
Sbjct: 501  NPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSGAAEI 560

Query: 718  PTSNESVMSLDNISTDSLISSDQYFSNLESMQHPY-LPPPRYDIWLKSLSYLNLTAVQCG 776
            P   +          D   SS+ YF N++++   +  PP    IWL SL+Y+N+T++QC 
Sbjct: 561  PHYRDPF--------DDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCS 612

Query: 777  VIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVS 836
            + VL KFLH P  VALPH ++W +FII+V  K ET+  E+   FW  F+RR +P NS+V+
Sbjct: 613  IQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVT 672

Query: 837  FLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAIT 896
            F NVL+ Y LDN +    +    E+  S++L +L+  FN NE LPEVWKCWG+LWFDA+ 
Sbjct: 673  FSNVLVCYMLDNLH--PFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVK 730

Query: 897  DKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF-D 955
                   +  E  GV DHLFFDSP+DGIVFD KDE GEKFW R++R I   K IA+ F D
Sbjct: 731  K-----CDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPD 785

Query: 956  IGITLSHTAPVYCRRDDVELNHILGSFSFKI---EQHLLNGNTVQVEIENCLGAIIEMTE 1012
            +G+ ++  A V+CRR+D+  ++ L + +FK+   E+   N N    E+ +     IE+ E
Sbjct: 786  LGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDT----IEINE 841

Query: 1013 MPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEI 1072
            +   VNI + ATP +S+   E+IFEYTGY R+  +   FDKNG   SA  YT W +    
Sbjct: 842  LIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVGNG 901

Query: 1073 VPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDAT 1132
            V    +S     + ++      ++ + + +F++  N +++ +         +  FV+DAT
Sbjct: 902  VTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSC--------SVYFVIDAT 953

Query: 1133 SWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDGK 1192
            SWLRH AHI+KLA N+ L F+ICLTTFQELR+LR SKD+NV+E          QLY + K
Sbjct: 954  SWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKK 1013

Query: 1193 VIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF-LQPFVQNPVDNDSR 1251
            +IP+RFTGNIATHIEE+LEFEEQITW++HVDEFVI++I+K  + F  +  +         
Sbjct: 1014 IIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKE 1073

Query: 1252 FFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
            F VLV+DD+NM +KA +K I+T  T+++F+L S++G    +CTN
Sbjct: 1074 FAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/942 (48%), Positives = 633/942 (67%), Gaps = 36/942 (3%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            +P Q  ++KLQ+IYK IV QE ELQ++C  LT+SQTT+L S+W+IYR+N EL+ NY+ FI
Sbjct: 202  QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFI 261

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
             TALL++Q   DL++GQEI++ Y + +RLWVYG ITFLDVLKNFS+FMDPEVC QFI + 
Sbjct: 262  ITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FIS+S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LS+EYWY ++        
Sbjct: 322  FISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNT--- 601
                H++T+QQN+LEAFVNLGKSVFCQD F PS Q +QL+I+NIYQ AFI+RGS+ T   
Sbjct: 382  KLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNN 441

Query: 602  ----RNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQ 657
                +NSQLI+YLKH+EVMLLP+F+ N +LQ VV+ YF++KFG D +  ++F  +D+F Q
Sbjct: 442  ETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQ 501

Query: 658  NPENLKYFFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGE 717
            NPE+L+Y+FRHAPAFAES +LQ +GFG+ KNPFA                      ++  
Sbjct: 502  NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSSATET 561

Query: 718  PTSNESVMSLDNISTDSLISSDQYFSNLESMQHPYLP-PPRYDIWLKSLSYLNLTAVQCG 776
            P   +              S + YF N++++   +   P   +IWL+SL+++N+T++QC 
Sbjct: 562  PQYRDPFHDKK--------SPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCS 613

Query: 777  VIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVS 836
            + VL KFLH PFV+ALPH + W YF++++  + ET+  ++   FW  F+RR +P NS+VS
Sbjct: 614  IHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVS 673

Query: 837  FLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAIT 896
              NVL+ Y LDN +    +    E   S +L +L+  FN NE LPE+WKCWG+LWFDAI 
Sbjct: 674  LANVLVCYMLDNLH--PFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAI- 730

Query: 897  DKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF-D 955
                   +  E  GV DHLFFDSP+DGIVFD KDE GE+FW R++R I L K IA+ F D
Sbjct: 731  ----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPD 786

Query: 956  IGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPN 1015
            +G+ ++  APV+CRR+D+  ++ L  F+FK++ +   GN       + L   IE+ E  +
Sbjct: 787  LGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAY-DEGNNNDNNELDELYETIEINEKID 845

Query: 1016 EVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPK 1075
             VN+ + ATP +S+   E+IFEYTGY R+AP+   FDKNG   SA  Y+ W +    VP 
Sbjct: 846  NVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVPI 905

Query: 1076 SAAS-PENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDATSW 1134
              ++ P   V  +     ++ +   + I + + N +EN           T  FV+DATSW
Sbjct: 906  DVSNEPIYDVTDNDLSLHWE-KIFFDRIAAAYKNCDENDNC--------TIYFVVDATSW 956

Query: 1135 LRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDGKVI 1194
            LRH AHI+KLA NS L F+ICLTTFQELR+LR SKD+NV+E          QLY + K+I
Sbjct: 957  LRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKII 1016

Query: 1195 PLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF-LQPFVQNPVDNDSRFF 1253
            P+RFTGNIATH+EE+LEFEEQITW++HVDEFVI++I+K  + F  +  +    + + +F 
Sbjct: 1017 PMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFA 1076

Query: 1254 VLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
            VLV+DD+NM +KA +K I+T  T+++F+L S++G    +CTN
Sbjct: 1077 VLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/941 (48%), Positives = 630/941 (66%), Gaps = 34/941 (3%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            +P Q  ++KLQ+IY+ IV QE ELQ++C  LT+SQTT+L S+W+IYR+N EL+ NY+ FI
Sbjct: 202  QPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFI 261

