Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0G02497g5.702ON1780176779750.0
TDEL0B021905.702ON1810174121250.0
SAKL0E14916g5.702ON1779177121140.0
Suva_11.3315.702ON1898174220400.0
ZYRO0G06600g5.702ON1820172220310.0
YKR095W (MLP1)5.702ON1875171420270.0
Skud_11.3345.702ON1885171720110.0
Smik_11.3585.702ON1878170920020.0
Ecym_40185.702ON1769175019010.0
KLTH0E01056g5.702ON1771170618040.0
NCAS0A032005.702ON1788169017160.0
KLLA0A00594g5.702ON1748178116760.0
Kwal_55.196975.702ON1760168216490.0
NDAI0E050405.702ON1973173416160.0
AFR286W5.702ON1758174915071e-177
TBLA0E017305.702ON1820158111911e-134
NCAS0G002305.702ON173513519861e-108
Suva_9.395.702ON168215969241e-100
Skud_9.195.702ON168017579091e-98
YIL149C (MLP2)5.702ON167916428884e-96
Smik_9.205.702ON168216178153e-87
KNAG0C065905.702ON165113767021e-73
KNAG0L021405.702ON160814906448e-67
KAFR0D022205.702ON16745865099e-51
KAFR0H002105.702ON145410704731e-46
NDAI0F002905.702ON15543754409e-43
Kpol_1043.705.702ON13214654086e-39
TPHA0E002305.702ON12844962385e-19
TPHA0D046105.702ON11834822002e-14
Kpol_2001.755.702ON10061031070.001
NCAS0A093301.295ON1227107920.062
KAFR0F030204.46ON824323890.15
Skud_12.3934.46ON913206870.23
TPHA0N005407.68ON157651840.55
Kwal_8.599singletonON62687791.9
Smik_13.654.343ON1055138792.2
Kwal_14.716singletonON76787792.2
ZYRO0A09548g8.431ON65156782.5
Kwal_23.50438.68ON122560782.6
CAGL0H00594g6.291ON45361763.8
SAKL0F08844g7.249ON61684755.5
Smik_12.1928.324ON94367756.3
Skud_11.1542.616ON77763747.2
AFR273W3.561ON96994747.5
TBLA0A040908.346ON727226747.7
NCAS0C055604.86ON42554738.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G02497g
         (1780 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...  3076   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   823   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   818   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   790   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   786   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   785   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   779   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   775   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   736   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   699   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   665   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   650   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   639   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   627   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   585   e-177
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   463   e-134
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   384   e-108
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   360   e-100
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   354   1e-98
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   346   4e-96
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   318   3e-87
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   275   1e-73
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   252   8e-67
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   200   9e-51
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   186   1e-46
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   174   9e-43
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   161   6e-39
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    96   5e-19
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    82   2e-14
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    46   0.001
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    40   0.062
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    39   0.15 
Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {...    38   0.23 
TPHA0N00540 Chr14 complement(107050..111780) [4731 bp, 1576 aa] ...    37   0.55 
Kwal_8.599 s8 complement(21951..23831) [1881 bp, 626 aa] {ON} [c...    35   1.9  
Smik_13.65 Chr13 complement(113555..116722) [3168 bp, 1055 aa] {...    35   2.2  
Kwal_14.716 s14 complement(5384..7687) [2304 bp, 767 aa] {ON} [c...    35   2.2  
ZYRO0A09548g Chr1 (770850..772805) [1956 bp, 651 aa] {ON} weakly...    35   2.5  
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...    35   2.6  
CAGL0H00594g Chr8 (57283..58644) [1362 bp, 453 aa] {ON} weakly s...    34   3.8  
SAKL0F08844g Chr6 (675792..677642) [1851 bp, 616 aa] {ON} simila...    33   5.5  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    33   6.3  
Skud_11.154 Chr11 (284835..287168) [2334 bp, 777 aa] {ON} YKL072...    33   7.2  
AFR273W Chr6 (923039..925948) [2910 bp, 969 aa] {ON} Syntenic ho...    33   7.5  
TBLA0A04090 Chr1 complement(1014784..1016967) [2184 bp, 727 aa] ...    33   7.7  
NCAS0C05560 Chr3 complement(1128856..1130133) [1278 bp, 425 aa] ...    33   8.7  

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 3076 bits (7975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1612/1767 (91%), Positives = 1612/1767 (91%)

Query: 1    MATNTESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLS 60
            MATNTESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLS
Sbjct: 1    MATNTESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLS 60

Query: 61   SKYEKLKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNID 120
            SKYEKLKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNID
Sbjct: 61   SKYEKLKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNID 120

Query: 121  RANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKS 180
            RANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKS
Sbjct: 121  RANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKS 180

Query: 181  ELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXX 240
            ELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSD      
Sbjct: 181  ELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKS 240

Query: 241  XXXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLES 300
                     DETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLES
Sbjct: 241  SKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLES 300

Query: 301  TLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTK 360
            TLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTK
Sbjct: 301  TLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTK 360

Query: 361  GRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFV 420
            GRKRTY          ELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFV
Sbjct: 361  GRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFV 420

Query: 421  IELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLE 480
            IELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLE
Sbjct: 421  IELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLE 480

Query: 481  ILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVISEH 540
            ILLRQRTDLAHQLQY                EDEIKFIKNLVSNDNMASTNDSQKVISEH
Sbjct: 481  ILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVISEH 540

Query: 541  LIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAILTL 600
            LIKFKDIQQLQEKNMELVKTVRTLAQQL              VDEDNEIFAEAKEAILTL
Sbjct: 541  LIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAILTL 600

Query: 601  EKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRL 660
            EKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRL
Sbjct: 601  EKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRL 660

Query: 661  TQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKEN 720
            TQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKEN
Sbjct: 661  TQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKEN 720

Query: 721  EQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLK 780
            EQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLK
Sbjct: 721  EQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLK 780

Query: 781  SELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERV 840
            SELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERV
Sbjct: 781  SELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERV 840

Query: 841  HEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELEGAQ 900
            HEIDKIEKERNAQYEWYQKKIDEAS           TKNDELERLHLQNKTLEKELEGAQ
Sbjct: 841  HEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQ 900

Query: 901  IRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNAS 960
            IRIHTYETI           DVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNAS
Sbjct: 901  IRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNAS 960

Query: 961  FNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAE 1020
            FNAKDRDYRDA            GRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAE
Sbjct: 961  FNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAE 1020

Query: 1021 LQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQ 1080
            LQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQ
Sbjct: 1021 LQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQ 1080

Query: 1081 NQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQ 1140
            NQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQ
Sbjct: 1081 NQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQ 1140

Query: 1141 IDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNE 1200
            IDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNE
Sbjct: 1141 IDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNE 1200

Query: 1201 LENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIA 1260
            LENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIA
Sbjct: 1201 LENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIA 1260

Query: 1261 KDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDY 1320
            KDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDY
Sbjct: 1261 KDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDY 1320

Query: 1321 TKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEK 1380
            TKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEK
Sbjct: 1321 TKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEK 1380

Query: 1381 DDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELEVKLQNEIESSS 1440
            DDIRKQLDVKT            FREKQNDLETLREELNKEISKSEELEVKLQNEIESSS
Sbjct: 1381 DDIRKQLDVKTEENSELLSELNNFREKQNDLETLREELNKEISKSEELEVKLQNEIESSS 1440

Query: 1441 LASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEE 1500
            LASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEE
Sbjct: 1441 LASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEE 1500

Query: 1501 FNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRI 1560
            FNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRI
Sbjct: 1501 FNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRI 1560

Query: 1561 RLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSXXXXXXXXXXXXXXXXXXXX 1620
            RLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHS                    
Sbjct: 1561 RLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSNEFNNELKEALEKELKERFE 1620

Query: 1621 DELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKPEENSTPSVK 1680
            DELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKPEENSTPSVK
Sbjct: 1621 DELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKPEENSTPSVK 1680

Query: 1681 KIPETLNSSDTSFGNSNNVKVLKPSSPFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDL 1740
            KIPETLNSSDTSFGNSNNVKVLKPSSPFG                            KDL
Sbjct: 1681 KIPETLNSSDTSFGNSNNVKVLKPSSPFGATSAFNNPFTFNNNGNPPAFASAFAPTFKDL 1740

Query: 1741 MSXXXXXXSELSQNKRVGDDDIETNEL 1767
            MS      SELSQNKRVGDDDIETNEL
Sbjct: 1741 MSGQGGQQSELSQNKRVGDDDIETNEL 1767

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1741 (34%), Positives = 991/1741 (56%), Gaps = 101/1741 (5%)

Query: 9    IATFLNVERSNVESLAQE--LKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKL 66
            IA FL +    ++ +  +  L D +++K +EF  LQS+NLR +  ++E KA  +SK + L
Sbjct: 20   IAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDSL 79

Query: 67   KEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRAN--- 123
            K+E + ++ +N   +     L E+V  L       L ++  +K     LQN I++ N   
Sbjct: 80   KKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFE---LQNTIEQKNVLK 136

Query: 124  ERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELE 183
               +E+    +EK++ELE  + E +EL    K L  +++E + + Q  + + L  KSELE
Sbjct: 137  SNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELE 196

Query: 184  RNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXXXX 243
               Q++ +L K+ EWLE+E+T+K +  + YR++ D  +  ++  V +LK+D         
Sbjct: 197  IVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSRE 256

Query: 244  XXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTL- 302
                   E ++ LQN L E K L D L  EKQEF +E+S+K KL+ L + Q++S +  L 
Sbjct: 257  FLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELR 316

Query: 303  --QQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILD---HDSNDVSL 357
              ++K  + EA+   S++  + + ++L+   ++L++   + +RL+++++    DS +  L
Sbjct: 317  LTEEKHNSTEADNLQSTQQARFM-DDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDL 375

Query: 358  QTKGRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVE 417
             +                        +++S+ ++ GDI +LK+QL++E+ QKE LQ Q+E
Sbjct: 376  DS-----------------------TANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIE 412

Query: 418  SFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNS 477
            SFV+ELE+K+PVINS +ER+  LEKEL+D ALLLEH + E E KT EL+S   KI     
Sbjct: 413  SFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIK---- 468

Query: 478  QLEI----LLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDS 533
            QLEI    L+RQR+DLA Q+Q+                 DE+ FIK ++ N+N ++ +DS
Sbjct: 469  QLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDS 528

Query: 534  QKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDE-DNEIFAE 592
            Q +I+E L++FKDI  LQE+N EL+KT RTLA +L              +D  + +   E
Sbjct: 529  QSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIR----IDSLERKTIDE 584

Query: 593  AKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRER--NFKSSNSVHKYHELKSYNE 650
            AKEAI+TL++ N  +E  +  + KERDA+K ++S+  +   N   ++ +    E    N+
Sbjct: 585  AKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQE----NQ 640

Query: 651  TVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQ 710
             ++K LE++L+ LT +++ +++ L +E+  L++  +QL +  EK RS+++LAE+RLK+ Q
Sbjct: 641  ELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQ 700

Query: 711  NSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVT 770
            +++E+   EN +L  RS  L+  L +Q+    +T + Y+   SK S LE    NL+ E +
Sbjct: 701  STLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKS 760

Query: 771  LLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINE 830
            LL+    SL+ E+   + E+  L +MVTQLQ+LQSERE LL+  Q+  K  I+++     
Sbjct: 761  LLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTS 820

Query: 831  KLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNK 890
            +L  ++S + +EI   E  + AQ +W+Q+KIDE S           TK   + +L L+  
Sbjct: 821  ELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVN 880

Query: 891  TLEKELEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNS 950
             L+K++E +  RI +Y+T+            + K+LEKT IEL  AYSQ EEFK +S  +
Sbjct: 881  DLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTA 940

Query: 951  EDALKELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESE 1010
            E+ LK L+  F  +    +                   LK+ ++ + NE  +Q   +E E
Sbjct: 941  EETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEE 1000

Query: 1011 RKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADV 1070
            +  + + +  L+ +   + +VKK +++KL +L+ DLE+QT YAN AQKNYE+ELQ+HA+V
Sbjct: 1001 KNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEV 1060

Query: 1071 SKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDI 1130
            SK IS+LR + Q  +++ + L A  Q  ++ +   EK   +++ E    ID  ++++D+I
Sbjct: 1061 SKIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNI 1120

Query: 1131 TKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSL 1190
            + QN+LL++Q++LL+++E   EN       GS+ L++SLRRERDIL+TK+ V + E+  L
Sbjct: 1121 SSQNKLLFSQVELLSKSEREFENKL---LPGSSELLISLRRERDILETKLTVSKREEKLL 1177

