Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0G02519g5.704ON37837820030.0
Kwal_55.196885.704ON3933817252e-92
ZYRO0G06556g5.704ON3793637224e-92
SAKL0E14960g5.704ON3843627001e-88
KLTH0E01012g5.704ON3863226843e-86
TPHA0D046205.704ON4063246784e-85
TDEL0B021605.704ON3753746737e-85
KAFR0H002005.704ON3893586703e-84
NCAS0A031905.704ON3983766671e-83
KNAG0C066105.704ON3863686052e-74
AFR288C5.704ON4653595885e-71
KLLA0A00550g5.704ON3803575772e-70
NDAI0E050505.704ON4513515265e-62
Kpol_YGOB_Anc_5.7045.704ON2071913464e-38
KAFR0G026206.48ON601131850.053
CAGL0L04554g6.48ON560119830.10
NDAI0K028706.48ON662195820.13
SAKL0E02068g6.48ON558130810.16
KNAG0M011106.48ON598186800.24
TPHA0J005306.48ON589129800.24
KNAG0E027306.48ON748152790.37
AGR256W6.48ON579137770.51
CAGL0K05995g6.48ON794179770.56
Ecym_31386.48ON588170770.56
KLTH0C10406g6.48ON553148750.86
NCAS0F002306.48ON605131750.92
TBLA0G004306.48ON954145751.1
KAFR0E029708.505ON43173741.2
Kwal_56.225506.48ON553130741.4
NDAI0A08900singletonON39346731.5
ZYRO0C07084g6.48ON64779722.0
Skud_7.2814.117ON1177113722.3
TDEL0G042206.48ON632164712.6
YGL006W (PMC1)4.117ON1173114713.3
KLTH0F05874g1.223ON2220140713.4
KAFR0A052506.48ON71770694.7
Smik_7.2844.117ON1177114687.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G02519g
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   776   0.0  
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   283   2e-92
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   282   4e-92
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   274   1e-88
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   268   3e-86
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   265   4e-85
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    263   7e-85
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      262   3e-84
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    261   1e-83
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   237   2e-74
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   231   5e-71
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   226   2e-70
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   207   5e-62
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   137   4e-38
KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {O...    37   0.053
CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa] ...    37   0.10 
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    36   0.13 
SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} simila...    36   0.16 
KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {...    35   0.24 
TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6....    35   0.24 
KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {O...    35   0.37 
AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic ...    34   0.51 
CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} simil...    34   0.56 
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    34   0.56 
KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {...    33   0.86 
NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48 ...    33   0.92 
TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48 ...    33   1.1  
KAFR0E02970 Chr5 (595353..596648) [1296 bp, 431 aa] {ON} Anc_8.5...    33   1.2  
Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260...    33   1.4  
NDAI0A08900 Chr1 complement(2049750..2050931) [1182 bp, 393 aa] ...    33   1.5  
ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {...    32   2.0  
Skud_7.281 Chr7 (488922..492455) [3534 bp, 1177 aa] {ON} YGL006W...    32   2.3  
TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {O...    32   2.6  
YGL006W Chr7 (485921..489442) [3522 bp, 1173 aa] {ON}  PMC1Vacuo...    32   3.3  
KLTH0F05874g Chr6 complement(514124..520786) [6663 bp, 2220 aa] ...    32   3.4  
KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6...    31   4.7  
Smik_7.284 Chr7 (477865..481398) [3534 bp, 1177 aa] {ON} YGL006W...    31   7.4  

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/378 (100%), Positives = 378/378 (100%)

Query: 1   MAAIVELCRNNGIKYSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVKSG 60
           MAAIVELCRNNGIKYSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVKSG
Sbjct: 1   MAAIVELCRNNGIKYSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVKSG 60

Query: 61  TSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDT 120
           TSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDT
Sbjct: 61  TSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDT 120

Query: 121 SISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPL 180
           SISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPL
Sbjct: 121 SISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPL 180

Query: 181 PLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVG 240
           PLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVG
Sbjct: 181 PLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVG 240

Query: 241 IAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRG 300
           IAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRG
Sbjct: 241 IAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRG 300

Query: 301 YHNKDGEDIQEIGTIYQCFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLEDCNSKDNEYK 360
           YHNKDGEDIQEIGTIYQCFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLEDCNSKDNEYK
Sbjct: 301 YHNKDGEDIQEIGTIYQCFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLEDCNSKDNEYK 360

Query: 361 ILIRFIDDHAIMVYQNQM 378
           ILIRFIDDHAIMVYQNQM
Sbjct: 361 ILIRFIDDHAIMVYQNQM 378

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  283 bits (725), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 159/381 (41%), Positives = 235/381 (61%), Gaps = 14/381 (3%)

Query: 1   MAAIVEL---CRNNGIKYSVEIVEVKG-KVESYKLIK-ANDR---STDCFLKFDRDTQII 52
           MA IVE+   C +N  ++SV +VE +G K  S+ L++  ND+   + D  L   +   I+
Sbjct: 1   MAQIVEVPLVCSHN-TQFSV-VVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDIL 58

Query: 53  VIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYD 112
           V+DS+KSGT R+ ++D    VI+P+F  LG++Y+ +KTE+ENS+ +  R      G    
Sbjct: 59  VVDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFR-PCGQNTT 117

Query: 113 ILFLSGDTSISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLN 172
           ++FLSGDTSISEF+N L      + +  +++L +PLG+GNA A SLGF+T   AL  +L 
Sbjct: 118 VIFLSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQ 177

Query: 173 SNKKCSPLPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVF 232
              K    PLY A  PN   ++FFIILS+GFHANLLH  + P++K +GVERF++ASK +F
Sbjct: 178 GFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIF 237

Query: 233 ESYDLNVGIAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLED 292
           E Y L+  + V     + YSYFA+I  PNLE  YKPSPKS+ L  ELH+LGY +G+    
Sbjct: 238 EDYILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPM 297

Query: 293 LQDKIMRGYHNKDGEDIQEIGTIYQCFQKNLELSIKTGHN-APKYRYDMCIDGYLLNLED 351
           L ++IM+GY N+   DI E G  YQ F  +L++         P+  +D+C DG+LLN+  
Sbjct: 298 LINRIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLS 357