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
             TALL++Q   DL++GQEI++ YRI +RLWVYG ITFLDVLKNFS+FMDPEVC QFI + 
Sbjct: 262  ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FIS+S+ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LS+EYWY ++        
Sbjct: 322  FISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIER---GSNNT 601
                H++T+QQN+LEAFVNLGKSVFCQD F PS Q +QL+I+NIYQ AFI+R   G+NN 
Sbjct: 382  KLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNN 441

Query: 602  ----RNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQ 657
                RNSQLI+YLKH+EVMLLP+F+ N +LQ VV+ YF+ KFG D +  +IF  +D+F Q
Sbjct: 442  ETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQ 501

Query: 658  NPENLKYFFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGE 717
            NPE+L+Y+FRHAPAFAES +LQ +GFG+ KNPFA                      ++  
Sbjct: 502  NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGATEV 561

Query: 718  PTSNESVMSLDNISTDSLISSDQYFSNLESMQHPYLP-PPRYDIWLKSLSYLNLTAVQCG 776
            P   +          D  ISS+ YF N++S+   +   P   +IWL SL+++N+T++QC 
Sbjct: 562  PQYRDPF--------DDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCS 613

Query: 777  VIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVS 836
            + VL KFLH P VVALPH + W +FI+++  K ET+  +    FW  F+RR +P NS+V+
Sbjct: 614  IHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVN 673

Query: 837  FLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAIT 896
              NVL+ Y LDN +    +    E   S++L +L+  FN NE LPE+WKCWG+LWFDAI 
Sbjct: 674  LANVLVCYMLDNIH--PFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAI- 730

Query: 897  DKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF-D 955
                   +  E  GV DHLFFDSP+DGIVFD KDE GE+FW R++R I + K +A+ F D
Sbjct: 731  ----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPD 786

Query: 956  IGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPN 1015
            +G+ ++  APV+CRR+D+  ++ L +F+FK++++  N +    E++  L   IE+ E   
Sbjct: 787  LGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDE-LYDTIEINEKIE 845

Query: 1016 EVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPK 1075
             VN  + ATP +S+   ENIFEYTGY R+ P+   FDKNG   SA  Y+ W +    +  
Sbjct: 846  RVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGNGMVL 905

Query: 1076 SAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDATSWL 1135
              +S     A ++       +   + I +   N ++N           +  FV+DATSWL
Sbjct: 906  DVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNC--------SVYFVIDATSWL 957

Query: 1136 RHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDGKVIP 1195
            RH AHI+KLA N+ L F+ICLTTFQELR+LR SKD+NV+E          QLY + K+IP
Sbjct: 958  RHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIP 1017

Query: 1196 LRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF-LQPFVQNPVDNDSRFFV 1254
            LRFTGNIAT++EE+LEFEEQITW +HVDEFVI++I+K  + F  +  +    + ++ + V
Sbjct: 1018 LRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAV 1077

Query: 1255 LVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
            LV+DD+NM  KA +K I+T  T+++F+L S++G    +CTN
Sbjct: 1078 LVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/961 (50%), Positives = 636/961 (66%), Gaps = 55/961 (5%)

Query: 367  TQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFIST 426
            +QALVQKLQDIY+NIV+QEVELQE+C+QLT SQTTDL ++W IY++N EL+ NYV FI+T
Sbjct: 211  SQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITT 270

Query: 427  ALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFI 486
            ALL SQ + DL+IGQEIV  YRI RRLWV+GTITFLDVLKNFS+FMDPEVC QFITHVFI
Sbjct: 271  ALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFI 330

Query: 487  SISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXXXX 546
            SIS ML D+P K++ PW++RLGDLSRMAIALYPSGFIDWKLS+E+WY QA          
Sbjct: 331  SISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKL 390

Query: 547  XXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQL 606
              HMST+QQNTLEAFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAF ER   N RNS +
Sbjct: 391  YYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLM 450

Query: 607  IEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFF 666
            +EYLKHSEVMLL +F+ +  LQKVV+++F++KFG   ++ + F  + IFLQ+ E  KYFF
Sbjct: 451  VEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFF 510

Query: 667  RHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNESVMS 726
            RHAPAFAESHILQ VGFG+ KNPFA                      SS   TS E+   
Sbjct: 511  RHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEA--- 567

Query: 727  LDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHG 786
                   S  S  +Y  +++S +  Y  P    IW +SLS++N T+++C  +VL+KFLHG
Sbjct: 568  ------PSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHG 621

Query: 787  PFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYAL 846
            P V A  HL+ W YF++S+ ++ + L   E + FW +  R++ P NSIV+FLN++IA+AL
Sbjct: 622  PLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFAL 681

Query: 847  DNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSY 906
            DN++ ++ I ++ E+ DS+D++ L+  F+ NE+LPEVWKCWG LWFD I+DKS+      
Sbjct: 682  DNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGA 741

Query: 907  EKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPV 966
                V DH+F D P+DGI FD  DE G +FWKRA R++F+FK IA+ F++G+TL+ + P+
Sbjct: 742  TYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLA-SVPL 800

Query: 967  YCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMP-----NEVNITM 1021
              RR  +   H L +F FK E   ++  +          A+I  T+MP     +E N+  
Sbjct: 801  QSRR-SLAAGHPLQNFCFKFEDPPVDSESY---------ALIS-TQMPAFENISERNLDP 849

Query: 1022 DATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASPE 1081
            +A P  S+ E +++FE  GY+++  +   F+K G L + + YTS   + E  P       
Sbjct: 850  NAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTS--GSLEKGPIHGGDDF 907

Query: 1082 NSVAGS-------SPGRSFQSQDVEENIF------SVFTNEEENSTSLLDGLNLETTS-- 1126
            N+   S       +     +  D  E ++        F  +  +       L+    S  
Sbjct: 908  NTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGV 967

Query: 1127 --FVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXX 1184
              FV DATSWLRH AH+YKLA+N  L F+ICLTTFQELRFLRKSKDE+V+E         
Sbjct: 968  SYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITV 1027

Query: 1185 XQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF------- 1237
             QLYS+ +++PLRFTGN+ATH+EEHLEFEEQITWRSHVDEFVIE++ KAQ KF       
Sbjct: 1028 RQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQA 1087