Query: 1191 QQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELK 1250
             QK   +++EL   ++    L+   S HSD+   ++ I   L Q+NLLRESNVTLRN + 
Sbjct: 1178 HQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVN 1237

Query: 1251 QALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIE 1310
             A ++   +  +L   ++++LPL S L      I+EKD +I    DE+ RWK R  +++ 
Sbjct: 1238 AAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILR 1297

Query: 1311 KHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQ 1370
            +H+K++ ++Y KLEE ++  K+ L+ K +E  +LNDRF RLKKQAHEKLN SK  Q++L 
Sbjct: 1298 RHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLS 1357

Query: 1371 EQISNLISEKDDIRKQL-DVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELE 1429
             +++ L   K  + + L + +T              E  N+ E LR EL+  + + +E+E
Sbjct: 1358 AEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANN-EDLRHELDDALERCKEIE 1416

Query: 1430 VKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQ 1489
            VKL   + SS   +   N+EI  L++ +   K +   ++ +  +  +  VE++K+ FE +
Sbjct: 1417 VKLGETVGSSEGLTSQLNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMKKAFEEE 1476

Query: 1490 KTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNV-DVEALRKQWEEDSEELIQKR 1548
            K KFI EKTEE+NK+  EE  K+ +   EN  P   ++  DV +L+KQWEE+ E + Q+R
Sbjct: 1477 KIKFIQEKTEEYNKKFEEEKAKLSS---ENGSPAEPVSAPDVNSLKKQWEEEYEAISQQR 1533

Query: 1549 IAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSXXXXXXXX 1608
            I EAE+NLKKRIR+P+EE+I K+++KR++ELE EF +++++   +L              
Sbjct: 1534 IQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKE--NNLQPEGGDAKEREELK 1591

Query: 1609 XXXXXXXXXXXXDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQD 1668
                        + L + +KKAFEEGKQQA MK+TLLERKI KLESQ+         + +
Sbjct: 1592 KQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLN-------SSNN 1644

Query: 1669 VKPEENSTPSVKKIP--------ETLNSSDTSFGNSNNVKVLK----------PSS---P 1707
              PE+ +  SV  +P        E + +   +FG     KVLK          PSS   P
Sbjct: 1645 PTPEKAAATSV-GLPTKIDESRTENMATGTPAFGE----KVLKLSDKPAFSFQPSSKSNP 1699

Query: 1708 F 1708
            F
Sbjct: 1700 F 1700

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1771 (34%), Positives = 1019/1771 (57%), Gaps = 126/1771 (7%)

Query: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68
            I++FL ++ S V +L   +   +  KA +F QL++ NL+ +V L+E K++   + E  K 
Sbjct: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80

Query: 69   ELDYVVEDNTKVRAENKTLSEKVWSL--ETSDNSKLAEINQLKTSNEGL--QNNIDRANE 124
            +L+ + E+   +R E     ++ + L  E ++ SK  E+N LK+    L  QN I R+++
Sbjct: 81   QLEKINENTESLRKEKDAFEDEKFKLIDEKANASK--EVNLLKSQLTELKQQNEIFRSSK 138

Query: 125  RYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELER 184
            +  ++    +EK+ +LE  +DE K+L    KTL  ++LELE + Q ++S++L  K+E++R
Sbjct: 139  Q--DVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQR 196

Query: 185  NAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXXXXX 244
              QE+ LL+ N +WLE+EL +K++ F  YR++ +  +  A++ +  ++S+          
Sbjct: 197  LTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIERSSSQT 256

Query: 245  XXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQ 304
                 ++ ++QLQ+ + E K L+D  ++EKQEF +E+++K +LI L E QI+S ++ L+ 
Sbjct: 257  LKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELES 316

Query: 305  KFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKR 364
                + +N ++     + + EEL   ++KL+  E K V+LE  +D       L T G   
Sbjct: 317  ARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDE-----LLSTDG--- 368

Query: 365  TYXXXXXXXXXXELGSFDDSSISL-------SRMQGDIKILKRQLVQEKRQKEKLQNQVE 417
                        E G+ + S +SL        ++ GDI +LK++L+QE+RQKE+LQ QVE
Sbjct: 369  ------------ERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVE 416

Query: 418  SFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNS 477
            +FV+ELEHK+PV+NSF+ERT +LEKEL+D AL+LE  +K+ E K +EL S+K KI+D  +
Sbjct: 417  AFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYET 476

Query: 478  QLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVI 537
            Q+  L+RQR+DLAHQ+Q+                 +E  FIK ++++       D+Q++I
Sbjct: 477  QIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRII 536

Query: 538  SEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAI 597
            SE L++F+ + +LQEKNMEL+ ++R LA +L                  +E   EAKEAI
Sbjct: 537  SERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVE---SETVKEAKEAI 593

Query: 598  LTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSS-NSVHKYHELKSYNETVVKDL 656
            LTL++ N++LE  L+I+ KERDAFK+L S+    N  S+ NS    H +    E  +K+L
Sbjct: 594  LTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLV--LAEEKIKEL 651

Query: 657  ENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELL 716
            EN L+ LT +S  + K L EE++ L++  +  +V +EK RS++ LAE+R K+  N++E+ 
Sbjct: 652  ENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMT 711

Query: 717  SKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDRE 776
              EN++LR R   L++++L+QD +TQ+T  S +   S+ S+L++ + N ++E  LL+  +
Sbjct: 712  KMENDELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQ 771

Query: 777  ISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQL 836
             +LK E  + +EE+  +RI++TQLQ+LQ+ERE+LLE  Q +F+ + +       KL+ +L
Sbjct: 772  ENLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTN-------KLETEL 824

Query: 837  SERVHEIDKIEKE-------RNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQN 889
            S+ + ++D   KE       +++Q +WYQ+K D  +           +K  +++ L L+ 
Sbjct: 825  SDTLEKLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKV 884

Query: 890  KTLEKELEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQN 949
            ++L  +LE ++ RI  +  +            + +ELEKT+I+LADAYSQ+E++K+++ +
Sbjct: 885  ESLNNKLEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADS 944

Query: 950  SEDALKELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAES 1009
            SE++   +  +      +Y +              +  ILK Q+ N+ NEL  Q  + ES
Sbjct: 945  SEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFES 1004

Query: 1010 ERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHAD 1069
            +    T+ + +L+     ++ +K  +E+K+ K++ DL +QT YAN AQKNYEQELQ+HAD
Sbjct: 1005 QISDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHAD 1064

Query: 1070 VSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDD 1129
            VSK IS LR + Q+ K++T++L    ++ +  + Q+E   + +  +Y  ++ LA QRI+D
Sbjct: 1065 VSKKISLLRAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIED 1124

Query: 1130 ITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTA---LVLSLRRERDILDTKINVIETE 1186
            +  Q+++LY+QID L++ +     SS+D    ST    L+ SLRRE+DIL+TK+ V   E
Sbjct: 1125 LNAQSKILYDQIDFLSKGKPT---SSEDLMPISTETRNLLTSLRREKDILETKLEVSTRE 1181

Query: 1187 KNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLR 1246
            +  L+QKL  I+++LE ++   + L+   S +S  + + + I   L QLNLLRESN+TLR
Sbjct: 1182 EKVLRQKLKLIESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLR 1241

Query: 1247 NELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLE 1306
            NE ++  +   ++  +L     ++ PL+S +    N ++EKDL+I+  N+E++RWK R +
Sbjct: 1242 NEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQ 1301

Query: 1307 EMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQ 1366
            +++ K+++++ +++ KL + ++E +Q + +K  E  EL+ RF RLK+QAHEKLN +K  Q
Sbjct: 1302 DILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQ 1361

Query: 1367 SSLQEQISNLISEKDDIRKQL-----DVKTXXXXXXXXXXXXFREKQNDLETLREELNKE 1421
            S+L  Q+++L + K+ +   L     +VK               EK NDL+   E+L   
Sbjct: 1362 STLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEK-NDLQ---EQLENS 1417

Query: 1422 ISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQL----------AANSTDA 1471
             +K  E E KL+    SS+L  +  N+ IE L   I  L+  L           + S++ 
Sbjct: 1418 QAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSEL 1477

Query: 1472 DEQTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKI----RNEFQE---NEKPDT 1524
             E T++ VE +K EFE +K K I++K  E  ++  EE   I      E +E    +K D 
Sbjct: 1478 VENTSKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDP 1537

Query: 1525 ELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFD 1584
             +N+D   ++K+WEE+ E+   +RI E+ + LKKRIRLP+EEKINKI+EK+R ELE+EF+
Sbjct: 1538 PVNID--EIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFE 1595

Query: 1585 QKIRDKARDLLMNDHSXXXXXXXXXXXXXXXXXXXXDELQA--------ARKKAFEEGKQ 1636
              ++ KA ++  +  +                     E+Q          +K+AFEEGKQ
Sbjct: 1596 ANVQKKAEEIAKSKSASNSNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQ 1655

Query: 1637 QATMKTTLLERKIQKLESQIQEKE--------------KDSEETQDVK---PEENSTPSV 1679
            QA+MK+T LE+KI KLE+QI+  +              +    TQDVK   P  N+  ++
Sbjct: 1656 QASMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAI 1715

Query: 1680 -KKIPETLNSSDTSFGNSNNVKVLKPSSPFG 1709
                P   N +  +FG            PFG
Sbjct: 1716 LPGKPLPFNPAHFAFG-----------MPFG 1735

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/1742 (34%), Positives = 961/1742 (55%), Gaps = 132/1742 (7%)

Query: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68
            IA+F +     V+S+ +++   +  K  +F +L+S+N++  V L+E K N + K   LK 
Sbjct: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83

Query: 69   ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKE 128
            E++ V+  N ++R E    S K  S++        E   L    E ++  +   +E  KE
Sbjct: 84   EMEDVLRQNDEIRKERNDTSSKFESVQ-------REKTHLSNELESIKRKLSDLSEEKKE 136

Query: 129  LNGS-------YDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSE 181
            +  S        DE++ ELE ++       ++ K L   ILELE K Q Y S++LN KS+
Sbjct: 137  IQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQ 196

Query: 182  LERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXX 241
            LER  QE+ LL+ N++WLE+EL++KNQ ++ YR+KT+ ++ +   ++ ++++D       
Sbjct: 197  LERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTN 256

Query: 242  XXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLEST 301
                    +E ++ LQ  L++ K L D    EK++F  E+++K +LI L E+Q+ +++  
Sbjct: 257  NDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEE 316

Query: 302  LQQKFKT--AEANEENSSEVV---KSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVS 356
            L    ++  ++ N ++S +++   + L ++L L + KL   E +C+RL SI +       
Sbjct: 317  LNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITE------- 369

Query: 357  LQTKGRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQV 416
                                E G  D   I  S+  GD  +LK+QL++EKR KE LQNQ+
Sbjct: 370  --------------------EAGKED--GILTSKSNGDFILLKKQLIKEKRAKEHLQNQI 407

Query: 417  ESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDN 476
            ESF++ELEHK+P+INSF+ERT  LE EL + ALLLEH + E   K  EL+   +K+++  
Sbjct: 408  ESFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYK 467

Query: 477  SQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMAST-NDSQK 535
             ++ IL +QR DL  Q+QY                ++EIKFI+N++ ND+ A+T +DSQK
Sbjct: 468  DEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQK 527

Query: 536  VISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKE 595
            +++E L++F+DI QLQEKN EL++  R LA +L                 +NE   EAKE
Sbjct: 528  IVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNI---ENETINEAKE 584

Query: 596  AILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKD 655
            AILTL+     LE  +  + KER+ FK     D+E +  +S  + +  E K   E+  +D
Sbjct: 585  AILTLQSQKVQLESKIHELEKEREKFKNWTM-DQETSPNNS-VIQQLTETKRELESQTQD 642

Query: 656  LENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMEL 715
            L+ R++Q+T +S  +   L +EL  L+   S L++++ + +S++ LAEER K+  N+++L
Sbjct: 643  LQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDL 702

Query: 716  LSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDR 775
               EN+QLR RS  L++++ +QD +TQ+T + YV   SK S++ET + NL+ E TL  + 
Sbjct: 703  AKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIEL 762

Query: 776  EISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQ 835
            E +LK ELS  + EKT L IMVTQLQ+LQ ERE LL+  +   + +I  +     +L  +
Sbjct: 763  EKNLKQELSELSSEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTE 822

Query: 836  LSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKE 895
               +   I ++E++ +++ EWYQ KI+               K  E+ER   + K+LEKE
Sbjct: 823  AIRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKE 882

Query: 896  LEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALK 955
            +E  +IR+HTY  +            + +ELEK+KI L DAYSQ++E+K L + ++ +L+
Sbjct: 883  IEENKIRLHTYNVLDESINDDS----LRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQ 938