Query: 352 CNSKDNEY--KILIRFIDDHA 370
                  +  +I ++F+ +H+
Sbjct: 358 QQPAHGSFDGRIHVKFLKEHS 378

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  282 bits (722), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 152/363 (41%), Positives = 227/363 (62%), Gaps = 10/363 (2%)

Query: 13  IKYSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVKSGTSRNDRSDLYKL 72
            +Y V   +   K  S++L K++ + +        D+ +IV+DS+KSG  R + +D Y +
Sbjct: 13  FEYYVTFAKDGSKYTSFQLEKSHAKQSSRASTRSDDSTLIVLDSLKSGIGRTENNDFYSI 72

Query: 73  VIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSISEFINALDTT 132
           VI P+ + L   + YIKT S +S+  FA+  S      Y+I  +SGDT+ISEF N L   
Sbjct: 73  VIAPILEELNWNHNYIKTTSHDSVSQFAQ--SLDPLQDYEIWIISGDTTISEFCNNLPNK 130

Query: 133 ILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLYDAQLPNSTS 192
            +     RI  LP+P+G+GNA A SLGF +P+ A   YLN N K   +PLY A LPN  S
Sbjct: 131 KITRNPLRI--LPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNGYS 188

Query: 193 MIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNGLQSQSYS 252
           +IFF+I SLGFHANLLH  EDPKY  MG ERFQ+A++++ ESY L++ I+++GL+ +SY+
Sbjct: 189 IIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLDGLR-RSYA 247

Query: 253 YFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRGYHNKDGEDI-QE 311
           YFA+I  PNLE TYKPSP+S+ L++EL +LGY + +  ++L +KIM+GY NK   D+   
Sbjct: 248 YFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQNKPNGDLPTN 307

Query: 312 IGTIYQCFQKNLELSIKTG-HNAPKYRYDMCIDGYLLNLEDCNSKDNEY---KILIRFID 367
              IY+    +  L +     ++  +++++C DG LLNL D  S D      +I  +F++
Sbjct: 308 EDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRFQFLN 367

Query: 368 DHA 370
           D++
Sbjct: 368 DYS 370

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  274 bits (700), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 150/362 (41%), Positives = 224/362 (61%), Gaps = 10/362 (2%)

Query: 15  YSVEIVEVKGKVESYKLIKANDRST--DCFLKF-DRDTQIIVIDSVKSGTSRNDRSDLYK 71
           YSV+I E  G V S  ++KA   ST     +     ++++I++DSV SG  R  ++D   
Sbjct: 17  YSVDI-EKDGSVYSSFVLKAEKLSTVSSSLISLPSANSELIILDSVMSGIGRKTQADFST 75

Query: 72  LVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSISEFINALDT 131
            VI+P+ + LG E+K IKT+S  SI +FAR    +    Y I+FLSGDTSISEF+N + T
Sbjct: 76  QVIKPILEKLGAEHKIIKTQSSTSIAEFARE--IEPSKSYTIIFLSGDTSISEFLNHIPT 133

Query: 132 TILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLYDAQLPNST 191
               S K+ ++I P+P+G+GNA A+SL  K P+++   +L ++   S  PLY A  PN  
Sbjct: 134 QNSNS-KHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASKFPLYRASFPNGY 192

Query: 192 SMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNGLQSQSY 251
           S IFFIILS+GFHANLLH     KYK MGVERF+ AS  +F++YDL   +++    S  Y
Sbjct: 193 STIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKYKVSIPNRVSGCY 252

Query: 252 SYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRGYHNKDGEDIQE 311
           +YFA+I  PNLEPTYKPSP S  L   LH+LG+++ +   +L  +I RG   + G+DI +
Sbjct: 253 AYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITRGRTAQKGDDIMD 312

Query: 312 IGTIYQCFQKNLELSIKTGHNAP-KYRYDMCIDGYLLNLEDCNSKDNEY--KILIRFIDD 368
            G IY+  +K+ ++ ++   +A  + ++++C DG LLNL D    +  +   I + F+ D
Sbjct: 313 TGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEGSFDGTIKVSFLQD 372

Query: 369 HA 370
           ++
Sbjct: 373 YS 374

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  268 bits (684), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 133/322 (41%), Positives = 205/322 (63%), Gaps = 6/322 (1%)

Query: 51  IIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFK 110
           I+++DS+KSGT R+ R++  K V+EPLF  LG+ +K ++T+  ++        +FQ   +
Sbjct: 56  ILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGH--TFQPSTE 113

Query: 111 YDIL-FLSGDTSISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALIT 169
             IL FLSGDT+ISEF+N L+  +    ++ +S++P+PLG+GNA A SLG + P  +L  
Sbjct: 114 NTILIFLSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSC 173

Query: 170 YLNSNKKCSPLPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASK 229
           +L         PLY A  PN   MIFFIILS+GFHANLLH  +  +++S+GVERF++AS 
Sbjct: 174 FLQGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASL 233

Query: 230 TVFESYDLNVGIAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGIC 289
            + + Y L   + V+GL ++ YSYFA+I  PNLE +YKPSP+S+ L  +LH+LGY + + 
Sbjct: 234 EILQKYPLEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQ 293

Query: 290 LEDLQDKIMRGYHNKDGEDIQEIGTIYQCFQKNLELSI-KTGHNAPKYRYDMCIDGYLLN 348
              L  KIM+GY N+ G+DI   G IY+ +   LE+   +   N     +++C DG+LLN
Sbjct: 294 QASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLN 353

Query: 349 LEDCNSKDNEY--KILIRFIDD 368
           +     +D ++  +I I+F+ +
Sbjct: 354 MLSLQPQDQKFDGRIRIQFLKN 375

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  265 bits (678), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 202/324 (62%), Gaps = 20/324 (6%)

Query: 49  TQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSG 108
           ++++VIDS+ SG  R  ++D Y  V++P+F+    ++KYI+TE E+SI+D A  T F++ 
Sbjct: 58  SELVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLA--TKFEAS 115