Query: 1238 ---LQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICT 1294
                  F+    +    F  LVSDD NM+ KAH + IRTF++RF+FA+C+++G     CT
Sbjct: 1088 KEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACT 1147

Query: 1295 N 1295
            N
Sbjct: 1148 N 1148

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/946 (49%), Positives = 628/946 (66%), Gaps = 44/946 (4%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            +P Q  ++KLQ+IYK IV QE ELQ++C  LT+SQTT+L S+W+IYR+N EL+ NY+ FI
Sbjct: 202  QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFI 261

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
             TALL++Q   DL++GQEI++ YRI +RLWVYG ITFLDVLKNFS+FMDPEVC QFI + 
Sbjct: 262  ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FIS+S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LS+EYWY ++        
Sbjct: 322  FISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNT--- 601
                H++T+QQN+LEAFVNLGKSVFCQD F PS Q +QL+I+NIYQ AFI+R S +    
Sbjct: 382  KLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNN 441

Query: 602  ----RNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQ 657
                RNSQLI+YLKH+EVMLLP+F+ N +LQ VV+ YF+ KFG D +  ++F  +D+F Q
Sbjct: 442  EIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQ 501

Query: 658  NPENLKYFFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGE 717
            NPE+L+Y+FRHAPAFAES +LQ +GFG+ KNPFA                         E
Sbjct: 502  NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFA----LLFQLPKYLKLKKDKREKKRSE 557

Query: 718  PTSNESVMSLDNISTDSLISSDQYFSNLESMQHPYLP-PPRYDIWLKSLSYLNLTAVQCG 776
             T   S         D  ISS+ YF N++++   +   P   +IWL SL+++N+T++QC 
Sbjct: 558  ATETSSYTD----PFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCS 613

Query: 777  VIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVS 836
            + VL KFLH P VVALPH + W +FI+++  K E +  ++   FW  F+RR +P NSIV+
Sbjct: 614  IHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVT 673

Query: 837  FLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAIT 896
              NVL+ Y LDN +    +    E+  S++L +L+  +N NE LPE+WKCWGTLWFDAI 
Sbjct: 674  LGNVLVCYMLDNLH--PFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI- 730

Query: 897  DKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF-D 955
                   +  E  GV DHLFFDSP+DGIVFD KDE GEKFW R++R + L K IA+ F D
Sbjct: 731  ----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPD 786

Query: 956  IGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPN 1015
            +G+ +S  A V+CRR+D+  ++ L + +FK++ +  +      E+++ L   IE+ E   
Sbjct: 787  LGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDD-LYDTIEINEEIE 845

Query: 1016 EVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPK 1075
             VN+   ATP +S+   E+IFEYTGY R+AP+   FDKNG   SA  Y+ W         
Sbjct: 846  AVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW--------- 896

Query: 1076 SAASPENSVAGSSPGRSFQSQDVEENIFS-----VFTNEEENSTSLLDGLNLETTSFVLD 1130
              ++  N V     G S    DV  N  S     +F ++   ++   D     T  FV+D
Sbjct: 897  --SNVGNGVTLDVSGESI--YDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVID 952

Query: 1131 ATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSD 1190
            ATSWLRH AHI+KLA N+ L F+ICLTTFQELR+LR SKD+ V+E          QLY +
Sbjct: 953  ATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDE 1012

Query: 1191 GKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDS 1250
             K+IP+RFTGNIATH+EE+LEFEEQITW++HVDEFVI++I+K  ++F    + +   N  
Sbjct: 1013 KKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKG 1072

Query: 1251 R-FFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
            + F VLV+DD+NM +KA ++ I+T  T+++F+L S++G    +CTN
Sbjct: 1073 KEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1015 (46%), Positives = 628/1015 (61%), Gaps = 87/1015 (8%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            + TQAL+ KLQDIYK+I+ QEVELQ  C+ +TSSQTTDL  IW +Y+INVELV NYV FI
Sbjct: 271  RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            +TALL SQSQ DL+IGQEI++ Y+I RRLWVYGTITFLDVLK+FS+FMDPE+C QFI HV
Sbjct: 331  TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FISI+ M   IP K+SIPW  RLGDLSRMA ALYP G  DWKLS+EYWY +A        
Sbjct: 391  FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNS 604
                HM+T+QQN+L AF+NLGKSVFC+D F+P+ QY+QLVIDNIYQRA+I RG  ++ N 
Sbjct: 451  KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNV 510

Query: 605  QLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKY 664
            Q+++YLKH+E+M+LPNF+ N  LQ++   YF  KFG D    N F  R +F+QN E++K+
Sbjct: 511  QILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKF 570

Query: 665  FFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNESV 724
            +FRH+P FA++HILQ VG+G+  N FA                       S     N S+
Sbjct: 571  YFRHSPLFAQAHILQVVGYGNIGNAFA---LLYELPKFIKDNEISRQRKKSKTGVDNMSI 627

Query: 725  MSLD-NISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKF 783
             +L   +S + +    +YF++LE++   +  PP  DIW++SL Y N T + CG++VL+KF
Sbjct: 628  DTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKF 687

Query: 784  LHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIA 843
            L GPFV ALPHL+ W YF+ISV  K ETL D  S+YFW  F+RR+ P N+I++FLNVLIA
Sbjct: 688  LQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIA 747

Query: 844  YALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDT 903
            +  DNS   +L++ + E    + L E+LT F+ NEELPEVW CWG+LWFD I +KS T  
Sbjct: 748  FLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSY 807

Query: 904  NSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHT 963
            +  +  G+ D  F D+P DGIVFD +D+NG KFWKRA RI+FLFK  AE FD G+ L++ 
Sbjct: 808  SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTNI 867

Query: 964  APVYCRRDDV-----ELNHILGSFSFKIEQHLL---NGNTVQVEIENCLGAIIEMTEMPN 1015
              +    +++     E  +I   F F     LL     +    ++ +     +   E  +
Sbjct: 868  NSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESIS 927

Query: 1016 EVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPK 1075
            E NI +DA P +S+ + E+IF+Y GYK++ P    +DKNG +   A Y++W +  ++   
Sbjct: 928  ENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNG 987