Query: 956  ELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLT 1015
            E+++  +  ++ + +              +  +L++Q+ N+ NEL +Q++  E E+    
Sbjct: 939  EMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFK 998

Query: 1016 QTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTIS 1075
            + I+ LQ   + IE VK  +E KL K++ DL++QT+YAN AQ NYEQELQ+HADVSKTIS
Sbjct: 999  KKISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTIS 1058

Query: 1076 ELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQ 1135
            ELREQ    K   ++L       +  + +NE +  S+++    Q+DL+  RI+D++ QN+
Sbjct: 1059 ELREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNK 1118

Query: 1136 LLYNQIDLLNRAESVNENSSDDEANGSTA---LVLSLRRERDILDTKINVIETEKNSLQQ 1192
            LLY+QI+L     +   N   D  +GS     ++++LRRERDILDTK+ V E +   L+Q
Sbjct: 1119 LLYDQIELY----TTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQ 1174

Query: 1193 KLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQA 1252
            K+  I  EL+  +      + E  + S +I  +  +   L QLNLLRESN TLRNEL  +
Sbjct: 1175 KISLIDVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSS 1234

Query: 1253 LDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKH 1312
              +  ++  +L+  R  + P++S L +    I+EK+ +I    +E  RWK R ++++EKH
Sbjct: 1235 NSKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKH 1294

Query: 1313 QKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQ 1372
            Q+++  DY KLE  +   K  L++K Q+  +  ++FNRL++QA EKL  SK  Q S  EQ
Sbjct: 1295 QQLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQ 1354

Query: 1373 ISNLISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELEVKL 1432
            ++ L   K  + K L+                 E +N L  +++        S+ELE KL
Sbjct: 1355 LNELKDAKLALEKSLN--NANARIQELEDAKVAENRNQLSMIKKLQEDTEENSKELETKL 1412

Query: 1433 QNEIESSSLASRNTNKEI----EELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFEN 1488
            +    S     +  N+EI    EEL+K     +   AA  T+ D+  ++ VE++KR FE 
Sbjct: 1413 EENAISYDSTVKKLNEEIGILKEELEKQRQIQQQFQAAAGTEQDD-LSKVVESMKRSFEE 1471

Query: 1489 QKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTEL---NVDVEALRKQWEEDSEELI 1545
             K KFI EKT E N       +KIR   +  E  +T L   N++++ ++KQWE +  E +
Sbjct: 1472 DKIKFIEEKTREVN-------QKIREFQEAQEAEETGLKPSNINIDEIKKQWEAEHNEEV 1524

Query: 1546 QKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFD--------------------- 1584
             K+I EAE+ LKKRIRLP+EEKI+KIIE+++ +LE EFD                     
Sbjct: 1525 SKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKMEDIFQ 1584

Query: 1585 -------------------QKIRDKARDLLMNDH-SXXXXXXXXXXXXXXXXXXXXDELQ 1624
                               +K+++K R+L  +D  S                     ELQ
Sbjct: 1585 KQLESRIQEKQKELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIEAQLREEFNHELQ 1644

Query: 1625 AARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKPEENSTPSVKKIPE 1684
              +KK+FEEGKQQA MKTTLLERK+ K+ESQ+ E    ++++ D  P+      + K+P 
Sbjct: 1645 TIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSE----TKQSVDSPPKH-----LSKMPN 1695

Query: 1685 TL 1686
             L
Sbjct: 1696 PL 1697

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1722 (35%), Positives = 978/1722 (56%), Gaps = 116/1722 (6%)

Query: 34   KAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKEELDYVVEDNTKVRAENKTLSEKVWS 93
            K  +F +L+S NLR NV ++E K   S + E LK E++ +++DN  +R E     E+  S
Sbjct: 51   KVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEE--S 108

Query: 94   LETS-DNSKLAEINQLKTSNEGLQNNIDRANERYK----ELNGSYDEKVTELEHIRDEKK 148
             ++S D  K+   N++++  E L +++D+  E  K    E+    +EK+ ELE  R E +
Sbjct: 109  TQSSRDKQKIQ--NEVESLQEKL-SDLDQERETLKQDKREVVAVLEEKIKELESFRTESR 165

Query: 149  ELQTQIKTLNDKILELELKCQEYQSSELNRKSELERNAQEILLLRKNQEWLEQELTNKNQ 208
            +     K L  ++LELE   Q  +S EL  +SE++   Q + +L+KN +WLE+E+T+K +
Sbjct: 166  KSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTE 225

Query: 209  HFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXXXXXXXXXXDETTEQLQNNLIENKDLKD 268
              +  R+K D  +    +     K++               +E T+ LQ  L+E KDL D
Sbjct: 226  QLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSD 285

Query: 269  VLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQKF--------KTAEANEENSSEVV 320
             L  EKQEF  E+S+K KLI L ENQ+KSL+  L             + E N EN     
Sbjct: 286  SLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENE---- 341

Query: 321  KSLKEELSLAERKLQDMEEKCVRLES-----ILDHDSND--------VSLQTKGRKRTYX 367
            K ++E ++L E   ++ E + +RLE+     I   DS D        +SL+ K       
Sbjct: 342  KLIQELITLKE-NFEESERERLRLEALVQELIPGDDSQDDINNTSSFISLRNK------- 393

Query: 368  XXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKI 427
                           DSS+       D+ ILK++L++E+ QKE+LQ QVESF++ELE+KI
Sbjct: 394  ---------------DSSLR------DMGILKKELIKERHQKERLQRQVESFIVELEYKI 432

Query: 428  PVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRT 487
            PVINSF+ERTS+LEKEL D ALLL+H + E E +  E ++L KK+ D  S +  L RQRT
Sbjct: 433  PVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRT 492

Query: 488  DLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDI 547
            DLAHQ+Q+                 +E+ FIK +V+ND+  S +DSQ+VISE L++F +I
Sbjct: 493  DLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNI 552

Query: 548  QQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAILTLEKVNENL 607
              LQEKNMEL+KTVR LA++L                 +N+   EAKEAI++L+  N NL
Sbjct: 553  ATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTF---ENDTIKEAKEAIVSLQDYNANL 609

Query: 608  EKNLQIVTKERDAFKLLVSEDR-ERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTND 666
            E  ++I+TKE DAFK + S +  ++N   S +  + +   S +E  ++ LE RLT LT +
Sbjct: 610  ESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVE 669

Query: 667  SNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIR 726
            S+ ++K L  E++ L++  +Q+++++EK RS+K+L EERLK+ Q+++EL   EN+QL  R
Sbjct: 670  SSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKR 729

Query: 727  SSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNT 786
            S  L+    +QD  T +T +  +   SK + LET V NLETE  LL+  E + +      
Sbjct: 730  SQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKL 789

Query: 787  TEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKI 846
            +EE+  LRIMV+QLQ+LQSERE  L+ +Q+ +K+ +  +         +L  +  E + +
Sbjct: 790  SEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDM 849

Query: 847  EKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELEGAQIRIHTY 906
            E  +  Q +WYQ K+D              TK   +  L  + + LEK++E ++ RI +Y
Sbjct: 850  ENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSY 909

Query: 907  ETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDR 966
            + +            + KELEKTKI L+D Y++++++KNL   +E++L +L   + +  +
Sbjct: 910  QVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQ 969

Query: 967  DYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQ 1026
            + +                   L + +  ++  L   ++ AE+E+  L + IA L+  ++
Sbjct: 970  ELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESK 1029

Query: 1027 PIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKN 1086
               ++K+ ++ ++ KL+ DLE+Q  +AN AQ+NYE+ELQ+ ++VSKTISELREQ+Q+ + 
Sbjct: 1030 GSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRI 1089

Query: 1087 DTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNR 1146
                L    + ++  + QNEK   ++++EY  Q++ ++Q ++D++ QN LLY+QI+L ++
Sbjct: 1090 AITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSK 1149

Query: 1147 AESVNENSSDDEANGSTA----LVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELE 1202
              S       D  NG TA    ++ +LRRERDIL TK+ V + E+ +L+  L  ++NEL+
Sbjct: 1150 DNS-------DGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELD 1202

Query: 1203 NTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKD 1262
             TKR  +  + E + HS+LI  ++ I   L QLNLLRESN+TLRN    A +E++K  ++
Sbjct: 1203 TTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRN----AAEEENKKNRE 1258

Query: 1263 LQ----ICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVD 1318
            LQ      R  +LPL+S L + +  + EKD ++    +E+ RWK R +E++ KH +++ +
Sbjct: 1259 LQEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPE 1318

Query: 1319 DYTKLEETLNETKQLLDNKVQETN----ELNDRFNRLKKQAHEKLNTSKELQSSLQEQIS 1374
            D+ +L+E ++    +L+ K+ ETN    EL+DRFNRLKKQAHEKLN+SK  Q++L  Q++
Sbjct: 1319 DHKELKEKVS----ILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLN 1374

Query: 1375 NLISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELEVKLQN 1434
             L   K ++  + + +                    +E++++EL+  +  S ELE  L  
Sbjct: 1375 ELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSA 1434

Query: 1435 EIESSSLASRNTNKEIEELQKVIDDLKTQLAANS-TDADEQTNRNVEAIKREFENQKTKF 1493
             ++ +   ++  N EI+ L+  +  LK Q AA +  +  E  +  VE+++R FE +K  F
Sbjct: 1435 TLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINF 1494

Query: 1494 IAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAE 1553
            + EKTEE  K      E+ ++  Q N     +  V+ E +++QWE + EE I KRIAEAE
Sbjct: 1495 LKEKTEELKK-----LEEEKHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAE 1549

Query: 1554 DNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSXXXXXXXXXXXXX 1613
            +NLKKRIRLP+EE+I +++EK+++ LE  + +K+ +    L  +D +             
Sbjct: 1550 ENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNSDLKKQLEKDLQ 1609

Query: 1614 XXXXXXXDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEK----EKDSEETQDV 1669
                    E+QA +KKAFEEGKQQA MK+TLLERKI KLESQ+  K    +K S ET  V
Sbjct: 1610 EKFEA---EVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSSETSSV 1666

Query: 1670 KPEENSTPSVKKIPETLNSSDTSFGNS--NNVKVLK--PSSP 1707
             P+ N  PS  KI E   +++ S  N   +  KVLK  PS P
Sbjct: 1667 -PKPN-LPS--KIDEKSVTTNQSVPNPLVSGEKVLKLDPSKP 1704

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/1714 (34%), Positives = 967/1714 (56%), Gaps = 118/1714 (6%)

Query: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68
            IA+F       V+S   ++   +  K  +F +L+S+NL+  V  +E KA+   K + LK 
Sbjct: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83

Query: 69   ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKE 128
            E++ V+ +N K+R E    ++     E+ +N K+    +L +  E ++  +D   E  KE
Sbjct: 84   EMENVIRENDKIRKER---NDTFVKFESVENEKM----KLSSELEFVKRKLDDLTEEKKE 136

Query: 129  LNGS-------YDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSE 181
               +        DE++ E+E +R E     ++ K L   I++LE K Q Y +++LN ++E
Sbjct: 137  TQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTE 196

Query: 182  LERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXX 241
            LER  QE+ LL+ N +WLE+EL +KN+ ++ YR+KTD ++ D    + +L++D       
Sbjct: 197  LERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTN 256

Query: 242  XXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLEST 301
                    +E ++ LQ  L+E K L D L  EKQEF  E+S+K +L+ L E+Q+ +++  
Sbjct: 257  NDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEE 316

Query: 302  LQ--QKFKTAEANEENSSEVVK---SLKEELSLAERKLQDMEEKCVRLESILDHDSNDVS 356
            L   ++  TA+   ++S +       L +EL L + KL   E++C+RL SI D       
Sbjct: 317  LNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSSITDE------ 370

Query: 357  LQTKGRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQV 416
                                     D+ ++S ++   D   LK+QL++E+R KE LQNQ+
Sbjct: 371  ----------------------ADEDNENLS-AKSSSDFIFLKKQLIKERRTKEHLQNQI 407

Query: 417  ESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDN 476
            E+F++ELEHK+P+INSF+ERT +LE EL + ALLLEH + E   K  EL +  +K+ +  
Sbjct: 408  ETFIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECE 467

Query: 477  SQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMAST-NDSQK 535
            + L+ L +QR DL  Q+QY                ++EI+FI+N++  D+   T +DSQK
Sbjct: 468  NDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQK 527

Query: 536  VISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKE 595
            V++E L++FK+I QLQEKN EL+K VR LA +L                 ++E   EAKE
Sbjct: 528  VVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKI---ESETVNEAKE 584