Query: 109 FKYDILFLSGDTSISEFINALDTTILRSA-------KYRISILPVPLGSGNALATSLGFK 161
             Y I+FLSGDTS+SEFIN L T + +         K +++I  +PLG+GNALA+S+   
Sbjct: 116 KDYTIIFLSGDTSVSEFINNL-TKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174

Query: 162 TPLQALITYLNSNKKCSPLPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGV 221
           +P Q    +LN+       PLY   LPN  ++IFFII S+GFHANLLH  +  +Y+ MG 
Sbjct: 175 SPHQVFQKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGT 234

Query: 222 ERFQVASKTVFESYDLNVGIAV-NGLQ--SQSYSYFAVIAAPNLEPTYKPSPKSSVLKKE 278
           ERF  AS+ +F++YDLN+G+   NG +  S++Y+YFA+I  PNLE  Y PSP S V K E
Sbjct: 235 ERFAKASENIFKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNE 294

Query: 279 LHILGYKAGICLEDLQDKIMRGYHNKDGEDIQEIGTIYQCFQKNLE-------LSIKTGH 331
           LH+LGY A +  E L +KIM GY  K+ E I     +   +  NL        L   +  
Sbjct: 295 LHLLGYDASLSTEKLVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDK 354

Query: 332 NAPKYRYDMCIDGYLLNLEDCNSK 355
              KY+YD+C DG LLNL+D N++
Sbjct: 355 KLEKYKYDICCDGLLLNLDDINNQ 378

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  263 bits (673), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 148/374 (39%), Positives = 228/374 (60%), Gaps = 23/374 (6%)

Query: 5   VELCRNNGIKYSVEIVEVKGKVES-YKLIKANDRSTDCFLKFDRDTQ----IIVIDSVKS 59
           ++L   +GI YSV    +    ES ++L+K    + D     DR  Q    +IVIDSV S
Sbjct: 7   IKLLNIHGICYSV----ISEPSESRFQLVKTATTTED-----DRTVQNQPNLIVIDSVHS 57

Query: 60  GTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGD 119
           G  R  ++DLY +V++P+F+++ ++++ IKT S ++I  +A          + +LFLSGD
Sbjct: 58  GKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQS--HTVLFLSGD 115

Query: 120 TSISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSP 179
           TSISEFIN L      +    +SIL  P+GSGNA A+SLG   P++    ++      SP
Sbjct: 116 TSISEFINNLPQG---APSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSP 172

Query: 180 LPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNV 239
            PLY A  PN  S++FFIILS+GFHANL+H  E P+Y+ MG+E+FQ+A   + + Y+L++
Sbjct: 173 FPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDL 232

Query: 240 GIAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMR 299
            I VN L + SYSYFA+I  PNLEP Y+PSP+S  LK+EL++LGY +G+  +    K+M+
Sbjct: 233 KITVNSL-AASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQFLTKVMK 291

Query: 300 GYHNKDGEDIQ-EIGTIYQCFQKNLELSIKTG-HNAPKYRYDMCIDGYLLNLEDCNSK-D 356
           GY     + +  +  TIY  F K  ++++      +P+Y+ ++C DG LLNL+D  +  +
Sbjct: 292 GYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLE 351

Query: 357 NEYKILIRFIDDHA 370
              K  I F++ ++
Sbjct: 352 VSNKFSIEFLNHYS 365

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  262 bits (670), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 145/358 (40%), Positives = 218/358 (60%), Gaps = 10/358 (2%)

Query: 1   MAAIVE-LCRNNGIK-YSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVK 58
           +A  +E LC  NG + + V+I +   K  ++KL+ A +   D          ++VIDSV 
Sbjct: 4   LATTIEPLCTVNGSQSFEVKITKDGSKYHAFKLV-AKEVKDDKPCSPPHYENVVVIDSVS 62

Query: 59  SGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSG 118
           SGT RN  +  Y +VI+P+F    +++ Y KT    SI  +A+         Y ++F+SG
Sbjct: 63  SGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKS--YTVIFISG 120

Query: 119 DTSISEFINALDTTILRS--AKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKK 176
           DTSISEFIN L   +  S   K+ ISILP+P+G+GNA ++S+G K P+Q L ++L++  +
Sbjct: 121 DTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQ 180

Query: 177 CSPLPLYDAQLPNSTSMIFFIILSLGFHANLLH-CAEDPKYKSMGVERFQVASKTVFESY 235
            S  PLY+   PN  ++IFFIILSLG HAN+LH C  DP+YK  G ERF++A + V  +Y
Sbjct: 181 PSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTY 240

Query: 236 DLNVGIAVNGLQ-SQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQ 294
           DLNV + +  L  S ++SYF +I  PNLE +Y PSP S    ++LH+LGY + +  EDL 
Sbjct: 241 DLNVRLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLL 300

Query: 295 DKIMRGYHNKDGEDIQEIGT-IYQCFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLED 351
           + + +GY NK G+++ E    +Y+   +N+ + +     + KY+YD+C DG L NL D
Sbjct: 301 NYVTQGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEESEKYKYDICCDGLLFNLRD 358

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  261 bits (667), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 148/376 (39%), Positives = 216/376 (57%), Gaps = 22/376 (5%)

Query: 15  YSVEIVEVKGKVESYKLI--KANDRSTDCFLKFD--RDT-QIIVIDSVKSGTSRNDRSDL 69
           Y VE V      +S+ L+   +   S D  L+F   +DT Q+IVIDS+ SG  R   +D 
Sbjct: 17  YYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSDNDF 76

Query: 70  YKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSISEFINAL 129
           Y+ V+EP+F  L + +  +KT S++S+ +FA +        Y+I FLSGDT+ISEFIN L
Sbjct: 77  YRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTK--HYEIFFLSGDTTISEFINGL 134

Query: 130 DTTIL--RSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLYDAQL 187
               L    AK  +SILP P G+GNALA SLG   P      YL SN   +  PLY A  
Sbjct: 135 PKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFPLYKAIF 194

Query: 188 PNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNG-- 245
           PN   ++FF+ILSLGFHANLLHC E P YK +GVERF++AS+ +  +YDL++ I++    
Sbjct: 195 PNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILANYDLDLNISIESPR 254

Query: 246 -----LQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRG 300
                + S+ YSYF V+  P LE  Y PSP+S+ L+ +LHI+ Y + +  ++L  +I++G
Sbjct: 255 GLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARILKG 314

Query: 301 YHNKDGEDIQEIGTIYQCFQKNLELSIKTGHN-APKYRYDMCIDGYLLNLEDCNSKDN-- 357
           Y N  G+ +   G  Y   + N  + +      +P  ++ +C DG L NL D   K++  
Sbjct: 315 YENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDFIHKNDNG 374

Query: 358 ---EYKILIRFIDDHA 370
                +ILI F+  ++
Sbjct: 375 PCKNNEILIEFLSTYS 390

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  237 bits (605), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 139/368 (37%), Positives = 219/368 (59%), Gaps = 16/368 (4%)

Query: 4   IVELCRNNGIKYSVEIVEVKGKVESYKLIKANDRSTDCFLK--FDRDTQIIVIDSVKSGT 61
           +V+ C   G + SVEI +   K   + L+ +     +C     F R+  +IV+DSV SGT
Sbjct: 9   LVDFC---GERISVEIDKDGSKYTKFALL-SEPCPQECAPPQLFTREN-LIVLDSVHSGT 63

Query: 62  SRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTS 121
            R   +D+   VIEP+ + L   Y+ +K+++  S+ +F  +        Y ILF+SGDTS
Sbjct: 64  GRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQ--LDPTQSYTILFVSGDTS 121

Query: 122 ISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLP 181
           +SEF N +   +  S +  ++ILP+ +G+GNALA SL    P++A  ++L      +  P
Sbjct: 122 VSEFFNGVGAGV-PSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAEFP 180

Query: 182 LYDAQLPNS-TSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVG 240
           LY A LP+  TS++FFI+LSLGFHANLLH AE+ KYKSMGVERFQ AS  + ++Y L   
Sbjct: 181 LYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQEQ 240

Query: 241 IAVN--GLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIM 298
           I ++  G+ + SY+YFA++  PNLE +Y PSP+S   K ELH+L Y + +  + L ++IM
Sbjct: 241 ITLDKQGV-AGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIM 299

Query: 299 RGYHNKDGEDI-QEIGTIYQCFQKNLELSIKTGHNAPK-YRYDMCIDGYLLNLEDCNSKD 356
            GY N+ G+++  +  T Y+   +  E+ ++     P    +++C+DG L NL    S  
Sbjct: 300 AGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKSDQ 359

Query: 357 NEYKILIR 364
           ++ ++ I+
Sbjct: 360 HQEELTIQ 367

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  231 bits (588), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 125/359 (34%), Positives = 199/359 (55%), Gaps = 17/359 (4%)

Query: 6   ELCRNNGIKYSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVKSGTSRND 65
           EL    G++Y+V  +  +GK+ S +L     R  +          ++V+DSV+SG  R  
Sbjct: 95  ELFCKEGLEYAVAELWEEGKLRSVELAVREGRGAEARAP---GGPLVVLDSVRSGAGREP 151

Query: 66  RSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSISEF 125
            +D Y  V+ P+   L VE++Y++T S  S+R+ A   +F    +  +L +SGDT+ISEF
Sbjct: 152 ATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAE--TFPRTSETTVLVMSGDTTISEF 209

Query: 126 INALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLYDA 185
           +NAL +         +++  +PLG+ NA A S+G  TP +AL  ++       P PLY A
Sbjct: 210 VNALGSGA------GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGRVHAVPFPLYRA 263

Query: 186 QLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNG 245
           + P+  S+ FFI+LS GFHANLLH   D +Y+ +GVERF+ AS  + + Y L   + V  
Sbjct: 264 RFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYALAEHVRVRA 323

Query: 246 LQSQS-----YSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRG 300
                     Y+YFA++  P+LE TY PSP S  L K+LH+L ++A +  + L + +M G
Sbjct: 324 ADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMAG 383

Query: 301 YHNKDGEDIQEIGTIYQCFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLEDCNSKDNEY 359
           Y    G  +   G +Y+    +  LSI+ G  + +   ++C+DG+LLNL D  +  + +
Sbjct: 384 YSTIRGSALSAPGLVYRNLGDSFTLSIENG-ASDRVANELCVDGHLLNLVDLQAPGDVF 441

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  226 bits (577), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 134/357 (37%), Positives = 202/357 (56%), Gaps = 18/357 (5%)

Query: 6   ELCRNNGIKYSVEIVEVKGKVESYKLIKA--NDRSTDCFLKFDRDTQIIVIDSVKSGTSR 63
           EL   NG+ +++    +    +SY+L     +D       KF+   +++++DSV SG+ R
Sbjct: 14  ELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLDDEKLLANKKFEYSGELLIVDSVFSGSGR 73

Query: 64  NDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSIS 123
           +   D    VI   F+ + V Y+ IKT S++S+ + A  +S  S  +Y +LFLSGDTSIS
Sbjct: 74  DKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELA--SSIDSTRQYTVLFLSGDTSIS 131

Query: 124 EFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLY 183
           EF+N L           IS+LP P+G+GNA A+SL    P      ++N    C+  PLY
Sbjct: 132 EFVNNLPLN-----HDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLSCNDFPLY 186

Query: 184 DAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAV 243
            A   N   + FFIILSLGFHANLLH  E+ +Y+ MG+ERF+VAS+ +   Y L   +++
Sbjct: 187 RATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKLESRVSI 246

Query: 244 NGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRGYHN 303
             +   S+SYFA+I   NLEPTY PSP S  L+ +LH+L Y++ +   + Q ++  GY N
Sbjct: 247 PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQKRVFMGYSN 306

Query: 304 KDGEDIQEIGTIYQ----CFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLEDCNSKD 356
               +I + GT Y+    CF  N+E+       + K  +++C DG LLNL +   K+
Sbjct: 307 TKHSNILQNGTFYRPLPFCF--NVEV---LDDPSQKSNFEVCCDGQLLNLLELEGKN 358

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  207 bits (526), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 193/351 (54%), Gaps = 39/351 (11%)