Query: 1076 SAASPENS----VAGSSPGRSF---------------QSQDVEENIFSV----------- 1105
                 EN     + G    ++F               +SQ+  +++  V           
Sbjct: 988  LKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAEVEREGDETEDET 1047

Query: 1106 -----------FTNEEENSTSL----LDG---LNLETTSFVLDATSWLRHSAHIYKLASN 1147
                       +TN+ +  T      ++G   +   +T F+ DAT+WLRH AHIYK+A +
Sbjct: 1048 EETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYS 1107

Query: 1148 SFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDGKVIPLRFTGNIATHIE 1207
              L F ICLTTFQELRFLR+S+DENVME           LY   KVIPLRF G IA+HIE
Sbjct: 1108 GLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIE 1167

Query: 1208 EHLEFEEQITWRSHVDEFVIESISKAQKKFL---------------------------QP 1240
            EHLEFEEQITWRSHV+EFVIE+++K+Q+  +                           Q 
Sbjct: 1168 EHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQR 1227

Query: 1241 FVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295
               N   N     VLV+DD NM  KA E+ IRT +TRF+F++CS++G    ICTN
Sbjct: 1228 GNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/981 (48%), Positives = 634/981 (64%), Gaps = 74/981 (7%)

Query: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
            K +Q LVQKLQDIYK IV+QE+ELQE+C +LT+SQTT+L ++W+IYR+N ELV NY+TFI
Sbjct: 379  KSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFI 438

Query: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            +TA+  +Q + D  IG+EI+E Y+I RRLWVYGTITFLD+LKNFS+FMDPEVC QFI HV
Sbjct: 439  TTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHV 498

Query: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
            FISIS MLADIP KY + W Q+LGDLSRMAIALYPS FIDWKLS+E WY  A        
Sbjct: 499  FISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHG 558

Query: 545  XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIE-RGSNNTRN 603
                HMST+QQNTLEAFVNLGKS+FC++TF+PS QY+QLVI NIYQRA+ +   SNN RN
Sbjct: 559  KLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRN 618

Query: 604  SQL-IEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDL--NIFQPRDIFLQNPE 660
             QL ++Y+KH EV LLPNF  ++ LQ+VV+ YF  KFG D ++   N+F  R +F+QN +
Sbjct: 619  DQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNND 678

Query: 661  NLKYFFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSS----- 715
              K F+R++ AFAES ILQ VG+G+ K+PF+                      +      
Sbjct: 679  QFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKI 738

Query: 716  GEPT-------SNESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYL 768
             +P        +    M  +N+     ++++++F N++++ +P   P   DIW  SL Y 
Sbjct: 739  TQPRLYHRWVGTTLPTMPNNNV----FLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYA 794

Query: 769  NLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRL 828
            N  +++C +IV +KFLH PF++ALPH + W YFIIS+ L+ +   +     FW  F+RR+
Sbjct: 795  NHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRI 854

Query: 829  LPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWG 888
             P NSIV FLNVL+AY +DN +  ++++ +    +SM L ELLT FN NEELPEVWKC G
Sbjct: 855  FPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRG 914

Query: 889  TLWFDAITDKSNT--------------DTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGE 934
            +LWFD I +KSN               + N Y+  GV D+ FFD PIDG  FD  DE GE
Sbjct: 915  SLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGE 974

Query: 935  KFWKRALRIIFLFKKIAETFD--IGITLSHTAPVYCRR-DDVELNHI---LGSFSFKIEQ 988
            +FWKRA R+IFLFKK+AE++    G+ LS+ APV+ RR D+ ++N +   L  FSFK   
Sbjct: 975  RFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFK--- 1031

Query: 989  HLLNGNTVQVEIENCLGAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPEL 1048
              LN ++  V +++    IIE  E P+EVN     TP +S+ + ++IF+Y GYKR+ P  
Sbjct: 1032 --LNASSDGVMLDD----IIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNF 1085

Query: 1049 QNFDKNGELRSAANYTSWYS---AQEIVPKSAASPENSVAGSSPGRSFQSQDVEE---NI 1102
             +FDKNG+  S + + SW       E+   + +S  +    S  G    +        N 
Sbjct: 1086 YSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNE 1145

Query: 1103 FSVF---------TNEEENSTSLL----DGLNLE-TTSFVLDATSWLRHSAHIYKLASNS 1148
              VF         T EE  S  +       ++L+  T F+LDATSWLRH AHIYK+A++ 
Sbjct: 1146 LLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSK 1205

Query: 1149 FLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDGKVIPLRFTGNIATHIEE 1208
             L F+ICLTTFQELR+LRKSKD NV+E          QLY +  ++PLRFTGN+ATHIEE
Sbjct: 1206 ILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEE 1265

Query: 1209 HLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDSR-----FFVLVSDDENMK 1263
            HLEFEEQITWRSHVDEFVIE++ KA++K         +D D +       +LV+DD  MK
Sbjct: 1266 HLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMK 1325

Query: 1264 RKAHEKEIRTFTTRFVFALCS 1284
             KA +++I+TF+TRF+F++ +
Sbjct: 1326 NKAMDRKIKTFSTRFIFSMAN 1346

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/972 (47%), Positives = 612/972 (62%), Gaps = 79/972 (8%)

Query: 367  TQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFIST 426
            +QAL++KLQ+IY+NIVRQE ELQ++C+QLT+SQTTDL ++W IY++N EL+ NY  FI+T
Sbjct: 282  SQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFITT 341

Query: 427  ALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFI 486
            ALL +Q + DL+IG+EI+E YRI RRLWVYGTITFLDVLKNFS+FMDPEVC QFI +VFI
Sbjct: 342  ALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVFI 401

Query: 487  SISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXXXX 546
            SIS ML DIP K+SI W++RLGDLSRMAIALYPSGFIDWKLS+E+WY++A          
Sbjct: 402  SISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGKL 461

Query: 547  XXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQL 606
              HMST+QQNTL AFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAF ER S + RN+ L
Sbjct: 462  YYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRNAHL 521