Query: 596  AILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKD 655
            AI+TL+    +LE   +I   +++  +L  S   E    S+ ++ +  E K   E+ V+D
Sbjct: 585  AIITLKSEKMDLES--RIEELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQD 642

Query: 656  LENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMEL 715
            L+ R++Q+T +S  +   L +E+  L+   S +++++ K +S++ LAEER K+  N+++L
Sbjct: 643  LQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDL 702

Query: 716  LSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDR 775
               EN+QLR R   L++++L+QD +T +T + YV   SK S +ET + NL+ E  L    
Sbjct: 703  TKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHL 762

Query: 776  EISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQ 835
            E +LK EL+  + EK  LRIMVTQLQ+LQ ERE LLE  +   +K+I E+     +L K+
Sbjct: 763  EKNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKE 822

Query: 836  LSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKE 895
             S++ H I ++E++ N+  EWYQ KI+              +K  ++E+L  + K+LEKE
Sbjct: 823  TSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKE 882

Query: 896  LEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALK 955
            +E  +IR+HTY  +            + KELEK+KI L DAYSQ++E+K+L + +  +L+
Sbjct: 883  IEEDKIRLHTYNVMDETINDDS----LRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQ 938

Query: 956  ELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLT 1015
            + N+  +   +D+ +              +  +LK+Q+ N+ NEL +Q +  E E+    
Sbjct: 939  QTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFK 998

Query: 1016 QTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTIS 1075
            + I+ LQ   + +E VK  +E KL K++NDL++QT+YAN AQ NYEQELQ+HADVSKTIS
Sbjct: 999  KRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTIS 1058

Query: 1076 ELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQ 1135
            ELREQ    K   K+L      L++ + +NEK   S+++    Q+DL+  RI+D++ QN+
Sbjct: 1059 ELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNK 1118

Query: 1136 LLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLD 1195
            LLY+QI +   A+    NS++    G   ++++LRRERDILDTK+ V E +   L+QK+ 
Sbjct: 1119 LLYDQIQIYTAADKEVNNSTN--GPGLNNILITLRRERDILDTKVTVAERDAKMLRQKIS 1176

Query: 1196 DIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDE 1255
             +  EL++ +        E   HS +I  +  I   L QLNLLRESN+TLRNEL+   ++
Sbjct: 1177 LMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNK 1236

Query: 1256 KDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKV 1315
            K ++  +L   +  + P++S L +    ++EK+ ++  A +E  RWK R ++++EKH+++
Sbjct: 1237 KKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQL 1296

Query: 1316 NVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISN 1375
            +  DY KLE  +   K+ L+NK ++  E  ++FNRL++QA E+L TSK  Q SL EQ+++
Sbjct: 1297 SSSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNS 1356

Query: 1376 LISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISK-SEELEVKLQN 1434
            L   K+ +   L                  +  N LE +R+ L ++  K S EL+ KL+ 
Sbjct: 1357 LRDAKNVLENSLS--EANARIEELQNAKVAQGNNQLEAIRK-LQEDAEKASRELQAKLEE 1413

Query: 1435 EIESSSLASRNTNKEIEELQKVID-DLKTQLAANSTDADEQTNRN--VEAIKREFENQKT 1491
               S        N+EI  L++ I+   + Q    +T A+EQ + +  VE++K+ FE  K 
Sbjct: 1414 STTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSANEQNDLSNIVESMKKSFEEDKI 1473

Query: 1492 KFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAE 1551
            KFI EKT+E N++++E  E++        +P    N+++E ++K+WE + E+ + ++I E
Sbjct: 1474 KFIKEKTQEVNEKILEAQERLN-------QPS---NINMEEIKKKWESEHEQEVSQKIRE 1523

Query: 1552 AEDNLKKRIRLPSEEKINKII--------------------------------------- 1572
            AE+ LKKRIRLP+EEKINKII                                       
Sbjct: 1524 AEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQSGEIDVVLRKQLEAK 1583

Query: 1573 -EKRRSELESEFDQKIRDKARDLLMNDH-SXXXXXXXXXXXXXXXXXXXXDELQAARKKA 1630
             ++++ ELE+E+++K++++ +D+  + H S                    +ELQA +KK+
Sbjct: 1584 VQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEFNNELQAIKKKS 1643

Query: 1631 FEEGKQQATMKTTLLERKIQKLESQIQEKEKDSE 1664
            F+EGKQQA MKTTLLERK+ K+ESQ+ E ++ +E
Sbjct: 1644 FDEGKQQAMMKTTLLERKLAKMESQLSETKQSAE 1677

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1717 (34%), Positives = 958/1717 (55%), Gaps = 123/1717 (7%)

Query: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68
            IA+F +     V+S+  ++   +  K  +F +L+S+NL+  V  +E K N   K + LK 
Sbjct: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83

Query: 69   ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKE 128
            E++ V+  N ++R E    S K   L+   N K+   N+L    E ++  ++   E  KE
Sbjct: 84   EMENVLRQNDEIRKERNDTSAKFEFLQ---NEKIQLSNEL----ESVKRKLNDLTEEKKE 136

Query: 129  LNGS-------YDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSE 181
            +  +        DE++ E+E  + E      + + L   ++ELE K Q Y +++LN +SE
Sbjct: 137  IQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSE 196

Query: 182  LERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXX 241
            LER  QE+ LL+ N++WLE+EL++K++ ++ YR++TD  + +  + + +LK+D       
Sbjct: 197  LERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTN 256

Query: 242  XXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLEST 301
                    +E +  LQ  +++ K+L D L  EKQEF  E+++K +LI L E Q+ +++  
Sbjct: 257  NDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEE 316

Query: 302  LQQKFKTAEAN--EENSSEVV---KSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVS 356
            L+   K+  +N   ++S +++   +SL ++L L + KL   E +C+RL SI +       
Sbjct: 317  LKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITE------- 369

Query: 357  LQTKGRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQV 416
                                E G  ++S    SR   D  +LK+Q ++EKR KE+LQNQ+
Sbjct: 370  --------------------ETG--EESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQI 407

Query: 417  ESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDN 476
            ESF++ELEHK+PVINSF+ERT +LE EL ++ALLLEH + E   K  EL    +KI+   
Sbjct: 408  ESFIVELEHKVPVINSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCE 467

Query: 477  SQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMAST-NDSQK 535
            + + IL RQR DL  Q+QY                ++EIKFI+N++ NDN  +T +DSQK
Sbjct: 468  NDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQK 527

Query: 536  VISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKE 595
            +++  L++F+++ +LQEKN EL++  R LA +L                 +N+   EAKE
Sbjct: 528  ILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNLLKI---ENKTINEAKE 584

Query: 596  AILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKD 655
            AIL+L+    +LE  ++ + +ER+  K  +S+ +  +F +S  + +  + K   E+ V+D
Sbjct: 585  AILSLQSEKMSLESKVEELERERETLKSSISK-QASSFNNS-VIQQLTKTKRELESQVQD 642

Query: 656  LENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMEL 715
            L+ R++Q+T +S  +   L +E+  ++   S +++++ K +S++ LAEER K+  N+++L
Sbjct: 643  LQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDL 702

Query: 716  LSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDR 775
               EN+QLR RS  L+ S+ +QD +T +T + Y+   SK S  ET++ NL+ E  L  D 
Sbjct: 703  TKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDS 762

Query: 776  EISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQ 835
            E SLK EL   + EKT LRIMVTQLQ+LQ ERE LL+  +   + +I+EV     +L  +
Sbjct: 763  EKSLKQELDKLSSEKTSLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVE 822

Query: 836  LSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKE 895
             S +   I ++E++  ++ EWYQ KI+               K  E+E+L  + K+LEKE
Sbjct: 823  TSHKDQHIMQLEEDNTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKE 882

Query: 896  LEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALK 955
            +E  +IR+HTY  +            + KELE +KI L +AYSQ++E+K L +++  +L+
Sbjct: 883  IEENKIRLHTYNVMDETINDDS----LRKELEMSKINLTEAYSQIQEYKKLYESTAQSLR 938

Query: 956  ELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLT 1015
            E+N+  +  +  + +              +  +LK+Q  N+ NEL +Q  E E ++    
Sbjct: 939  EMNSKLDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFK 998

Query: 1016 QTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTIS 1075
            + IA LQ   + IE VK  +E KL K+++DL++QT+YAN AQ NYEQELQ+HADVSKTIS
Sbjct: 999  KIIAILQNNNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTIS 1058

Query: 1076 ELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQ 1135
            ELREQ    +   K+LT     L++ + +NEK   S++     Q+DL+  RI+D++ QN+
Sbjct: 1059 ELREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNK 1118

Query: 1136 LLYNQIDLLNRAESVNENSSDDEANGSTA---LVLSLRRERDILDTKINVIETEKNSLQQ 1192
            LLYNQI+L   A     N   D  NG T    ++++LRRERDILDTK+ V E +   L+Q
Sbjct: 1119 LLYNQIELYTAAG----NGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQ 1174

Query: 1193 KLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQA 1252
            K+  +  EL++ +        E  E S ++  +  I   L QLNLLRESN+TLRNEL+  
Sbjct: 1175 KITLMDVELQDARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENC 1234

Query: 1253 LDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKH 1312
              +  ++  +L   +  + P++S L +    ++EK+ +I  A +E  RWK R ++++EKH
Sbjct: 1235 SKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKH 1294

Query: 1313 QKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQ 1372
            Q+++ +DY KLE  +   K  L++K+Q+  E  +RFNRL++QA EKL TSK  Q +L EQ
Sbjct: 1295 QQLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQ 1354

Query: 1373 ISNLISEKDDIRKQL-DVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELEVK 1431
            ++ L   K  + + L D  T              E  N  E ++         S ELE K
Sbjct: 1355 LNELKDAKVALERSLNDANTRIQELEGEK---VAEDNNRSEMIKRSQEDAEKSSRELEEK 1411

Query: 1432 LQNEIESSSLASRNTNKEIEELQKVID---DLKTQLAANSTDADEQTNRNVEAIKREFEN 1488
            L+    S S   R  N+EI  L++ I+    ++ QL   +   DE  +  VE++K+ FE 
Sbjct: 1412 LEENAISYSSTVRKLNEEIATLKEEIEKQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEE 1471

Query: 1489 QKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKR 1548
             K KFI EKT E NK++ E  E++        +P +   V+++ ++KQWE + EE + +R
Sbjct: 1472 DKIKFIEEKTREVNKKIQEAQERLN-------QPSS---VNIDEMKKQWEAEHEEEVAER 1521

Query: 1549 IAEAEDNLKKRIRLPSEEKINKIIEKRR-------------------------------- 1576
            + EAE+ LKKRIRLP+EEKI+KIIE+++                                
Sbjct: 1522 VREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSISGSEQMEAMLQKQL 1581

Query: 1577 --------SELESEFDQKIRDKARDLLMNDH-SXXXXXXXXXXXXXXXXXXXXDELQAAR 1627
                     ELE E+++K+++K +++  +   S                    DELQ  +
Sbjct: 1582 EIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVK 1641

Query: 1628 KKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSE 1664
            KK+FEEGKQQATMKTTLLERK+ K+ESQ+ E ++ +E
Sbjct: 1642 KKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAE 1678

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/1709 (34%), Positives = 954/1709 (55%), Gaps = 116/1709 (6%)

Query: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68
            IA+F       VES+  +L   +  K  +F +L+S+NL+  V  +E K N S K + LK+
Sbjct: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83

Query: 69   ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKE 128
            E++ +++ N  +R E     +K   LE+  N K    N+L    E ++   D   E  KE
Sbjct: 84   EMENLIKQNDGIRKERDDTCDK---LESEKNEKTKISNEL----ESIKRRADDLIEEKKE 136

Query: 129  LNGS-------YDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSE 181
            L  +        DE++ ELE  R +      + K L   I++LE K Q+  +S+LN ++E
Sbjct: 137  LQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAE 196

Query: 182  LERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXX 241
            LER AQE+ +L+   +WLE+EL +KN+ ++ YRKKTD ++ +    +  L+SD       
Sbjct: 197  LERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTK 256

Query: 242  XXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLEST 301
                    DE ++ LQ  L+E K L D L+ EKQEF  E+++K +L+ L E+Q+ +++  
Sbjct: 257  NDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEE 316

Query: 302  LQ--QKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQT 359
            L   +  +T+  ++++ SE  + L +EL L + +L   + +C+RL SI+           
Sbjct: 317  LDSTRGLETSNDSKKHMSEK-EDLVKELQLTKEELAQCKSECIRLSSII----------- 364