Query: 38  STDCFLKFD---RDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESEN 94
           S D  L  D    +T++I+IDS  SG  RN  +D Y +++EP+   L ++++  KT S++
Sbjct: 68  SKDLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKD 127

Query: 95  SIRDFARRTSFQSG----FKYDILFLSGDTSISEFINALDTTILRSAKYRISILPVPLGS 150
           SI+ FA   S ++       Y+++FLSGDT+ISEF N L     +++K  ++IL +P+G+
Sbjct: 128 SIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGT 187

Query: 151 GNALATSLGFKTPLQALITYLNSNKKCSPLPLYDAQLPN-------------STSMIFFI 197
            NA + SL    P+     +L +    SP PLY   LP+               ++ FFI
Sbjct: 188 ANAWSNSLNLNCPIDIFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFI 247

Query: 198 ILSLGFHANLLH-CAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNG-------LQSQ 249
           +LS+GFHANLLH C+ D KY ++G+ERF++AS  +  +Y+LN+ I +         + + 
Sbjct: 248 VLSMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILND 307

Query: 250 SYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAG-ICLEDLQDKIMRGYHNKDG-- 306
           S+SYF ++  P LE  Y PSP S  LK  LH+L YK+     + L   IM+GY N+ G  
Sbjct: 308 SFSYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQK 367

Query: 307 --EDIQEIGTIY-QCFQKNLELSIKT-----GHNAPKYRYDMCIDGYLLNL 349
             ++I E G IY     K  ++++          +  + Y++C DG L NL
Sbjct: 368 NIQNIDEDGIIYFPINDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNL 418

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  137 bits (346), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 119/191 (62%), Gaps = 7/191 (3%)

Query: 185 AQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVN 244
           A  P+ + + FFIILSLGFHA LLH    P+   MG ERFQ+A+K + E+YDL++ I VN
Sbjct: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61

Query: 245 GLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRGYHNK 304
              ++ Y+YFA+I   NLE TY PSPKS+VL+  L +LGY + +   +L DKIM+GY  +
Sbjct: 62  K-STRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120

Query: 305 DGEDIQ-EIGTIYQCF---QKNLELSI-KTGHNAPKYRYDMCIDGYLLNL-EDCNSKDNE 358
            G+ I+ +  T Y+     Q  +++ + +  +N+  +++++C DG LL+L E    + + 
Sbjct: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLMEKSKGRTDN 180

Query: 359 YKILIRFIDDH 369
             I I  + D+
Sbjct: 181 LTIHINSVKDY 191

>KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {ON}
           Anc_6.48 YOR171C
          Length = 601

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 62/131 (47%), Gaps = 8/131 (6%)

Query: 46  DRDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSF 105
           DR+  +++I +   G  +  +  L++  +EP+ +    +++   TE        AR+   
Sbjct: 224 DRNKSLLIIINPHGGKGKALK--LFQEHVEPILKLTFFKFEVKLTEYHRHAMQIARKLDL 281

Query: 106 QSGFKYD-ILFLSGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSL-GFKT 162
               K+D I+  SGD    E IN L     RS  + ++ +  +P GSGNA++ S  G   
Sbjct: 282 D---KFDTIVCASGDGIPYEVINGLYQRTDRSNAFNKLCVTQLPCGSGNAMSISCHGTGN 338

Query: 163 PLQALITYLNS 173
           P  A ++ L S
Sbjct: 339 PSHATLSLLKS 349

>CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YOR171c LCB4
          Length = 560

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 13/119 (10%)

Query: 47  RDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQ 106
           R+  I+VI +   G  +     ++K  IEP+  +    ++ ++T+      D AR    +
Sbjct: 166 RNRSILVIINPHGGKGK--AMHIFKKRIEPILIASECSFELMETKYSRHATDIAREIDLE 223

Query: 107 SGFKYD-ILFLSGDTSISEFINALDTTILRSAKY----RISILPVPLGSGNALATSLGF 160
              ++D I   SGD    E IN L    +R  K     +I++  +P GSGNA++ S  +
Sbjct: 224 ---EFDTIACASGDGVPYEVINGL---YMREDKVDAFNKITVTQLPCGSGNAMSISCHW 276

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 78/195 (40%), Gaps = 34/195 (17%)

Query: 67  SDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFL-SGDTSISEF 125
           S L+    +P+  +   +++ I T   +   D A+        KYDI+   SGD    E 
Sbjct: 277 SKLFNKWSKPILSTSNCKFEIINTTYSSHATDIAKSLDIS---KYDIIACASGDGIPYEV 333

Query: 126 INALDTTILRSAKY-RISILPVPLGSGNALATSLGFK-TPLQALITYLNSNKK-----CS 178
           IN L     R   + +++I  +P GSGNA++ S  +      A +  L S +K     C 
Sbjct: 334 INGLYQRPDRVDAFNKLTITQIPCGSGNAMSISCHWTDNTSHATLCLLKSIEKRIDLMCC 393

Query: 179 PLPLYDAQLPNST--SMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYD 236
             P Y  Q P  +  S  F +I     +   +        + MG  RF+           
Sbjct: 394 SQPSYANQSPRLSFLSQTFGVIAESDINTEFI--------RWMGPVRFE----------- 434

Query: 237 LNVGIAVNGLQSQSY 251
             +G+A N +Q + Y
Sbjct: 435 --LGVAYNVIQGKRY 447

>SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} similar
           to uniprot|Q12246 Saccharomyces cerevisiae YLR260W LCB5
           Minor sphingoid long-chain base kinase paralog of Lcb4p
           responsible for few percent of the total activity
           possibly involved in synthesis of long-chain base
           phosphates which function as signaling molecules and
           similar to YOR171c
          Length = 558

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 8/130 (6%)

Query: 47  RDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQ 106
           R+  I+VI +   G  R ++  LY    +P+  +     + ++T       D A+     
Sbjct: 178 RNKSILVIINPHGGKGRANK--LYVSKAKPILIASQCTVEILETTYHRHAIDIAQNIDID 235