Query: 607  IEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFF 666
            +EYLKH+EVMLLP+F+ +  LQ VV+ +FE KFG    +++ F PR +F+Q+ E LK+FF
Sbjct: 522  VEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVT-SNVDFFDPRLVFVQDSERLKHFF 580

Query: 667  RHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNESVMS 726
            RHA  +AESH+LQ VGFGD +NPFA                      SS   TS +   S
Sbjct: 581  RHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSS---TSTQYDTS 637

Query: 727  LDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHG 786
            +D+    +  +  ++F  ++S ++ Y  P   +IW +SLSY N+TA++C +IVLRKFLHG
Sbjct: 638  IDDDC--AFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHG 695

Query: 787  PFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYAL 846
            P + ALPHL+ W YF+ +   +  T+  +E R FW + +R+L P N+I++FLNVL+ Y  
Sbjct: 696  PLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYMN 755

Query: 847  DNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSY 906
            + +  +       E+   M L +L+  F  NEELPEVW+CWGTLWFDA+  K  T+    
Sbjct: 756  NQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNLTDI 815

Query: 907  EKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPV 966
               GV DH+F DSPIDGI FD  DE+GEKFWKR  R+I LF+ +A    +G+        
Sbjct: 816  NSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGLR------- 868

Query: 967  YCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNITMDATPP 1026
                 ++       S  FK E+       + +E       + +  E  + VN+   ATP 
Sbjct: 869  -----EISGGRNWRSLVFKFEEPPSEWCDMYLEP---FTLVFDTFEQISPVNLDQRATPY 920

Query: 1027 MSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASPENSVAG 1086
              +  + +I    GY+ + P+   F++NG++ + + YT              + E+S  G
Sbjct: 921  CGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYT------------IGTLESS--G 966

Query: 1087 SSPGRSFQSQDVEENIFSVFTNEEENSTSLLDG--------------------------- 1119
               G  F  + + EN   + + E  +  SL+D                            
Sbjct: 967  IHGGDDFNGKRLLEN-GELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPR 1025

Query: 1120 ------LNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENV 1173
                   +   T FVLDAT+WLRH  H+YKLA+N+ L F+ICLTTFQELRFLRKSKDE+V
Sbjct: 1026 GDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESV 1085

Query: 1174 MEXXXXXXXXXXQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKA 1233
            +E          QLY + K++PLRFTGN+A H+EEHLE EEQ+TWRSHVDEFVIE+I KA
Sbjct: 1086 LEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKA 1145

Query: 1234 QKKF----------LQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALC 1283
            Q KF           +  +    D    F  LV+DD NM+ KA  + I+ F+TRF+F++C
Sbjct: 1146 QDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVC 1205

Query: 1284 SEMGKGRLICTN 1295
            +E+G  + +CTN
Sbjct: 1206 NELGHAKNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/966 (48%), Positives = 608/966 (62%), Gaps = 60/966 (6%)

Query: 365  KPT-QALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTF 423
            KP+ Q LV+KLQ+IYKNIV+QE ELQE+C+QLT+SQTTDL ++W IY++N EL+ NY TF
Sbjct: 317  KPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTF 376

Query: 424  ISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITH 483
            I+TALL +Q + DL+IGQEI+E YRI RRLW+YGTITFLDVLKNFS+FMDPEVC QFI +
Sbjct: 377  ITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVY 436

Query: 484  VFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXX 543
            VFISIS +L +IP  +S+ W++RLGDLSRMAIALYPSGFIDWKLS+E+WY +A       
Sbjct: 437  VFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGH 496

Query: 544  XXXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRN 603
                 HMST+QQNTL AFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAF ER S + R 
Sbjct: 497  GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRY 556

Query: 604  SQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLK 663
            S ++EYLKH+EVMLLP+F+ N   Q VV+ +F+ KFG      N F P  IF+Q+ E LK
Sbjct: 557  SHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGAT-GSANFFDPSLIFVQDCERLK 615

Query: 664  YFFRHAPAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNES 723
            +FFRHA  +AESHILQ VGFGD +NPFA                      S+    SN+S
Sbjct: 616  HFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTA---SNQS 672

Query: 724  VMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKF 783
             MS+D+      +   Q+F  L S +  Y      +IW +SL+Y+N T+++C ++VLRKF
Sbjct: 673  DMSIDDTFLGDPV---QFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKF 729

Query: 784  LHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIA 843
            L+   + ALPHL+ W YF+++V L+ + + +E+S+ FW  F+R++ P  SI +FLNVL+ 
Sbjct: 730  LNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLL 789

Query: 844  YALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDT 903
            Y  D       I        +M L ELL  F  NE+LPEVW CWGTLWFD I  K  ++ 
Sbjct: 790  YINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNL 849

Query: 904  NSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHT 963
                  GV DH+F D+P+DGI FD  DE+GEKFWKR +R+I LF+ IA  F  G T    
Sbjct: 850  VDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFT---- 905

Query: 964  APVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMT---EMPNEVNIT 1020
                      E N   GS  +K      N    + + E  LG+  +     E  + VN  
Sbjct: 906  ----------EFN---GSDDWKSLVFKFNEPPAEWK-EQYLGSFSKEYGEFESISFVNTD 951

Query: 1021 MDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYS-AQEIVPKSAAS 1079
            + + P   +    +I    GYK++ P+   F+KNG+L + + YTS  S     VP  +  
Sbjct: 952  LQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSED 1011

Query: 1080 -------PENSVAGSSPGRSFQS-QDVEEN-IFSVFTNEEENSTS------LLDG----- 1119
                    EN +  +S  R + +  D EE  I   F     +ST+      L  G     
Sbjct: 1012 FGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYF 1071

Query: 1120 LNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXX 1179
             +   T FVLDAT+WLRH  H+YKLA+++ L F+ICLTTFQELRFLRKSKDE+V+E    
Sbjct: 1072 TDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATR 1131

Query: 1180 XXXXXXQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQ 1239
                  QLY + K++PLRFTGN+A H+EEHLE EEQ+TWRSHVDEFVIE+I KAQ KF Q
Sbjct: 1132 AVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQ 1191