Query: 360  KGRKRTYXXXXXXXXXXELGSFDD-SSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVES 418
                               G  D+ S  S SR   D  +LK+QL++EKR KE LQNQ+ES
Sbjct: 365  -------------------GETDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIES 405

Query: 419  FVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQ 478
            F++ELEHK+P+INSF+ERT  LE EL + ALLLEH + E   K  EL +  +K+    + 
Sbjct: 406  FILELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCEND 465

Query: 479  LEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSND-NMASTNDSQKVI 537
            ++ L++QR DL  Q+QY                ++EI FI+N++ ND + A+  DSQK++
Sbjct: 466  IQTLIKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIV 525

Query: 538  SEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAI 597
            +E L++F+ I +LQEKN EL+K VR LA +L                 ++E   EAKEAI
Sbjct: 526  TERLVEFRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKI---ESETINEAKEAI 582

Query: 598  LTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLE 657
            LTL+   E LE  ++ + KE +  K L+S +   +  S+  + + +E K   E  ++DL+
Sbjct: 583  LTLKAEKEQLESKVEELEKECENSKALLSNEETSHLNST--IQQLNETKRNLECQIQDLQ 640

Query: 658  NRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLS 717
            + ++Q+T +S  +   L +E+  L+   S +++++ K +S++ LAEER K+  N+++L  
Sbjct: 641  SNISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTK 700

Query: 718  KENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREI 777
             EN+QLR R   L+ ++L+QD +TQ+T + Y+   SK +  ET + NL+ E  L  D E 
Sbjct: 701  AENDQLRKRFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQ 760

Query: 778  SLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLS 837
            +LK E+   + EKT LRIMVTQLQ+LQ ERE LL+  +  ++ +I E+ + + +L  + S
Sbjct: 761  NLKQEMQKLSSEKTGLRIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEAS 820

Query: 838  ERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELE 897
             +   I ++E++ N+  EWYQ KI+               K  E+E+L  + K+LEKE++
Sbjct: 821  HKDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEID 880

Query: 898  GAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKEL 957
              +IR+HTY  I            + KELEK+KI L DAYSQ++E+K L + +  +LK++
Sbjct: 881  ENKIRLHTYNVIDGTINDDS----LRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQM 936

Query: 958  NASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQT 1017
            ++ F    +D+ +              +  +LK+Q+ N+ NEL +Q++  + E+    + 
Sbjct: 937  HSKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKK 996

Query: 1018 IAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISEL 1077
            I+ LQ   + +E VK  +E KL K++ DL++QT+YAN AQ NYEQELQ+HADVSKTISEL
Sbjct: 997  ISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISEL 1056

Query: 1078 REQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLL 1137
            REQ    +    +LT     L+  + +NE+   S+R     Q++ +  RI+D+T QN+LL
Sbjct: 1057 REQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLL 1116

Query: 1138 YNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLD-- 1195
            Y+QI+L   A+    +++D  A  S  ++LSLRRERDILDTK+ V E +   L+QK+   
Sbjct: 1117 YDQIELYTTADKGVTDTNDKPALNS--ILLSLRRERDILDTKVTVAERDAKMLRQKISLM 1174

Query: 1196 DIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDE 1255
            DI+ +   TK   + LE E  +   +I  ++ I   L QLNLLRESN+TLRNEL+   +E
Sbjct: 1175 DIELQEARTKLDNSRLEEE--KRPTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEE 1232

Query: 1256 KDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKV 1315
            K  +  +L   + ++ P++S L +    ++EK+ ++    +E  RWK R ++++EKH+++
Sbjct: 1233 KRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQM 1292

Query: 1316 NVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISN 1375
            +  DY KLE  ++  K  LD K ++  E  +RFNRL++QA E+L TSK    +L EQ+++
Sbjct: 1293 SSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVND 1352

Query: 1376 LISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELEVKLQNE 1435
            L + K  + K LD                 +  N L+ ++       + S+E + KL+ +
Sbjct: 1353 LKNAKIKLEKSLD--DANTKIEELENAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEK 1410

Query: 1436 IESSSLASRNTNKEIEELQKVIDD---LKTQLAANSTDADEQTNRNVEAIKREFENQKTK 1492
                    +  N+EI  L++ I+    ++ QL +   +     ++ VE++K+ FE  K  
Sbjct: 1411 ATFYDSTIKKLNEEIITLREEIEKQRRIQQQLQSEPANEQNDLSKIVESMKKTFEEDKIN 1470

Query: 1493 FIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEA 1552
            FI EKT+E N++++E  E++        +P    N++++ L+ +W+ + EE +  RI EA
Sbjct: 1471 FIREKTKEVNEKILEAQERLN-------QPS---NINIDELKIKWKAEHEEEVVNRIREA 1520

Query: 1553 EDNLKKRIRLPSEEKINKIIEKRRSELESE-------------------------FDQKI 1587
            E+ LKKRIRLP+EEKI+KIIE++R +LE E                         F+ +I
Sbjct: 1521 EEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRI 1580

Query: 1588 RDKARDL------------LMNDHSXXXXXXXXXXXXXXXXXXXXDELQAARKKAFEEGK 1635
            ++K ++L              N  S                    +ELQ  +KK+FEEGK
Sbjct: 1581 QEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGK 1640

Query: 1636 QQATMKTTLLERKIQKLESQIQEKEKDSE 1664
            QQA MKTTLLERK+ K+ESQ+ E +K +E
Sbjct: 1641 QQAMMKTTLLERKLAKMESQLSETKKITE 1669

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/1750 (33%), Positives = 957/1750 (54%), Gaps = 110/1750 (6%)

Query: 7    SEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKL 66
            S++A FL V+ + V+ L + +      KA EF+++++DN+R ++ ++  K N   K    
Sbjct: 16   SKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTF 75

Query: 67   KEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERY 126
            KE+++ ++ D    + E +   ++   L         E+ +L++  E  +  ++      
Sbjct: 76   KEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAK 135

Query: 127  KELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELERNA 186
            +++    +EK+++L   ++E   L    K L    ++LE   Q Y+S EL  KSE++R  
Sbjct: 136  QDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLH 195

Query: 187  QEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXXXXXXX 246
            QE+ L++ N +WL +EL +KN+    +R+KT+  + +    V  LKS             
Sbjct: 196  QELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLK 255

Query: 247  XXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQKF 306
                E + QLQ  L+E K L DVL  EK+EF +E+S+K +LI L E+Q+ S++S L+  +
Sbjct: 256  AKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAY 315

Query: 307  KTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILD-----HDSNDVSLQTKG 361
            ++A  N  ++ E    L +EL   ++ L+  + + ++LE+ ++     +  N V++    
Sbjct: 316  QSANQNGMSTPEK-DQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSN 374

Query: 362  RKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVI 421
               T              S D    ++ ++ GDI ILK+QLVQE+RQKE+LQNQVESFV+
Sbjct: 375  VSDT--------------SLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVV 420

Query: 422  ELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEI 481
            ELEHKIP++NSF+ERT +LE+EL D  LLLE   K+ + KT EL   K KI++  SQ+  
Sbjct: 421  ELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCS 480

Query: 482  LLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVISEHL 541
            L+ QR+DLAHQ+QY                E E++F+K ++S+++ A  +D+Q +ISE L
Sbjct: 481  LIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERL 540

Query: 542  IKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAILTLE 601
            ++FK + +LQ KN EL+ T+R LA +L                 + +   EAKEAIL+L+
Sbjct: 541  VQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSV---ETQTVKEAKEAILSLQ 597

Query: 602  KVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRLT 661
            +  + LE  L+IV+KERDAFKL  S +++ +   S++    ++ K  +E ++ +LE RL 
Sbjct: 598  EHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSST----YQSKKLDEHIM-ELEKRLK 652

Query: 662  QLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENE 721
             L   S  + K L +E+  L+K  S++ V +E+ RS+K LAEERLK+ Q+++ L  +EN 
Sbjct: 653  NLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENL 712

Query: 722  QLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKS 781
            +L  RS  L+  LL+QD++TQ T    +   S+ S+L + +  L +E   L+  E  LK+
Sbjct: 713  ELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKN 772

Query: 782  ELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVH 841
            E    T+E T  +I+V+QLQ+LQ ER+ LLE  Q++++K I ++     +  + L  R  
Sbjct: 773  ENEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTR 832

Query: 842  EIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELEGAQI 901
            E ++      +QY+W+Q K+D  +            K + +E L L  K+L  +LE A++
Sbjct: 833  EYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAEL 892

Query: 902  RIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASF 961
            R  +Y  +            + K LEK  I LADAYSQ+E++K++++ SE +  E++ + 
Sbjct: 893  RTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKAL 952

Query: 962  NAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAEL 1021
                 +YR               +  +L  Q++++ +EL  Q  + +SE+  L + ++ L
Sbjct: 953  EESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSIL 1012

Query: 1022 QGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQN 1081
            QG+ + ++E+K  +EEK+ KL+ DL +Q  YAN AQKNYEQELQ+HADV+KTIS LRE++
Sbjct: 1013 QGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREES 1072

Query: 1082 QRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQI 1141
            Q+ K++ +         +  + +NE+    +  +   Q+ LAQQR +++  QN+LLY+Q+
Sbjct: 1073 QKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQV 1132

Query: 1142 DLLNRAESVNENSSDDEANGSTA-----LVLSLRRERDILDTKINVIETEKNSLQQKLDD 1196
            +LL++A      SSD EA  S +     L+++LRRERDIL+TK++V   E+  L+Q+L  
Sbjct: 1133 ELLSKA-----TSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGL 1187

Query: 1197 IQNELEN-----TKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQ 1251
             + ELEN     +K  A   +S ++  S      + I   L QLNLLRESNVTLRNE K+
Sbjct: 1188 AKTELENVRLEFSKTQATAPDSIFARESQ-----EQIMEKLNQLNLLRESNVTLRNESKK 1242

Query: 1252 ALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEK 1311
             L++      ++   + +L PL+S L+S    I E+D +I+   +ES RWK R ++++ K
Sbjct: 1243 YLEQSQHFQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHK 1302

Query: 1312 HQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQE 1371
            +++++  ++ KL + + E K  L+ K  E  E  +RF +L+KQA+E+L+  K  ++ ++ 
Sbjct: 1303 YERIDPVEHQKLADEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVES 1362

Query: 1372 QISNLISEKDDIRKQL-DVKTXXXXXXXXXXXXFREKQNDLETLR---EELNKEISKSEE 1427
            +   +   K  +  +L                   EK  + ++L+   EEL     ++ E
Sbjct: 1363 EFEAVSIAKAQLEAELAQTLDKVSELESKLSSSANEKNGEADSLKEELEELRANFIEANE 1422

Query: 1428 LEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQL------AANSTDADEQTNRNVEA 1481
                ++ E  SS    ++   +I+EL + I  L++++      A NS D+ +     VE 
Sbjct: 1423 AVADIKAEAASS---EKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPDFAPI-VEN 1478

Query: 1482 IKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEK--------------PDTELN 1527
            +K++FE +K   I EK EE   +L    E+I+ +++E  +              P+  L 
Sbjct: 1479 MKKKFEEEKQVLIQEKDEELRMKL----EEIQKQYEEERERELSELKASLVESTPNAPL- 1533

Query: 1528 VDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKI 1587
            +D E L+ + E + E+   +RI EAE+ LKKRIRLPSEE+IN++IE+R+  L+ EF+ ++
Sbjct: 1534 IDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRV 1593

Query: 1588 RDKARDLLM-NDHSXXXXXXXXXXXXXXXX----XXXXDELQAARKKAFEEGKQQATMKT 1642
            R +A +L   N  S                        ++L   RKKAFEEGKQQ  MK 
Sbjct: 1594 RARALELFKENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKV 1653

Query: 1643 TLLERKIQKLESQIQEKEKDSEETQDVKPEE----NSTPSVKKIPETLNSSDTSFGNSNN 1698
             LLE KI KLE Q               P +    NS PS  KIP  +++++ S      
Sbjct: 1654 KLLESKIAKLEGQ---------------PNKINLNNSVPS--KIP--IDNNNNSSPQGAQ 1694

Query: 1699 VKVLKPSSPF 1708
               +KP SPF
Sbjct: 1695 PIAIKP-SPF 1703

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/1706 (31%), Positives = 918/1706 (53%), Gaps = 80/1706 (4%)

Query: 12   FLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKEELD 71
            FL +E + + ++   +   I +KA EF QLQ++NLRT+V ++E +++   K    K+++ 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 72   YVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKELNG 131
             ++++   +R E+    +    L +     L +   L+   E L+           ++  
Sbjct: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVAR 141

Query: 132  SYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELERNAQEILL 191
              +EK++EL   + E  +L  + + L  + L+LE + +  +S +L RK+EL R +QE+ L
Sbjct: 142  LLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSL 201

