Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0G02535g5.705ON1401407421e-102
YKR095W-A (PCC1)5.705ON88541825e-18
NCAS0A031805.705ON88551826e-18
Kpol_YGOB_1043.725.705ON88541819e-18
Skud_11.3355.705ON94571802e-17
Smik_11.3595.705ON88541773e-17
ZYRO0B16368g5.705ON85541773e-17
Suva_11.3325.705ON111551769e-17
SAKL0E14982g5.705ON89531704e-16
TBLA0G010305.705ON89841704e-16
KAFR0H001905.705ON82541686e-16
TDEL0B021505.705ON91901696e-16
KLTH0E00990g5.705ON89531696e-16
TPHA0E002005.705ON85531688e-16
KNAG0C066205.705ON101531671e-15
NDAI0E050605.705ON86771625e-15
AFR289W5.705ON81691609e-15
Kwal_YGOB_Anc_5.7055.705ON88531531e-13
KLLA0A00539g5.705ON87721522e-13
Ecym_40165.705ON125551394e-11
SAKL0B05984g8.791ON38044690.72
AFR234W3.536ON28255626.4
KAFR0C040202.633ON66718626.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G02535g
         (140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...   290   e-102
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...    75   5e-18
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...    75   6e-18
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...    74   9e-18
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...    74   2e-17
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...    73   3e-17
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...    73   3e-17
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...    72   9e-17
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...    70   4e-16
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...    70   4e-16
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...    69   6e-16
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...    70   6e-16
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...    70   6e-16
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...    69   8e-16
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...    69   1e-15
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...    67   5e-15
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    66   9e-15
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...    64   1e-13
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...    63   2e-13
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    58   4e-11
SAKL0B05984g Chr2 (507408..508550) [1143 bp, 380 aa] {ON} weakly...    31   0.72 
AFR234W Chr6 (863005..863853) [849 bp, 282 aa] {ON} Syntenic hom...    28   6.4  
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    28   6.7  

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
           [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
           Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
           unknown function
          Length = 140

 Score =  290 bits (742), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MSKNNTRDLSHTFTLTCITFLICTGYIYRDLHVPFETARDALIAQRVLQPDPILRPEDFQ 60
           MSKNNTRDLSHTFTLTCITFLICTGYIYRDLHVPFETARDALIAQRVLQPDPILRPEDFQ
Sbjct: 1   MSKNNTRDLSHTFTLTCITFLICTGYIYRDLHVPFETARDALIAQRVLQPDPILRPEDFQ 60

Query: 61  VEYEAKATVLDIHFKAIDDRVLRTYAYQGSMSIFHLLGTDDSEVVSKLRYIGQGRRGLKS 120
           VEYEAKATVLDIHFKAIDDRVLRTYAYQGSMSIFHLLGTDDSEVVSKLRYIGQGRRGLKS
Sbjct: 61  VEYEAKATVLDIHFKAIDDRVLRTYAYQGSMSIFHLLGTDDSEVVSKLRYIGQGRRGLKS 120

Query: 121 SSYQVYHKMLLCTIRYTDHI 140
           SSYQVYHKMLLCTIRYTDHI
Sbjct: 121 SSYQVYHKMLLCTIRYTDHI 140

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score = 74.7 bits (182), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (79%)

Query: 30 DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          +L +PFET R A IA +VL PDPIL+P+DFQV+Y ++  V+ + F++IDDRVLR
Sbjct: 14 ELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLR 67

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score = 74.7 bits (182), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%)

Query: 30 DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRT 84
          +L +PF T+R A IA +VL PDPIL+P+DFQVEY ++  +L +HF+ IDDRVLR 
Sbjct: 14 NLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRV 68

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score = 74.3 bits (181), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (77%)

Query: 30 DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          D  +PFETAR A IA +VL+PDPIL+P+DFQV Y +   +L + FK+IDDRVLR
Sbjct: 14 DFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLR 67

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score = 73.9 bits (180), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 45/57 (78%)

Query: 27 IYRDLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          ++++L +PFET   A IA +VL PDPIL+P+DFQV+Y ++  ++ + F++IDDRVLR
Sbjct: 17 VFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSIDDRVLR 73

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score = 72.8 bits (177), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 44/54 (81%)

Query: 30 DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          +L VPF+T + A+IA RVL PDPIL+P+DFQ++Y ++  V+ + F++IDDRVLR
Sbjct: 14 ELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLR 67

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score = 72.8 bits (177), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (79%)

Query: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRT 84
          L +PF   R + +A +VL+PDPILRPEDFQVEY++K  +L+I FK++DDRVLR 
Sbjct: 10 LTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
          [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score = 72.4 bits (176), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%)

Query: 29 RDLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          R+L +PFET + A IA RVL PDPIL+P+DFQ +Y ++  V+   F++IDDRVLR
Sbjct: 36 RELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLR 90

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score = 70.1 bits (170), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (73%)

Query: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          L +P ET   A+IA + L+PDP+L+PEDFQVEY A    L + FK+IDDRVLR
Sbjct: 15 LEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLR 67

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score = 70.1 bits (170), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (61%), Gaps = 17/84 (20%)