Query: 1240 ----------PFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKG 1289
                        +    D    F  LV+DD NM+ KA  + IR F+T+F+FA+C E+G  
Sbjct: 1192 LNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLS 1251

Query: 1290 RLICTN 1295
            + +CT+
Sbjct: 1252 KKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/967 (46%), Positives = 611/967 (63%), Gaps = 62/967 (6%)

Query: 370  LVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTALL 429
            LV+KLQ+IYK+IV+QE ELQE+C+ LT+ QTTDL ++W  Y+IN EL+ NY+ FI+TALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 430  SSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFISIS 489
             SQS+  L IGQEIV+ YRI RRLWVYGTITFLDVLKNFS+FMDPEVC QFI +VFI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 490  TMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXXXXXXH 549
             ML D+P KYSIPW++RLGDLSRMAIALYPSGF+DWKLS+E+WY ++            H
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 550  MSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLIEY 609
            MST+QQNTLEAFVNLGKSVFC+D F+PSPQYMQLVIDNIYQRAF ER S+  R + +++Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 610  LKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFFRHA 669
            LKH+EVMLLP+F+ +  LQ VV+ YF+HKFG      N F P  IF+Q+ E LK+FFRH+
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 670  PAFAESHILQTVGFGDSKNPFAXXXXXXXXXXXXXXXXXXXXXXSSGEPTSNESVMSLDN 729
              F++SHILQ  GFGD KNPFA                         + T + S  SLD 
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERK------KSTKSTSEGSLDP 636

Query: 730  I--STDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGP 787
            +  S+    S++ +FS ++S + PY  P    +W +SL Y+N+T+++CG+IVLR+FL+GP
Sbjct: 637  VEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGP 696

Query: 788  FVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALD 847
             V ALPH++ W  FIIS+ ++ + + D   + FW  F+RR+ P +S+++F+N LI Y + 
Sbjct: 697  IVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMV 756

Query: 848  NSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSYE 907
                +  I +       M+ +ELLT    NE LPE W CWG+LWF+ I+ KS+ D  + E
Sbjct: 757  TGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLE 816

Query: 908  KIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPVY 967
              G+SD LF DSP +GI FD  DE G K+W+R  R + LF  I E ++      H     
Sbjct: 817  STGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE-WEACDGYGHG---- 871

Query: 968  CRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNIT---MDAT 1024
            C++ + E      +  F+      +  +V++  E       E  E+ + +N +    D +
Sbjct: 872  CKKLNPEATS-WKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGS 930

Query: 1025 PPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSW------------YSAQEI 1072
               S+    +I    G+K + P+   F+KNG+L +A+ YT              ++A +I
Sbjct: 931  K--SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKI 988

Query: 1073 VPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLET----TSFV 1128
            +       ++ +  SS     +   +E  +   F   E  + S L  LN +     T FV
Sbjct: 989  LDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFV 1048

Query: 1129 LDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLY 1188
            LDAT+WLRH AHIYKLA++S L F+ICLTTFQELRFLRKSKDE+V+E          QLY
Sbjct: 1049 LDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLY 1108

Query: 1189 SDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDN 1248
             + K++ LRFTGN+A H+EEHLE EEQ+TW+SHVDEFVI++I+KAQ KF      N ++N
Sbjct: 1109 YERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKF------NVLNN 1162

Query: 1249 DS--------------------RFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGK 1288
            D+                     F  LV+DD NM+ KA +  IRTF+TRFVFA+C E+G+
Sbjct: 1163 DAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGR 1222

Query: 1289 GRLICTN 1295
               +CTN
Sbjct: 1223 ETGVCTN 1229

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  447 bits (1149), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 225/368 (61%), Positives = 276/368 (75%), Gaps = 43/368 (11%)

Query: 367 TQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFIST 426
           +QAL+QKLQDIYK IV+QE++LQ++C+QLT+SQTTDL ++W+IY+IN++L+ NY+ FI+ 
Sbjct: 395 SQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITN 454

Query: 427 ALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFI 486
           ALL +QS+ DL IG+EI+E YRI RRLWVYGTITFLDVLK+FS+FMDPEVC QFI+HVFI
Sbjct: 455 ALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFI 514

Query: 487 SISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXXXX 546
           +IS +L DIP KYSI W+QRLGDLSRMAIALYPSGFIDWKLS+E+WYN+A          
Sbjct: 515 AISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKL 574

Query: 547 XXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQL 606
             HMST+QQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF+ER + N RN QL
Sbjct: 575 YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQL 634

Query: 607 IEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGT------------------------- 641
           IEYLKH+EVMLLP F+ + +LQ VV+ YF+ KFG                          
Sbjct: 635 IEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPY 694

Query: 642 ------------------DLHDLNIFQPRDIFLQNPENLKYFFRHAPAFAESHILQTVGF 683
                                 ++IF+ +D+F+QNP++LKYFFRH+  FA+SHILQ VGF
Sbjct: 695 SSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGF 754

Query: 684 GDSKNPFA 691
           GD KNPFA
Sbjct: 755 GDPKNPFA 762

 Score =  430 bits (1105), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 244/589 (41%), Positives = 347/589 (58%), Gaps = 81/589 (13%)

Query: 736  ISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHL 795
            I  +++F N++ +Q PY  P   +IWL+SL  +NL +++C +IVL+KFL+GP ++ALPHL
Sbjct: 863  ILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHL 922

Query: 796  MVWTYFIISVCLKSE-TLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDN--SYYS 852
            + W +FIIS+ LK E ++ D +S+ FW SF++ ++P NSIV+FLNVL+ Y LDN      
Sbjct: 923  LTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENF 982

Query: 853  TLISSISEELDSMD---LQELLTKFNNNEELPEVWKCWGTLWFDAITDKS---------- 899
             LI S+S + +SM    L E+L  FN NE LPE+WKCWGTLWFD I +K+          
Sbjct: 983  KLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQ 1042

Query: 900  -------------------NTDTN-SYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKR 939
                               N DT+ +   +G+ DH   D P+DGI F + DE+G  F+KR
Sbjct: 1043 NNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKR 1102