Query: 192  LRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXXXXXXXXXXDE 251
             R N EWLE +L  KN  F  YR  T   +      +E L+ +                 
Sbjct: 202  CRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNAR 261

Query: 252  TTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQKFKTAEA 311
             T  L+  L   K L D L  EKQEF +E+S+K++L+ L E Q++SL+S L+ +    E 
Sbjct: 262  ITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEG 321

Query: 312  NEENSSEVVKSLKEELSLAERKLQDMEEKCVRLE-SILDHDSNDVSLQTKGRKRTYXXXX 370
            ++ + S  + +L EEL+   ++L++ E K  +LE ++ D  S D   + K     Y    
Sbjct: 322  DDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEY---- 377

Query: 371  XXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVI 430
                            S++ + GDI +LKRQ++ EKRQKE LQNQVE+FV+ELE K+P++
Sbjct: 378  --------------PASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPML 423

Query: 431  NSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLA 490
            +SF++R  +LE++L +TA +LE  +K+ E    +L+  K +I D   Q+  L RQR+DLA
Sbjct: 424  SSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLA 483

Query: 491  HQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQL 550
             Q+QY                 +EI F++ ++   +++   D+QKVISE L++F+DI +L
Sbjct: 484  RQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVEL 543

Query: 551  QEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAILTLEKVNENLEKN 610
            Q KN +L++T+R LA +L                 +N+   EAKEAI+TL++  + LE  
Sbjct: 544  QSKNSDLLRTIRNLADKLESEEEQSKMRSKTV---ENDAIREAKEAIITLQEHAQELESR 600

Query: 611  LQIVTKERDAFKLLVSEDRERNFKSSNSV--HKYHELKSYNETVVKDLENRLTQLTNDSN 668
            ++++TKERDA+K +     + +  + N +  H     K      V DLE  L     ++ 
Sbjct: 601  IEVLTKERDAYKAI-----QPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAE 655

Query: 669  AHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSS 728
             + K L  E+  L ++ ++L ++IEK R++K LAEERLK++Q S++L  +ENE+L  R  
Sbjct: 656  KNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYH 715

Query: 729  RLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTE 788
             ++D+LL+QD +TQ+T S  +E  SK ++LE+ +++   ++  L   +      +   T 
Sbjct: 716  IIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTA 775

Query: 789  EKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEK 848
            E+  L I+VTQLQ+LQ ER+ LL   +  +K+++  +     +L  QLS +  E +   +
Sbjct: 776  ERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQ 835

Query: 849  ERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELEGAQIRIHTYET 908
              +++ +WYQ+KID  +           ++      L  Q K LE  L+  + +  +Y+ 
Sbjct: 836  TNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDV 895

Query: 909  IXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASF----NAK 964
            +            +  ELEK+KI+L DAYSQ+EE ++  +++E+AL  +  +F    N  
Sbjct: 896  LNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEH 955

Query: 965  DRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGA 1024
             +D+ +             G+ E LK Q+ N+ NEL  Q ++ +SE+  L   +  LQ  
Sbjct: 956  SKDFGN----MKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQST 1011

Query: 1025 AQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRL 1084
             + +  +K+ +E++L KL  DL +Q  +AN AQ+NYEQELQRHADVSKTIS+LRE++Q+ 
Sbjct: 1012 QETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKY 1071

Query: 1085 KNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLL 1144
            KN    L + ++ L+  + +++    ++++EY  Q+    QRI+D+T QN LL +Q+DL 
Sbjct: 1072 KNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDL- 1130

Query: 1145 NRAESVNENSSDDEANGSTA---LVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNEL 1201
               E+ + NS   ++        L+ SLRRERDIL TK+ V +  +    +KL+ I+ EL
Sbjct: 1131 ---EAKDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQEL 1187

Query: 1202 ENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAK 1261
               K   + L++  S++S + + +  +   L QLNLLRESN+TLR+E+++      ++  
Sbjct: 1188 SFAKEELSSLQALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEG 1247

Query: 1262 DLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYT 1321
             +   +  L PL+S L S    ++ KD +I+  ++E+ RWK R ++++ K ++++ +++ 
Sbjct: 1248 QIDNLQQSLQPLESELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHK 1307

Query: 1322 KLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKD 1381
            KL E L++ K  L  K  + +EL DRF RLKKQA E+L+ +K +Q++L  +++     + 
Sbjct: 1308 KLGEELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQS 1367

Query: 1382 D----IRKQLDVKTXXXXXXXXXXXXFRE---KQNDLETLREELNKEISKSEELEV---- 1430
            +    +RK+ DV               +     Q +LE+  ++L++   K++++E     
Sbjct: 1368 NMELQLRKEQDVNKALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQ 1427

Query: 1431 ---KLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFE 1487
                LQ+E+E     +    + ++E ++ ++ L+       TD+ E     +E +KR+ E
Sbjct: 1428 IEKALQSELEKVKSHAEELERRLDEARREVESLEEVKQGAFTDSSE-----LEKMKRDLE 1482

Query: 1488 NQKTKFIAEKTEEFNKRL----IEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEE 1543
                  IAEK  E         ++E      E +EN K      VD+E L+KQWEED E+
Sbjct: 1483 EHSNTLIAEKEAEIRSHYEELRLKEKATYEKELEENGK---HTPVDIETLKKQWEEDYEQ 1539

Query: 1544 LIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSXXX 1603
               KRI E+ + L+KRIRLP+EEKINKI+E R+SELE EF+ K++ +A +L         
Sbjct: 1540 KTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPAS 1599

Query: 1604 XXXXXXXXXXXXXXXXXD-------ELQAARKKAFEEGKQQATMKTTLLERKIQKLESQI 1656
                             D       E+   RKKAF+EGKQQA+MK+  LE+KI KLE+Q+
Sbjct: 1600 FTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQV 1659

Query: 1657 QEKEKDSEETQDVKPEENSTPSVKKI 1682
            +       E     P   ++P+ K +
Sbjct: 1660 K---ASGTEAVPSAPTSKNSPTEKPV 1682

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/1690 (31%), Positives = 911/1690 (53%), Gaps = 76/1690 (4%)

Query: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68
            I +FL+V    + ++   +   + +K E+F +LQS +L+  V LEE +     +   L+ 
Sbjct: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75

Query: 69   ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKE 128
            +L+ ++E N     E K + +++     SD  K  E  QL ++ + L+  +    E++  
Sbjct: 76   QLEDLIEQNASASEEKKKIEKEL-----SDEKK--ESFQLSSTRDNLRAELKEIQEKFDN 128

Query: 129  LNGS-------YDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSE 181
            L           D K+++ E  ++   +L  Q +    K  +LE + Q  + ++   ++ 
Sbjct: 129  LQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETT 188

Query: 182  LERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXX 241
            + + +Q++  + + +E LE EL NK++    Y       +      +  L+++       
Sbjct: 189  MNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSE 248

Query: 242  XXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLEST 301
                       +  L     + ++L ++   EK+E  KELS+K ++I + + Q++ L+  
Sbjct: 249  NDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDD 308

Query: 302  LQQKFKTAEA---NEENSSEVVKSLKEELSLAERKL-QDMEEKCVRLESILDHDSNDVSL 357
              +   T +    N+E  +  V+ LK++L   E +L +++EE+             ++++
Sbjct: 309  YTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEER------------RNITM 356

Query: 358  QTKGRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVE 417
            QT                       +SS   ++ Q D+  +K++L+QE+ QKEKLQNQVE
Sbjct: 357  QT-----------------------ESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVE 393

Query: 418  SFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNS 477
             F++ELE K+P INSF++RT +LEKELTD  LLLE+  +E    TNEL +L++       
Sbjct: 394  IFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKW 453

Query: 478  QLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVI 537
            + + L +QR DLAHQLQY                 +E++FI++++ N++   ++DSQ+VI
Sbjct: 454  ETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVI 513

Query: 538  SEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAI 597
            SE L+ F++I +LQ+KN++L+K+VR LA++L                 + +   EAKEAI
Sbjct: 514  SERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVV---EQQAIDEAKEAI 570

Query: 598  LTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYH-ELKSYNETVVKDL 656
            ++L+  N  LE  ++ +  E D +K L   D          V   H  L   N  ++K+L
Sbjct: 571  ISLQSYNTKLEDKIKTLNDELDCYKSLPKPD--------TKVETEHLRLNEENTDLIKEL 622

Query: 657  ENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELL 716
            E RL     +SN    +L  E++ + +  SQ   + +  R+++ LAE+RLK+ QNS+ L 
Sbjct: 623  ETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLS 682

Query: 717  SKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDRE 776
              ENEQL+ R   L+D  L+QD+ TQ+T   YV      S+ +  +  +++++ + K  E
Sbjct: 683  KVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNE 742

Query: 777  ISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQL 836
             SLK +++  ++E+ +L+ +V+QLQSLQ+ERE +    + D + R+  V      + ++L
Sbjct: 743  KSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKL 802

Query: 837  SERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKEL 896
              +  EI ++E  R ++ EWYQ KID               K +E+  L+ + K L+K+L
Sbjct: 803  KNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDL 862

Query: 897  EGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKE 956
            + ++ R+  Y+ +            +  ELEK+KI L++AY++L+++K  +   E+ L+ 
Sbjct: 863  QASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLEN 922

Query: 957  LNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQ 1016
               +     +++                   IL +Q+ ++ NEL  Q++    E+  +++
Sbjct: 923  YQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISK 982

Query: 1017 TIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISE 1076
             + EL      IEEV   +E KL  L+NDLE+Q  YAN AQ NYEQELQ+HA+++KTIS+
Sbjct: 983  KLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQ 1042

Query: 1077 LREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQL 1136
            LRE     +    S+ A   + ++ + +NEK  + +R  Y  QI   ++RI+D++ QN+L
Sbjct: 1043 LREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKL 1102

Query: 1137 LYNQIDLLNRAE-SVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLD 1195
            L++Q+DLL+++E S N+ SS   A  +  LVLSLR +RDIL T+++V E E  +L+ KL 
Sbjct: 1103 LFDQVDLLSKSENSYNQQSS---ATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLS 1159

Query: 1196 DIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDE 1255
             +  EL NT+     +  +Y      +  +  I   L QLNLLRESN+TLRNE   + ++
Sbjct: 1160 SVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREK 1219

Query: 1256 KDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKV 1315
              ++ +DL+  R ++LPL++       +IKE + ++ +  +E  RWK R ++++ KH+K+
Sbjct: 1220 AKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKI 1279

Query: 1316 NVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISN 1375
            +  ++ KLE  +   KQ L +K +E  ELNDRFNR+KKQAHE+LN+SK  Q +L +QI  
Sbjct: 1280 DPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQ 1339

Query: 1376 LISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELEVKLQNE 1435
            L  E   I+  L+ +               ++  D+  LR +L + +  S+E E K    
Sbjct: 1340 LEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNAS 1399

Query: 1436 IESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRN-VEAIKREFENQKTKFI 1494
            ++SS   S + N  I+ L   +  LK      +T   +    N VE +K+ FE +K KF+
Sbjct: 1400 VKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFV 1459

Query: 1495 AEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAED 1554
             ++T EF ++L EE ++I  +  + +  +     D+ A R+QWE++ EE++ KRI +AE+
Sbjct: 1460 QDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEE 1519

Query: 1555 NLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSXXXXXXXXXXXXXX 1614
            NLK+RIRLP+EEKIN +I+K+++ELE E+D+K+  +A++LL ++ +              
Sbjct: 1520 NLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKE 1579

Query: 1615 XXXXXXDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDV----- 1669
                   EL+ A+ KAFEEGKQQA MKTT LE+KI KLESQ+Q     +E   DV     
Sbjct: 1580 LERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLK 1639

Query: 1670 -KPEENSTPS 1678
               +EN+ PS
Sbjct: 1640 TPSDENNVPS 1649

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1781 (30%), Positives = 952/1781 (53%), Gaps = 154/1781 (8%)

Query: 7    SEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKL 66
            S +A FL V++  ++ +  ++   I  K E+  + +S+NLR    L++ K+   +K E  
Sbjct: 8    SRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESF 67

Query: 67   K---EELDYVVEDNTKVRA----ENKTLSEKVWSLETSDNSKLAE-INQLKTSNEGLQNN 118
            K    +L   +ED    R     E + L E         NS++ + I +L+   E  +  
Sbjct: 68   KIHISQLAKALEDGKDERLHFEEEKRRLIE--------GNSQVTKRIIELEQEIEVERQQ 119

Query: 119  IDRANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNR 178
             + A+   +++  S +EK+ EL   + +  E Q   K L  K++  E + Q  Q+ EL  
Sbjct: 120  KELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRS 179