Query: 107 SGFKYDILFL-SGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSL-GFKTP 163
              KYD++   SGD    E +N L     R+  + +++I  +P GSGNA++ S  G   P
Sbjct: 236 ---KYDVIACASGDGIPHEVLNGLYRRADRAKAFNKVAITQLPCGSGNAMSVSCHGTSNP 292

Query: 164 LQALITYLNS 173
             A ++ + S
Sbjct: 293 SHAALSLVKS 302

>KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {ON}
           Anc_6.48 YOR171C
          Length = 598

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 73/186 (39%), Gaps = 33/186 (17%)

Query: 76  PLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYD-ILFLSGDTSISEFINALDTTIL 134
           P+  + G +Y    TE      + A         KYD I+  SGD    E +N L   I 
Sbjct: 215 PILDASGSDYDIAYTERSRHAVEIAESLDID---KYDTIVCASGDGIPYEVLNGLYRRID 271

Query: 135 RSAKY-RISILPVPLGSGNALATSLGFKTPLQ-ALITYLNSNKK-----CSPLPLYDAQL 187
           R A + +I +  +P GSGNA++ S  +      A +  L S +      C   P Y  Q 
Sbjct: 272 RVAAFNKIVVTQLPCGSGNAMSISCHWTMNTSYAALCLLKSQESRIDVMCCQQPSYSDQP 331

Query: 188 PNS-TSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNGL 246
             S  S  + II     +   +        + MG  RF             N+G+A N L
Sbjct: 332 RLSFLSQTYGIIAESDINTEFI--------RWMGPIRF-------------NIGVAFNLL 370

Query: 247 QSQSYS 252
           Q ++Y+
Sbjct: 371 QGKTYA 376

>TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6.48
           YOR171C
          Length = 589

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 8/129 (6%)

Query: 50  QIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGF 109
           +I+VI +   G  + +   +Y    EP+ ++         T+      D AR        
Sbjct: 202 RILVIVNPHGG--KGNAKKIYLSKCEPILKASTATVDIAYTKYAGHAIDIAREVDLS--- 256

Query: 110 KYD-ILFLSGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSLGFKT-PLQA 166
           KYD I   SGD    E IN L+    R   + ++++  +P GSGNA++ S  + T P  A
Sbjct: 257 KYDTIACASGDGIPYEVINGLNQRSDRVDAFNKLAVTQIPCGSGNAMSVSCHWTTDPSLA 316

Query: 167 LITYLNSNK 175
            +  L  N+
Sbjct: 317 TLCVLKGNE 325

>KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {ON}
           Anc_6.48 YOR171C
          Length = 748

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 63/152 (41%), Gaps = 31/152 (20%)

Query: 110 KYD-ILFLSGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSLGF-KTPLQA 166
           KYD I   SGD    E IN L     R   + +++I  +P GSGNA++ S  +   P  A
Sbjct: 410 KYDTIACASGDGIPHEVINGLYRRHDRVRAFNKLAITEIPCGSGNAMSVSCNWTNNPSYA 469

Query: 167 LITYLNSNKK-----CSPLPLYDAQLPNST--SMIFFIILSLGFHANLLHCAEDPKYKSM 219
            +  + S +      C   P Y+A +P  +  S  + II     +   +        + M
Sbjct: 470 TLFIIKSVETRSDIMCLSQPSYEAGVPKLSFLSQTYGIIAESDINTEFI--------RWM 521

Query: 220 GVERFQVASKTVFESYDLNVGIAVNGLQSQSY 251
           G  RF+             +G+A N LQ + Y
Sbjct: 522 GPARFE-------------LGVAFNILQRKKY 540

>AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR260W (LCB5) and
           YOR171C (LCB4)
          Length = 579

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 42  FLKFDRDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFAR 101
           ++   R+  I+VI +   G  +  +  LY    +P+  +   +   ++T+  +   + A 
Sbjct: 187 YMNTKRNKSILVIINPYGGKGKAHK--LYVTKAKPILVASDCQIDVVETKYSSHAAEIAA 244

Query: 102 RTSFQSGFKYDILFL-SGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSL- 158
                   KYD++   SGD    E +N L T   R A + +++I  +P GSGNA++ S  
Sbjct: 245 TMDIN---KYDVIACASGDGIPHEVLNGLFTRPDRVAAFNKLAITQLPCGSGNAMSISCH 301

Query: 159 GFKTPLQALITYLNSNK 175
           G   P  A ++ + + +
Sbjct: 302 GTSNPSYASLSLVKATE 318

>CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} similar
           to uniprot|Q06147 Saccharomyces cerevisiae YLR260w
           sphingolipid long chain base kinase
          Length = 794

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 70/179 (39%), Gaps = 36/179 (20%)

Query: 83  VEYKYIKTESENSIRDFARRTSFQSGFKYD-ILFLSGDTSISEFINALDTTILRSAKY-R 140
           VE KY K   E    D AR        KYD I+  SGD    E IN L     R   + +
Sbjct: 435 VEIKYTKYPQE--AIDIAREMDIS---KYDTIVCASGDGIPYEVINGLYRRPDRVEAFNK 489

Query: 141 ISILPVPLGSGNALATSLGF-KTPLQALITYLNSNKK-----CSPLPLYDAQLPNST--S 192
           ++I  +P GSGNA++ S  +   P  A +  L S +      C   P Y  + P  +  S
Sbjct: 490 LAITQLPCGSGNAMSVSCHWTNNPSYAALCLLKSVEARIDLMCCSQPSYADEYPKLSFLS 549

Query: 193 MIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNGLQSQSY 251
             + +I     +   +          MG  RF+             +G+A N LQ + Y
Sbjct: 550 QTYGVIAESDINTEFIRW--------MGPARFE-------------LGVAFNVLQRKKY 587

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 76/170 (44%), Gaps = 23/170 (13%)

Query: 9   RNNGIKYSVEIVEVKGKV--ESYKLIKANDRSTDCFLKFDRDTQIIVIDSVKSGTSRNDR 66
           R++G+  + E V+V  K+   SYK  K             R+  I+VI +   G  R ++
Sbjct: 172 RSSGLLCNEENVDVVEKILERSYKNTK-------------RNKSILVIINPHGGRGRANK 218