Query: 940  ALRIIFLFKKIAETF-DIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQV 998
            ++R+IFL K + ETF ++G+ +SH    YCR   +  N IL +F+FK+  +L + + + +
Sbjct: 1103 SIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLT-NLYDPSLIII 1161

Query: 999  ----------------EIE---NCLGAIIE---MTEMPNEVNITMDATPPMS-LQENENI 1035
                            ++E   + L  I+E   + E   E+N+ +   PP+S L  NENI
Sbjct: 1162 PQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENI 1221

Query: 1036 FEYTGYKRIAPELQNFDKNGELRSAANYTSW--------------YSAQEIVPKSAASPE 1081
            F Y GYKR+   +Q+F +NGE+ S + Y+SW                 + +V  S    E
Sbjct: 1222 FNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNE 1281

Query: 1082 NSVAGS-----SPGRSFQSQDVEENIFSVFTNEE-ENSTSLLDGLNLETTSFVLDATSWL 1135
            N   G      +  + F        + +   N + +N+  +   +N   T FV DATSWL
Sbjct: 1282 NVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWL 1341

Query: 1136 RHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEXXXXXXXXXXQLYSDGKVIP 1195
            RH AHIYKL+ N FL F++CLTTFQELRFLRKSKD NV+E          QLY +GK++P
Sbjct: 1342 RHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLP 1401

Query: 1196 LRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQN 1244
            LRFTGN+AT IEEHLEFEEQITWRSHVDEFVIE+I ++Q++F    +QN
Sbjct: 1402 LRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQN 1450

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  400 bits (1028), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 212/403 (52%), Positives = 263/403 (65%), Gaps = 76/403 (18%)

Query: 365 KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424
           K  Q L+QKLQ+IYK IV QE+ELQ+KC +L++SQ+T L  +WSIY++N +L+ NY+ FI
Sbjct: 264 KSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFI 323

Query: 425 STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484
            T+L  SQS  D +IG+EI+E Y+I RRLW+YGTITFLD+LKNF++FMDPE+ SQFITHV
Sbjct: 324 LTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHV 383

Query: 485 FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAXXXXXXXX 544
           F SIS M++D+P  +  PW QRLGDLSRMAIALYPS FIDWKLSSEYWY ++        
Sbjct: 384 FESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHG 443

Query: 545 XXXXHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIER-------- 596
               H+ST+QQN LEAFVNLGKSVFC DTFIPS +YMQLVIDNIYQRAFIER        
Sbjct: 444 KLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSN 503

Query: 597 ------------GSNNTRNSQ---LIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFG- 640
                        S+  +N Q   LIEYLKHSEVMLLPNF+ N++L+ VV+ YF + FG 
Sbjct: 504 NAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGK 563

Query: 641 ----TDLHD-----------------------------------------------LNIF 649
               ++L D                                               +N+F
Sbjct: 564 IAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLF 623

Query: 650 QPRDIFLQ-NPENLKYFFRHAPAFAESHILQTVGFGDSKNPFA 691
             R+IF Q N + LKYFF+++  FAESHILQ +GFGD KNPFA
Sbjct: 624 NFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFA 666

 Score =  248 bits (633), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 117/255 (45%), Positives = 172/255 (67%), Gaps = 4/255 (1%)

Query: 736  ISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHL 795
            +S   +F+NLES++  +  P   +IW +SL Y+N+ ++ C +IVL+KFL+GP  V+LPH+
Sbjct: 786  LSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHM 845

Query: 796  MVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLI 855
            + W+YFIIS+ L+ E+L + ESR FW  F+R++ P NSIVS+LNV+I+  LDN Y +++I
Sbjct: 846  LPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMI 905

Query: 856  SSISEELDSMDLQELLTKFNNNE-ELPEVWKCWGTLWFDAITDKSNTDTNSYEK-IGVSD 913
            + +     + +L ELL +FN NE ELPEVWKC+G+LWFD I +     +    K I + D
Sbjct: 906  TKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKD 965

Query: 914  HLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFD--IGITLSHTAPVYCRRD 971
                + PIDG+ FD  +ENG  FWKR+ R+IFLFK +   F+   G+T+S    VYC R 
Sbjct: 966  TKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRS 1025

Query: 972  DVELNHILGSFSFKI 986
            D+  NHIL +F+FK+
Sbjct: 1026 DIPNNHILRTFAFKL 1040

 Score =  236 bits (601), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 186/325 (57%), Gaps = 56/325 (17%)

Query: 1018 NITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWY---------S 1068
            N  ++  P +SL ENE++FEY GYKR  P+  NFDKNGEL S + YTS           +
Sbjct: 1157 NTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTINGSSSN 1216

Query: 1069 AQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSV-----FTNEEENSTSLLD----- 1118
            A  I   + A+ E++   S+   S Q+++   +  ++     F  E+E    +LD     
Sbjct: 1217 ANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDYKN 1276

Query: 1119 -------------GLNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFL 1165
                          +    T FVLDATSWLRH AH+YKLA+N  L F+ICLTTFQELRFL
Sbjct: 1277 IDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFL 1336

Query: 1166 RKSKDENVMEXXXXXXXXXXQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEF 1225
            RKSKDENVME          QLYS+ +++PLRFTGNIATHIEEHLEFEEQITWRSHVDEF
Sbjct: 1337 RKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEF 1396

Query: 1226 VIESISKAQKKFLQPFVQNPVDNDSR--------------------FFVLVSDDENMKRK 1265
            VIE+I +AQ K      Q   +  S                      FVLV+DD +M +K
Sbjct: 1397 VIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLVTDDISMIKK 1456

Query: 1266 AHEK----EIRTFTTRFVFALCSEM 1286
              E+    +I TF+T+FVF+LC+ +
Sbjct: 1457 RQEEKSDNDIITFSTKFVFSLCNML 1481

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 100/442 (22%), Positives = 169/442 (38%), Gaps = 72/442 (16%)

Query: 771  TAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLP 830
            T +    ++ +KFL     ++ P ++ W  F ISV  +   + D      W   ++ LLP
Sbjct: 491  TLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLP 550

Query: 831  LNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTL 890
             + IV++LN  I     +S  S  + ++ + + S  L +LL          E+  C G +
Sbjct: 551  WDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFI 610