Query: 179  KSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXX 238
            KSE+ R  QEI LLR+N +WL  +L  K      +R+ T   + D+   V  ++S+    
Sbjct: 180  KSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIA 239

Query: 239  XXXXXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSL 298
                           EQL+  L ENK++KD     KQE  KE+S+K ++I   E  ++SL
Sbjct: 240  RTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESL 299

Query: 299  ESTLQQKFKTAEANEENSSEVVKS----LKEELSLAERKLQDMEEKCVRLESILDHDSND 354
            +  +      A  N  +SS   +     L EEL+  + +L   E  C++L+  +D  +++
Sbjct: 300  KKEMD-----ATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSN 354

Query: 355  VSLQTKGRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQN 414
            + L+      T              S + S   + ++ GD+ +LK+QLV EKRQK++L+ 
Sbjct: 355  IKLEDSEVGNTT------------ASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKM 402

Query: 415  QVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISD 474
            QVE+FV+ELEHKIPV+NSF+ER+ +LE+EL +  +LLE   K+ + K+++L  LK  +  
Sbjct: 403  QVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKS 462

Query: 475  DNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQ 534
              +Q+  L +QR DLAHQ+QY                 +E++F+KNL ++  +  T+D+Q
Sbjct: 463  YETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQ 522

Query: 535  KVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAK 594
             +I++ L++F+ + +LQ+KN EL+ T+R LA +L              V ED E   EAK
Sbjct: 523  GIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQ--VLED-ETVREAK 579

Query: 595  EAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSY-NETVV 653
            E ILTL    +NLE  L I++KERDA+K L       N  S  +  K     S  N+  V
Sbjct: 580  ETILTLHDHAQNLENQLVILSKERDAYKALSV-----NASSGTNTPKAITYPSPDNDDKV 634

Query: 654  KDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSM 713
            KDLE RLT +  ++  ++K  + E + L K++ ++++  E  +++++LAE+RL + Q+++
Sbjct: 635  KDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTL 694

Query: 714  ELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLK 773
            EL  ++ E+L+ RSS L+D L +QDK TQ+T  S ++  S  SS+++ +  L++E   + 
Sbjct: 695  ELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMA 754

Query: 774  DREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLD 833
              +  LK+E    ++E  + ++++ QLQ+LQ ERE LL+  Q+ +K+++        KL+
Sbjct: 755  KVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKL-------RKLE 807

Query: 834  KQLS---ERVHEIDK----IEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLH 886
             +LS   ER+ EI+K    I   +  QY W+Q+KID+ +            K  +L+++ 
Sbjct: 808  IELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQ 867

Query: 887  LQNKTLEKELEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNL 946
                    +L+ A+ R  +Y  +            + +ELEK  ++L+D+YSQ+E  K L
Sbjct: 868  STINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTL 927

Query: 947  SQNSEDALKELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEE 1006
            ++ S  ++ E++ +F    ++ +                  IL  Q++++ NE+  Q  E
Sbjct: 928  AEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSE 987

Query: 1007 AESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQR 1066
             ++ER    + I++LQ   + ++  K  +EEK+  ++ DLE QT YAN +Q++YE ELQ+
Sbjct: 988  YQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQK 1047

Query: 1067 HADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQR 1126
            HADVSKTI+ LR + Q  K+D ++L  + Q   + +  +EK    ++ EY  ++ + +QR
Sbjct: 1048 HADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQR 1107

Query: 1127 IDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETE 1186
            + +++ QN+LLY+QI+LLN+ E   +NS D     S+ L++SLRRERD+L+TK+ V  +E
Sbjct: 1108 VQELSTQNKLLYDQIELLNKTED-RDNSHD-----SSDLLISLRRERDMLETKLEVALSE 1161

Query: 1187 KNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLR 1246
            +  L+Q+LD  ++E+E+     + +++  SE + L+   + I  +L+QL+LLRESNVTLR
Sbjct: 1162 QTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLR 1221

Query: 1247 NELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLE 1306
            +E      E D +   LQ C + L PLQS++ S  N IK K+ ++  + +E++RWK+R +
Sbjct: 1222 SENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQ 1281

Query: 1307 EMIEKHQKVNVDDYTKLEETLNE-------TKQLLDNKVQETNELNDRFNRLKKQAHEKL 1359
            +++ K+++++ +++ KL+E +N+       TK  L + + E ++   +F R++ QA ++L
Sbjct: 1282 DILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRL 1341

Query: 1360 NTSKELQSSLQEQISNLISEKDDIRKQLD-VKTXXXXXXXXXXXXFREKQNDLETLREEL 1418
            N SKE + SL  +I+ +   K  +   L   KT             +E     ET  +  
Sbjct: 1342 NASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQEA----ETKEQTF 1397

Query: 1419 NKEISKSEELEVKLQNEIESSSLASRN---TNKEIEELQKVIDDLKT---QLAANSTDA- 1471
            N ++SK +E    +Q ++E++S   +N   ++++I+ L + ++ L +   +L A +++A 
Sbjct: 1398 NSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQ 1457

Query: 1472 -----------DEQTNRNVEAIKREFENQK------------TKFIAEKTEEFNKRLIEE 1508
                       +E T   V+ +K EFE +K            +KF AEK   +N R    
Sbjct: 1458 KIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSR---- 1513

Query: 1509 TEKIRNEF----------------QENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEA 1552
             E++R +F                Q   +P   L++D++AL+ +WE++ E+   ++I  A
Sbjct: 1514 EEELRKQFEEREKRIREECEKTTVQSPSQPT--LDIDIDALKNEWEKEYEKQTLEKIKLA 1571

Query: 1553 EDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDL---LMNDH-SXXXXXXXX 1608
            E+ LKKRIRLP+++KI+KI+E R++ LE  F++K+ +KA+ L   + ND  +        
Sbjct: 1572 EEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAEL 1631

Query: 1609 XXXXXXXXXXXXDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQD 1668
                         +L   ++K+FEEGKQQ ++K   LE KI+ LE Q             
Sbjct: 1632 NALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQ----------KST 1681

Query: 1669 VKPEENSTPSVKKIPETLNSSDTSFGNSNNVKVLKPSSPFG 1709
            +KP EN T ++    +        FG+ +       +SPF 
Sbjct: 1682 IKPVENDTSNMSAAFQA-----PVFGSHSTF-----TSPFS 1712

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1682 (30%), Positives = 889/1682 (52%), Gaps = 82/1682 (4%)

Query: 3    TNTESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSK 62
            T TE  +A+FL ++R  + +++  +   I +K  EF QLQ++NL+ +V ++E +++ S K
Sbjct: 15   TETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHK 74

Query: 63   YEKLKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGL--QNNID 120
                K+++  ++++   VRAEN  L ++    +      + + + L+  NE L  Q  + 
Sbjct: 75   LGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVL 134

Query: 121  RANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKS 180
             AN+   ++    +EK+ ++  ++ E + L  + +TL  + LELE + + Y+S EL  K+
Sbjct: 135  EANK--NDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKA 192

Query: 181  ELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXX 240
            +  + +Q++ LL  N EWLE +L  KN  F  YR++T   +      +E  + D      
Sbjct: 193  DFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATK 252

Query: 241  XXXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLES 300
                      +   +L+      K L D L   KQEF +E+S+K +L++L E Q+ +L+S
Sbjct: 253  TIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKS 312

Query: 301  TLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTK 360
             L+ K     + +  ++E    +++EL    ++L++ E K  +LE  ++           
Sbjct: 313  ELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVE----------- 361

Query: 361  GRKRTYXXXXXXXXXXELGSFDDSSIS----LSRMQGDIKILKRQLVQEKRQKEKLQNQV 416
                            +L S D+ +IS    L  +  DI ILK+Q++ E+RQKE LQNQV
Sbjct: 362  ----------------QLLSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQV 405

Query: 417  ESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDN 476
            E+FV+ELE+K+P+++SF++R  VLEKEL +TA +L+  +K+ +    +L+  K +I D  
Sbjct: 406  EAFVVELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLE 465

Query: 477  SQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKV 536
            SQ+  L +QR+DLA Q+QY                 +E  F+K +V+ +N     D+Q +
Sbjct: 466  SQISALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGI 525

Query: 537  ISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEA 596
            ISE L++FK+I +LQ KN +L+ TVR LA QL                 +N+   EAKEA
Sbjct: 526  ISERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAI---ENDTITEAKEA 582

Query: 597  ILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETV-VKD 655
            I+TL+   + LE  + ++T+ERDA+K + S+       S+  +   +   S N  + +++
Sbjct: 583  IVTLQDHIQELETRIDVITRERDAYKAIQSQTSHEG--SNGGLRDVNAKASENSDLKIRE 640

Query: 656  LENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMEL 715
            LE  L+    ++ A+ K L  E   L +  S+L V +EK +S++ LAEERLKI+++S+ L
Sbjct: 641  LEELLSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLL 700

Query: 716  LSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDR 775
              +ENE+L  R   LE++L +QD  TQ+T S  ++  S+ ++L   ++N   +  LL   
Sbjct: 701  TKQENEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTS 760

Query: 776  EISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQ 835
               LK      T+E+ +L I+VTQLQ+LQ ER+TLL+    +FK +I  +     +L   
Sbjct: 761  HQKLKETNEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTL 820

Query: 836  LSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKE 895
            LS++  E+       +++  WYQ+KID  +           +K   ++ L  Q   L  +
Sbjct: 821  LSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSK 880

Query: 896  LEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALK 955
            L  A+ +  +Y  +            +  ELEKT+I L DA+SQ++E+K L  ++++ L 
Sbjct: 881  LRDAETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLT 940

Query: 956  ELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLT 1015
             +  +     +D+                   +LK QL N+ +EL  Q    E+ +    
Sbjct: 941  AMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHN 1000

Query: 1016 QTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTIS 1075
            +   E++     +  +K  ++ +L KL  DL +Q +YAN AQ+NYEQELQRHADVSKTIS
Sbjct: 1001 KCEEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTIS 1060

Query: 1076 ELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQ 1135
            +LRE+ Q+ KN   SL A +  L+  + +NE    +++ EY  Q  L+ QRI+D++ QN+
Sbjct: 1061 QLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNR 1120

Query: 1136 LLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLD 1195
            LL++QI L +  +S+  N  D+  + +  L+ +L+RE DIL TK+ + + ++++L+QKL+
Sbjct: 1121 LLFDQISLKD-TDSIPIN--DELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLE 1177

Query: 1196 DIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDE 1255
              + EL   K      +      S +I     I   L Q+NLLRESN+TLRNEL++    
Sbjct: 1178 FTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQR 1237

Query: 1256 KDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKV 1315
               + ++++  +  L PL++++ +    +  KD +I+   +E  RWK R ++++ K+++V
Sbjct: 1238 NQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERV 1297

Query: 1316 NVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISN 1375
            + +++ KL E L++ +       Q+ +EL DRF RLKKQA E+L+ ++  Q++L  +++ 
Sbjct: 1298 DPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTE 1357

Query: 1376 LISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLE---TLREELNKEISKSEELEVKL 1432
                +  +   LD +               E  N++E     R++L   + K E+ + ++
Sbjct: 1358 ARESQKALEDALDKEREKTRSLQESIKATEE--NEIENSSATRDQLQDALQKLEDAQARI 1415

Query: 1433 QNEIESSSLASRNTNKEIEELQKVIDDLKTQLAA--NSTDADEQTNRNVEAIKREFENQK 1490
                 + S   +   +E+E  ++ +  L+  LA   N     E+    V   + E    K
Sbjct: 1416 NEMSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVK 1475

Query: 1491 TKFI-----------AEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEE 1539
            T+ I           AE  E++ K+ +E+  ++      +E   +    D+E L+K+WEE
Sbjct: 1476 TELIDHSNKLLAEKEAEIKEKYEKQRLEDKAELEKSLASSESLKSS---DIENLKKEWEE 1532

Query: 1540 DSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDL----- 1594
            + E+   KRI EA + L+KRIRLP+EEKINKIIE R+ EL+ EF+ K++ +  +L     
Sbjct: 1533 EYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKP 1592

Query: 1595 -------LMNDHSXXXXXXXXXXXXXXXXXXXXDELQAARKKAFEEGKQQATMKTTLLER 1647
                   +M  H                     +E+  A+KKAF+EGKQQA+MK+  LE+
Sbjct: 1593 LPATFTEVMKRH-----KQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEK 1647

Query: 1648 KI 1649
            KI
Sbjct: 1648 KI 1649

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1734 (31%), Positives = 949/1734 (54%), Gaps = 74/1734 (4%)