Query: 67  SDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFL-SGDTSISEF 125
             +Y    +P+  + G   +  +T       + AR        KYD++   SGD    E 
Sbjct: 219 --IYVTKAKPILIASGCYVEVFQTSYPEHAIEIARTMDID---KYDVIACASGDGIPYEV 273

Query: 126 INALDTTILRSAKY-RISILPVPLGSGNALATSL-GFKTPLQALITYLNS 173
           +N L     R+  + ++++  +P GSGNA++ S  G   P  A ++ + +
Sbjct: 274 LNGLYRREDRAKAFNKVAVTQLPCGSGNAMSVSCHGTNNPAYAALSLVKA 323

>KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of long-
           chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 553

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 62/148 (41%), Gaps = 13/148 (8%)

Query: 47  RDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQ 106
           R+  I+VI +   G     +  LY   ++P+  +     + ++T       D A+     
Sbjct: 176 RNKTILVIMNPHGGKGHAKK--LYLSKVKPILAASNCTVETVETTYHGHATDLAKTVDAD 233

Query: 107 SGFKYDILFL-SGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSL-GFKTP 163
              K+DI+   SGD    E +N L     R+  + ++ I  +P GSGNA++ S  G   P
Sbjct: 234 ---KFDIIACASGDGIPHEVLNGLFQRPDRADAFNKLIITQLPCGSGNAMSVSCHGTTNP 290

Query: 164 LQALITYLNSNK-----KCSPLPLYDAQ 186
             A +  L + +      C   P Y  Q
Sbjct: 291 SHAALNILKAPEIRIDLMCCSQPSYKDQ 318

>NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48
           YLR260W
          Length = 605

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 59/131 (45%), Gaps = 8/131 (6%)

Query: 46  DRDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSF 105
           +R+  I+VI +   G  +     L++   +P+  +     + I T+      D A+    
Sbjct: 217 NRNRSILVIINPHGGKGKAKL--LFEKKAKPILIASNCSLEIIHTKYSRHALDIAKDLDI 274

Query: 106 QSGFKYDILFL-SGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSLGFK-T 162
               KYD++   SGD    E IN L     R+  + +++I  VP GSGNA++ S  +   
Sbjct: 275 T---KYDVIACASGDGIPYEVINGLYQRPDRADAFNKLTITQVPCGSGNAMSISCHWTDN 331

Query: 163 PLQALITYLNS 173
           P  A +  L S
Sbjct: 332 PSHAALCLLKS 342

>TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48
           YOR171C
          Length = 954

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 65/145 (44%), Gaps = 20/145 (13%)

Query: 110 KYD-ILFLSGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSLGF-KTPLQA 166
           KYD IL  SGD    E IN L     R+  + +++I  +P GSGNA++ S  +   P  A
Sbjct: 633 KYDTILCASGDGIPYEIINGLYQRPDRAKAFEKLAITELPCGSGNAMSVSCFWTNNPSYA 692

Query: 167 LITYLNSNKKCSPLPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQV 226
            ++ + S +K   + L     PN    + F+  + G  A      E  ++  +G  RF+ 
Sbjct: 693 ALSLVKSIEK--RIDLMCVSQPNYPPRLSFLSQTYGVIAESDINTEFIRW--LGSARFE- 747

Query: 227 ASKTVFESYDLNVGIAVNGLQSQSY 251
                       +G+A N LQ + Y
Sbjct: 748 ------------LGVAFNVLQRKKY 760

>KAFR0E02970 Chr5 (595353..596648) [1296 bp, 431 aa] {ON} Anc_8.505
           YPL053C
          Length = 431

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 9/73 (12%)

Query: 94  NSIRDFARRTSFQSGFKYDILFLSGDTSISEFINALDTTILRSAKYRISILP-----VPL 148
           NSIR   +R  F   FKYD +FL+ +    EF NA+   I  + K+   ++P     +P 
Sbjct: 129 NSIRKVEQR--FNKQFKYDWIFLNDEPFTDEFKNAVQAEISSTVKF--GLIPTEHWSLPE 184

Query: 149 GSGNALATSLGFK 161
               + AT   FK
Sbjct: 185 WIDESRATEARFK 197

>Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260W
           (LCB5) - sphingoid long chain base (LCB) kinase [contig
           185] FULL
          Length = 553

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 58/130 (44%), Gaps = 8/130 (6%)

Query: 47  RDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQ 106
           R   I++I +   G     +  LY   ++P+  +     + I+T       + A+  +  
Sbjct: 174 RSKSILIIMNPHGGKGHAKK--LYLSKVKPILTASPSFVEAIETTYHGHAIELAKNINID 231

Query: 107 SGFKYDILFL-SGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSL-GFKTP 163
              KYD++   SGD    E +N L     R+A + ++ I  +P GSGNA++ S  G   P
Sbjct: 232 ---KYDVIACASGDGIPHEVLNGLYQRPDRAAAFNKLVITQLPCGSGNAMSVSCHGTTNP 288

Query: 164 LQALITYLNS 173
             A +  L +
Sbjct: 289 SHAALNVLKA 298

>NDAI0A08900 Chr1 complement(2049750..2050931) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 94  NSIRDFARRTSFQSGFKYDILFLSGDTSISEFINALDTTILRSAKY 139
           +SI+    R  F   F+YD +FL+ D    EFINA    +  +AKY
Sbjct: 86  DSIKSMEDR--FNHKFQYDWVFLNDDEFTEEFINATSIIVSGTAKY 129

>ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 647

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 98  DFARRTSFQSGFKYD-ILFLSGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALA 155
           D AR        KYD I   SGD    E IN L     R+A + ++SI  +P GSGNA++
Sbjct: 307 DIAREVDLN---KYDTIACASGDGIPYEVINGLYQRKDRAAAFNKLSITQLPCGSGNAMS 363

Query: 156 TSLGFKT-PLQALITYLNS 173
            +  + + P  A ++ + S
Sbjct: 364 VTCHWTSNPSYAALSLVKS 382

>Skud_7.281 Chr7 (488922..492455) [3534 bp, 1177 aa] {ON} YGL006W
           (REAL)
          Length = 1177

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 55/113 (48%), Gaps = 16/113 (14%)