Query: 891  WFDAITDK----SNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFL 946
            WFD++  K    S T   S  K        +++  D +++D  D+   K W RAL II L
Sbjct: 611  WFDSLASKIKQASITTNESLMKFKS-----YNASEDSLIYDDDDQVYTKMWTRALLIILL 665

Query: 947  FKKIA----ETFDIGITLSHTAPVYC-RRDDVELNHILGSFSFKIEQHLLNGNTVQVEIE 1001
             K +     E  D+ I         C +  D   N  L  + F              E+ 
Sbjct: 666  IKNVINDYPELIDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGF--------------ELN 711

Query: 1002 NCLGAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSA- 1060
            N    II+ T                 L     IF+++      P+ Q+FDKNG++    
Sbjct: 712  NNNAVIIDDT-----------------LHGRNRIFKFS----YIPDFQDFDKNGDITWGY 750

Query: 1061 ---ANYTSWYSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTN-EEENSTSL 1116
               +NY   YS             N       G  FQ       + S   +  E+ S   
Sbjct: 751  SLISNYDYIYS-------------NDFNSEEDGNFFQR--YSRRLLSAHNDYSEDKSKKY 795

Query: 1117 LDGLNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRK-SKDENVME 1175
            L    LE   F++D  +WL+HS  + +  +   +   + ++   +L  L+  S+ E+V  
Sbjct: 796  LPK--LENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRS 853

Query: 1176 XXXXXXXXXXQLYSDGKVIPLR 1197
                       LY+  ++  L+
Sbjct: 854  SASRVMIVINYLYAMNQINILK 875

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 140/323 (43%), Gaps = 49/323 (15%)

Query: 409 IYRINVELVTNYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNF 468
           +++++ ++V+ Y  FI+ AL  + +Q DL+ G+E V   R+  RL  +     L++++N+
Sbjct: 147 LFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENY 206

Query: 469 SSFM----------DPEVCSQFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALY 518
            + M          + +   +FI    I I+ ML +IP K+   W   +GDL+R+ + L 
Sbjct: 207 KNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLS 266

Query: 519 PSGFIDWKLSSEYWYN---------------QAXXXXXXXXXXXXHMSTIQQNTLEAFVN 563
                 ++L+S + YN               +             ++S +Q ++L   V 
Sbjct: 267 VKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVT 326

Query: 564 LGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLIEYLKHSEVMLLPNFIG 623
           L K +  ++T +      QL ID I  +   ++   N + S     +      LL  F G
Sbjct: 327 LSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQV--NLKQSMGGTTILMKYFTLLSLFFG 384

Query: 624 N------ENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKY----------FFR 667
           +        +++  + YF ++F  + H LN        L+ P N KY          +F 
Sbjct: 385 STSSSQLSGMERSSLHYFWNEFANEYH-LNYSS-----LRKPVNCKYRQKEINYSMFYFN 438

Query: 668 HAPAFAESHILQTVGFGDSKNPF 690
           +AP F+   I++T+      NPF
Sbjct: 439 NAPLFSLISIVETIIMNKKLNPF 461

>NDAI0D02240 Chr4 (524453..526699) [2247 bp, 748 aa] {ON} Anc_5.140
          Length = 748

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 268 NRIESHTETGHFEQHAFGNCNDVVKGNPDINGYENIDDDDGQYPNEPED 316
           ++I SH   G+FE   +GN +D V  N DI   E +D  D   PN P++
Sbjct: 422 HKIPSHVSRGNFEVSGYGNDDDFVDSN-DIWTIELVDQLDSSNPNYPKE 469

>KAFR0J02990 Chr10 (571614..573029) [1416 bp, 471 aa] {ON} 
          Length = 471

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 907 EKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPV 966
           E  GVS+  F DS +DG  FD ++ N   +     ++  LFK  ++T+ IG      A  
Sbjct: 141 EGSGVSNRPFDDSIVDGFDFDIENNNPTGYAALVTKLRTLFKSGSKTYYIG------AAP 194

Query: 967 YCRRDDVELNHIL 979
            C   D  + ++L
Sbjct: 195 QCVYPDASVGNLL 207

>Kpol_449.5 s449 (16801..18300) [1500 bp, 499 aa] {ON}
           (16801..18300) [1500 nt, 500 aa]
          Length = 499

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 721 NESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVL 780
           NE +    NI++D L +SD      E +Q    PPPR + W  SL  L  T   C  +V+
Sbjct: 31  NEDIADEKNIASDELTTSDG-----ERLQPG--PPPRLNFWDNSLKDLRFTI--CKQLVI 81

Query: 781 RKFLHG 786
             FL G
Sbjct: 82  NLFLLG 87

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {ON}
           Anc_7.17 YOR363C
          Length = 989

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 12/95 (12%)

Query: 793 PHLM-VWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIA--YALDNS 849
           P L+  +  ++I VCL S TL+   ++YF   +   LLP NS     N+  A   AL ++
Sbjct: 665 PQLLPFYQKYMIRVCLDSLTLISHITKYFNDEYAANLLPSNSY----NITKATQIALSST 720

Query: 850 YYSTLISSISEELDSMDL----QELLTKFNNNEEL 880
           ++  L   +  EL    L    QE LTK N++E L
Sbjct: 721 FFGVLGVIMRIELAGNTLFSQYQEDLTK-NDDENL 754

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 8/62 (12%)

Query: 904 NSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHT 963
           N+Y+  GV   + FD  + GI  +S+        K   +  F   KIA   D G TL +T
Sbjct: 298 NTYKDYGVKTPVQFDVTVQGIGIESE--------KACRQETFTTTKIAALMDSGTTLMYT 349

Query: 964 AP 965
           AP
Sbjct: 350 AP 351

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,246,960
Number of extensions: 6003134
Number of successful extensions: 20702
Number of sequences better than 10.0: 76
Number of HSP's gapped: 21232
Number of HSP's successfully gapped: 97
Length of query: 1295
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1173
Effective length of database: 39,492,147
Effective search space: 46324288431
Effective search space used: 46324288431
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)