Query: 1  MSK-NNTRDLSHTFTLTCITFLICTGYIYRDLHVPFETARDALIAQRVLQPDPILRPEDF 59
          MSK +N   + HT TL                ++PF T++ A IA +VL+PDPILRP+DF
Sbjct: 1  MSKRDNNMQMEHTLTL----------------NIPFATSKQADIACQVLRPDPILRPQDF 44

Query: 60 QVEYEAKATVLDIHFKAIDDRVLR 83
          QV+Y +K   L + F++IDDRVLR
Sbjct: 45 QVKYTSKGNELVMEFQSIDDRVLR 68

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score = 69.3 bits (168), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%)

Query: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRT 84
          L +PFE A+ A IA  VL+PDPILRP+DFQV Y+A+  V    F++IDDRVLR 
Sbjct: 9  LEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRV 62

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 bp,
           91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score = 69.7 bits (169), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 8/90 (8%)

Query: 31  LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRTYAYQGS 90
           L +PF+TA  A IA++VL PDPIL+P+DFQV+Y     VL + F++IDDRVLR     G 
Sbjct: 9   LEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV----GV 64

Query: 91  MSIFHLLGTDDSEVVSKLRYIGQGRRGLKS 120
            S+   + T    +V  +  +G   + L+S
Sbjct: 65  SSVIDSIKT----IVETIDELGPETKELQS 90

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score = 69.7 bits (169), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%)

Query: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          L VPF+TA+ A  A +VL+PDPIL+P+DF VEY +KA  L + F+ +DDRVLR
Sbjct: 15 LEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLR 67

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 69.3 bits (168), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 45/53 (84%)

Query: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          L++PFET++ A IA +VL+PDP LRPE+F+V+Y ++ + L ++F+++DDRVLR
Sbjct: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLR 62

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score = 68.9 bits (167), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (71%)

Query: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          L+VPFET R ALIA +VLQPDPIL+P+DF V Y A+   L+  F   D RVLR
Sbjct: 17 LNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLR 69

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.705
           YKR095W-A
          Length = 86

 Score = 67.0 bits (162), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 4/77 (5%)

Query: 30  DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKAT----VLDIHFKAIDDRVLRTY 85
           ++ +PF   R A IAQ+VL PDPIL+PEDFQVEY   AT    VL + F++ID+RVLR  
Sbjct: 9   EIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLRVG 68

Query: 86  AYQGSMSIFHLLGTDDS 102
                 SI  +L T D 
Sbjct: 69  VSSVLDSIKTILETMDE 85

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 66.2 bits (160), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRTYAYQGS 90
          LHVPFE+AR A IA R L PDP+LRPE+  V + +    L+I   AID RVLR      +
Sbjct: 7  LHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV----AT 62

Query: 91 MSIFHLLGT 99
           SIF  L T
Sbjct: 63 NSIFEALKT 71

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score = 63.5 bits (153), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 38/53 (71%)

Query: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
          L VPF+  + A  A +VL+PDPIL+P+DF VEY + A  L + F+ +DDRVLR
Sbjct: 15 LEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLR 67

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp, 87
           aa] {ON} highly similar to uniprot|Q3E833 Saccharomyces
           cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score = 63.2 bits (152), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 46/72 (63%)

Query: 31  LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRTYAYQGS 90
           L +PFE+ + A +A++VL PDPI++PEDFQV Y  + T L   F+++D+R+LR       
Sbjct: 14  LEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVGVNSVI 73

Query: 91  MSIFHLLGTDDS 102
            SI  ++ T D 
Sbjct: 74  ESIKTIVETIDE 85

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 58.2 bits (139), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 37/55 (67%)

Query: 29  RDLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83
           R L VPFE  + A IA+ VL  DP+LRPEDF+V+Y  +   L ++F +ID R LR
Sbjct: 49  RCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLR 103

>SAKL0B05984g Chr2 (507408..508550) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|Q12507 Saccharomyces cerevisiae
           YOR315W Protein of unknown function found in the
           cytoplasm and the nucleus potential Cdc28p substrate
          Length = 380

 Score = 31.2 bits (69), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 77  IDDRVLRTYAYQG--SMSIFHLLGTDDSEVVSKLRYIGQGRRGL 118
           +D  V+R Y ++G  S S FH +  +     S+  Y+G+ R GL
Sbjct: 318 VDAAVIRAYEFEGTTSSSKFHWISKEKLGFYSEEEYLGKQRNGL 361

>AFR234W Chr6 (863005..863853) [849 bp, 282 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL224C (SDT1) and
           YER037W (PHM8)
          Length = 282

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 24/55 (43%)

Query: 40  DALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRTYAYQGSMSIF 94
           DAL  Q +LQPDP LR    ++    K   L +   A  +  LR     G   +F
Sbjct: 133 DALPLQNILQPDPELREMLLRLRTSGKVDKLWLSTNAYKNHGLRCVRLLGIADLF 187

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 28.5 bits (62), Expect = 6.7,   Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 26  YIYRDLHVPFETARDALI 43
           Y ++DLHV F T+RD LI
Sbjct: 178 YYFKDLHVAFVTSRDELI 195

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,562,770
Number of extensions: 526630
Number of successful extensions: 1551
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1550
Number of HSP's successfully gapped: 24
Length of query: 140
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 42
Effective length of database: 42,244,131
Effective search space: 1774253502
Effective search space used: 1774253502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 60 (27.7 bits)