Query: 94  NSIRDFARRTSFQSGFKYDILFLSGDTSISEFINALDTTILRSAKYRISILPVPLGSGNA 153
           NS++DF +  S  S  +   L + GD  +SE  N +   +L S    +S      G G  
Sbjct: 256 NSLKDFTKYNSGDSHSQKKPLDI-GD--VSEDDNKVADCMLISGSRILS------GLGRG 306

Query: 154 LATSLGFKTPLQALITYLNSNKKCSPLPLYDAQLPNSTS-------MIFFIIL 199
           + TS+G  +     +T LN+  + +PL L+ +QL ++ S       +I F++L
Sbjct: 307 IVTSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVAAIILFLVL 359

>TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {ON}
           Anc_6.48 YOR171C
          Length = 632

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 65/164 (39%), Gaps = 34/164 (20%)

Query: 98  DFARRTSFQSGFKYD-ILFLSGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALA 155
           D AR        KYD I   SGD    E IN L     R+  + +++I  +P GSGNA++
Sbjct: 290 DIAREIDLD---KYDTIACASGDGIPYEVINGLYQRPDRAEAFTKLAITQLPCGSGNAMS 346

Query: 156 TSLGFKT-PLQALITYLNSNKK-----CSPLPLYDAQLPNST--SMIFFIILSLGFHANL 207
            S  + + P  A +  + S +      C   P Y    P  +  S  + +I     +   
Sbjct: 347 VSCHWTSNPSYAALCLVKSVEARIDLMCCSQPSYYQNFPRLSFLSQTYGVIAESDINTEF 406

Query: 208 LHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNGLQSQSY 251
           +        + MG  RF+             +G+A N LQ + Y
Sbjct: 407 I--------RWMGPARFE-------------LGVAFNVLQRKKY 429

>YGL006W Chr7 (485921..489442) [3522 bp, 1173 aa] {ON}  PMC1Vacuolar
           Ca2+ ATPase involved in depleting cytosol of Ca2+ ions;
           prevents growth inhibition by activation of calcineurin
           in the presence of elevated concentrations of calcium;
           similar to mammalian PMCA1a
          Length = 1173

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 55/114 (48%), Gaps = 16/114 (14%)

Query: 93  ENSIRDFARRTSFQSGFKYDILFLSGDTSISEFINALDTTILRSAKYRISILPVPLGSGN 152
           +NS+RDF +  S  S      L + GD  ++E  N +   +L S    +S      G G 
Sbjct: 255 DNSLRDFKKFNSIDSHNHSKPLDI-GD--VNEDGNKIADCMLISGSRILS------GLGR 305

Query: 153 ALATSLGFKTPLQALITYLNSNKKCSPLPLYDAQLPNSTS-------MIFFIIL 199
            + TS+G  +     +T LN+  + +PL L+ +QL ++ S       +I F++L
Sbjct: 306 GVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVL 359

>KLTH0F05874g Chr6 complement(514124..520786) [6663 bp, 2220 aa] {ON}
            highly similar to uniprot|P07259 Saccharomyces cerevisiae
            YJL130C URA2 Multifunctional carbamoylphosphate
            synthetase (CPSase)-aspartate transcarbamylase (ATCase)
            that catalyzes the two first reactions of the pyrimidine
            pathway; carbamoyl-phophate synthetase, aspartate
            transcarbamylase, and glutamine amidotransferase
          Length = 2220

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 59/140 (42%), Gaps = 17/140 (12%)

Query: 139  YRISILPVPLG--SGNALATSLGFKTPLQALITYLNSNKKCSPLPLYD--AQLPNSTSMI 194
            + I  LP  L   +GN + T +G K  L  L++ +N+ +    L + D   +L ++ + I
Sbjct: 1716 FSIGALPTLLAQITGNEVVTGIGIKEALPLLLSAVNNGR----LTIDDIVERLHDNPASI 1771

Query: 195  FFII-----LSLGFHANLLHCAEDPKYKS----MGVERFQVASKTVFESYDLNVGIAVNG 245
            F I      + +       H      Y       GVER  V  +T+  S DL    A   
Sbjct: 1772 FNIPEQNAEVEIDLDFAFRHTKRWSPYTKGGLRGGVERVLVDGETIVLSGDLVAAEAEGK 1831

Query: 246  LQSQSYSYFAVIAAPNLEPT 265
            L S S +     A P++EPT
Sbjct: 1832 LVSSSSTKILTPAHPSVEPT 1851

>KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6.48
           YOR171C
          Length = 717

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 110 KYD-ILFLSGDTSISEFINALDTTILRSAKY-RISILPVPLGSGNALATSLGF-KTPLQA 166
           KYD I   SGD    E IN L     R A + +++I  +P GSGNA++ S  +   P  A
Sbjct: 372 KYDTICCASGDGIPHEVINGLYRRKDRVAAFNKLTITQIPCGSGNAMSVSCHWTNNPSYA 431

Query: 167 LITYLNSNKK 176
            ++ + S +K
Sbjct: 432 TLSLIKSIEK 441

>Smik_7.284 Chr7 (477865..481398) [3534 bp, 1177 aa] {ON} YGL006W
           (REAL)
          Length = 1177

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 57/114 (50%), Gaps = 16/114 (14%)

Query: 93  ENSIRDFARRTSFQSGFKYDILFLSGDTSISEFINALDTTILRSAKYRISILPVPLGSGN 152
           +NS++DF +  S +  F+   + + GD  ++E  + +   +L S    +S      G G 
Sbjct: 255 DNSLKDFKKFNSNEGDFQNKPVDI-GD--VTEDGDKVADCMLISGSRVLS------GLGR 305

Query: 153 ALATSLGFKTPLQALITYLNSNKKCSPLPLYDAQLPNSTS-------MIFFIIL 199
            + TS+G  +     +T LN+  + +PL L+ +QL ++ S       +I F++L
Sbjct: 306 GVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVAAIILFLVL 359

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,804,657
Number of extensions: 1830791
Number of successful extensions: 4951
Number of sequences better than 10.0: 60
Number of HSP's gapped: 5061
Number of HSP's successfully gapped: 60
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)