Query: 1    MATNTESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLS 60
            +++ T +++A+FL+     V++L + +  ++ ++ +EF  ++++ ++ +  LE TK   +
Sbjct: 16   LSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNN 75

Query: 61   SKYEKLKEELDYVVEDNTKV--RAENKTLSEKVWSLETSDN-----SKLAEINQLKTSNE 113
            +  +KLK EL  +++    V    E+          +  DN     SKL +I+       
Sbjct: 76   TTIKKLKNELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIH------- 128

Query: 114  GLQNNIDRANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQS 173
             L+ N+     + +EL  S D+++TEL   R   + L  +     +KIL+LE + Q+ + 
Sbjct: 129  SLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKI 188

Query: 174  SELNRKSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKS 233
            ++L+++++LER +QE+  + K + WLE+ L  K + F  YR+K+     D    +  +K+
Sbjct: 189  NDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKN 248

Query: 234  DXXXXXXXXXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYEN 293
            +               DE + +L++     K+++     +K   +KEL++K +LI + ++
Sbjct: 249  ELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQS 308

Query: 294  QIKSLESTLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDH-DS 352
            Q+  L+              EN +E+  ++ +  S + RK  D   +   L++ L+H   
Sbjct: 309  QLNELQ-------------RENGNELSLTVSDTAS-SSRKDSDFTREINDLKNQLNHVQE 354

Query: 353  NDVSLQTKGRKR-TYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEK 411
             +V L+ K RK   Y             S DD   SL++   DI +LK++L  E+ Q+E 
Sbjct: 355  RNVELEFKLRKSEDYTAVSNST------SSDDLRNSLAKAYDDIDVLKKKLNDEQSQREN 408

Query: 412  LQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKK 471
             +  +E F+ +LE ++P + +++ R +  E+EL +  LLLE A KE  L ++EL   + +
Sbjct: 409  FEKNLEEFMDDLETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSR 468

Query: 472  ISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMAST- 530
            I     +++++ +QR+DLA+QLQ+                ++E+KFI+N++  D+     
Sbjct: 469  IQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDK 528

Query: 531  -NDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEI 589
              D+QKVISE L KFKDI +LQ+KNMEL+KT R LA +L              ++E  E 
Sbjct: 529  ETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSR-IEE--ET 585

Query: 590  FAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLV-SEDRERNFKSSNSVHKYHELKSY 648
             AEAKEAILTL+  N +L   +  +TKE + +K+L  +ED      +     K  E +  
Sbjct: 586  IAEAKEAILTLQNYNSSLTAKIAALTKELETYKVLSNTEDS----STPADFDKQREQREI 641

Query: 649  NET-VVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLK 707
              T +VK+LE R+  +  +S  ++  L +++  L ++ + +++++ + +SAK LAEERLK
Sbjct: 642  EHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLK 701

Query: 708  ITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLET 767
            + Q SM++   ENE+L+ R + L + +++QDK T +T +S ++  S+ +++E      + 
Sbjct: 702  LLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQN 761

Query: 768  EVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNY 827
            E+ LL   E  LK+EL+   EEK  ++++VT+LQ+LQSERE LL   Q  F K ++++  
Sbjct: 762  EIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEG 821

Query: 828  INEKLDKQLSERVHEIDKIEKERN-AQYEWYQKKIDEASXXXXXXXXXXXTKNDELER-L 885
                L K+L E       + +E    + ++ QKK  ++            ++  E ER  
Sbjct: 822  TCNDLRKKLKEAEENYGSLMEETTELKDDFRQKK--KSLKEEMSNVEKRYSEIVEKERET 879

Query: 886  HLQNKTLEKELEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKN 945
              +N  L K+L+     I  Y+              + KEL+  K EL ++YSQ E ++ 
Sbjct: 880  KWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRK 939

Query: 946  LSQNSEDALKELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSE 1005
              +    ++ ++N     K+  +++                 +LK Q++++ NEL VQ +
Sbjct: 940  DIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKK 999

Query: 1006 EAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQ 1065
              E E+   T+   EL+   + +E+ K+ +E+KL+ L  DLEEQ  YAN AQ NYEQELQ
Sbjct: 1000 LYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQ 1059

Query: 1066 RHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQ 1125
             HA+VSKTIS+LREQ Q  + +   LT      +  +++N+   + +RDEY  QI+  ++
Sbjct: 1060 NHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKK 1119

Query: 1126 RIDDITKQNQLLYNQIDLLNRA--ESVNENSSDDEANGSTALVLSLRRERDILDTKINVI 1183
            RI++ ++QN++L+ Q  L  +A  E   E+S  +   G   LVLSLR ERD+L  ++NV 
Sbjct: 1120 RIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVT 1179

Query: 1184 ETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNV 1243
            E E+  L+++L  I+ +   T      ++ E   + DL+  ++T+   L QL+LLRESN+
Sbjct: 1180 EAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNI 1239

Query: 1244 TLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKT 1303
            TLRNE  +   +   +  +++   ++LLPL++ L++  NLI+EKD +++  ++ES+RWK 
Sbjct: 1240 TLRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQ 1299

Query: 1304 RLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSK 1363
            R ++++ K+Q+++  ++  L E  N  +  L+ K +E  EL +RF +LKKQAHEKLN SK
Sbjct: 1300 RSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASK 1359

Query: 1364 ELQSSLQEQISNLISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNKEIS 1423
              Q+SL  QI++L ++K ++  QL+ +               +  +D+ +++ +L + + 
Sbjct: 1360 ISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALM 1419

Query: 1424 KSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLA----ANST----DADEQT 1475
            KS++ E K  N +ESS     N N EI++LQ+    L+ +LA      ST    + D+ T
Sbjct: 1420 KSKDFETKFINSVESSKQIEENLNSEIKKLQEESSKLQEELAHEKLTTSTTEIGNVDQDT 1479

Query: 1476 ------NRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENE-KPDTELNV 1528
                  N  VE++K+ FE +K KFI E+T EF K+L  E  K++ E++  + +P   +++
Sbjct: 1480 VDGGVSNDIVESMKQSFEEEKIKFIEEQTTEFKKKLQAEINKLKAEYETKQIEP---VSI 1536

Query: 1529 DVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIR 1588
            D  A+RKQ EE+ E+   +RI EAE+NLK+RIRLP+EEKINK+I+KRR++LE+EF  K+ 
Sbjct: 1537 DENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVE 1596

Query: 1589 DKARDLLMNDHSXXXXXXXXXXXXXXXXXXXXDELQAARKKAFEEGKQQATMKTTLLERK 1648
             +A++LL  D                      +ELQ  +KKAF+EG+QQ  MKT+ LE+K
Sbjct: 1597 ARAKELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKK 1656

Query: 1649 IQKLESQIQEKEKDSEETQD-VKPEENSTP--SVKKIPETLNSSDTSFGNSNNV 1699
            I KLES +Q  + ++  T + +   +N T      K P T+N++  S    NN 
Sbjct: 1657 ITKLESDLQNAKSNTGATDNTIVSTDNETKYEGSDKKPVTINTNVVSDVGENNA 1710

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  585 bits (1507), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 525/1749 (30%), Positives = 894/1749 (51%), Gaps = 118/1749 (6%)

Query: 7    SEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKL 66
            S +A  L +E+  V+ L ++L   +  + + F QL+++N R  V +   ++      E L
Sbjct: 19   SRLAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAENTRLKVSIGAAESACEHGVEAL 78

Query: 67   KE-ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANER 125
            +E +     E   + R + +       S   +    + E  +++   E  +  +   +  
Sbjct: 79   RERQQQLAAEAGAQQRGQGE-----AGSAGRAGGPSVPE--RVQQQLEETERRVAAGDSA 131

Query: 126  YKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELERN 185
             ++L    +EK+++L+  + E + +    K L    +ELE   Q  +S  L  ++E++R 
Sbjct: 132  RRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRL 191

Query: 186  AQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXXXXXX 245
             QE+ L+R N EW   +L  KNQ    YR+KT+  +      +  +K++           
Sbjct: 192  QQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAAL 251

Query: 246  XXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQK 305
                 E ++QLQ+ L E K L D L  EKQEF +E+++K +LI+L   Q+ +++  L++ 
Sbjct: 252  RSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKA 311

Query: 306  FKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKRT 365
            +  A+    + SE  + L + L   ++KL+  +    RLE  +       ++Q+ GR   
Sbjct: 312  YDVAKNGGMSDSERERLLND-LFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGI 370

Query: 366  YXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEH 425
                        +GS    S ++S + GD+  L++QLVQE+R KE+LQ QVESFV+ELEH
Sbjct: 371  --------EHANVGSPSGGS-TISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEH 421

Query: 426  KIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQ 485
            KIPV+NSF++R   LEK+L    LLLE   +E + K  +++  K K+ D  +Q+  L++Q
Sbjct: 422  KIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQ 481

Query: 486  RTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFK 545
            R+DLA Q+Q                  +E++F+K L S  + A+ +D+Q +IS  L++FK
Sbjct: 482  RSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFK 541

Query: 546  DIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAILTLEKVNE 605
             + +LQ+KN EL+  +R LAQ+L                E N +  EAKEAIL+L++  +
Sbjct: 542  SVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSL--EQNTV-NEAKEAILSLQEHVQ 598

Query: 606  NLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTN 665
             LE  L+ VT ERD+FKLLVSE +  N    N V             +  LE RL  +  
Sbjct: 599  MLEDQLETVTTERDSFKLLVSEGK--NNSLPNPVGAAALQPQEVADGIAHLEARLKAMAE 656

Query: 666  DSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRI 725
            +S  H+K L EE+  L+K  SQL +++E+ RS++ LA+E+L + Q S+EL+  EN  L+ 
Sbjct: 657  ESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQN 716

Query: 726  RSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSN 785
            R+  L+  LL+QD   Q T   +V A S+  S+ + +  L++E   L+  E  LK E  +
Sbjct: 717  RAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENES 776

Query: 786  TTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDK 845
              ++    ++++ QL++ Q ER++L+E  +  ++ RI E++       +QL  +  E D+
Sbjct: 777  LNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDE 836

Query: 846  IEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELEGAQIRIHT 905
            +    + Q +W+Q K+D               K  EL+ L  +  +   +LE A +  H 
Sbjct: 837  LSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMD-HQ 895

Query: 906  YETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKD 965
              ++            + K+L++   +L+ AYS++E +K  S  +E      NA  + KD
Sbjct: 896  QSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKD 955

Query: 966  RDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAA 1025
               + A                +   +++ +++EL  +     +ER  L + I  L    
Sbjct: 956  -GSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDK 1014

Query: 1026 QPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLK 1085
            Q IEE K  +++K+ +L+ DLE+Q    N A+  Y+  LQ+ A++S+ I  LR+ ++  K
Sbjct: 1015 QRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYK 1074

Query: 1086 NDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLN 1145
            ++     +  +  +  + +NE+    ++ +    +DLA QRI++++ QN+LLY+QI+LL+
Sbjct: 1075 SEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLS 1134

Query: 1146 RAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTK 1205
            R+ S +       ++ +  L+++LRRERDIL+TKI+V + E+  L+Q+L+  ++EL+N +
Sbjct: 1135 RSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLR 1194

Query: 1206 RSAALLESE--YSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDL 1263
              A L ES+   +E +D   N + +   L QLNLLRE N++LRNE        +K+++  
Sbjct: 1195 --AQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNE-------SEKVSEHN 1245

Query: 1264 QICRNELL-------PLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVN 1316
            +  +NE+L       P++  ++S    + EK+ K+A   +ES RWK R ++++ K+++++
Sbjct: 1246 EFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERID 1305

Query: 1317 VDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNL 1376
             ++Y KL   +   K  L+ K  E+ +  +RF +L+KQA+E+L+  K  ++ ++ ++   
Sbjct: 1306 PEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELA 1365

Query: 1377 ISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLET------LREELNKEISKSEELEV 1430
            +S K  +  +L                 REK   LET        E+ N    + EE + 
Sbjct: 1366 LSGKSQLEAKLS--------------EAREKITSLETQLTERPASEDDNPVSHELEETKT 1411

Query: 1431 KLQ------NEIESS-SLASRNTNKEIEELQKVIDDLKTQLAANSTDAD-----EQTNRN 1478
            KLQ      N ++S  S++  +  K+++EL K ++ ++   A +S  +D     EQ    
Sbjct: 1412 KLQDAENTINMLKSEWSISEESFKKQLDELNKQLETIQKNSAPSSGHSDPSSYHEQPTAV 1471

Query: 1479 VEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEF-QENEKPDTEL-----NVDVEA 1532
            +E  K++ E ++   I    +E   RL    E  R  F  E EK   EL     NV VEA
Sbjct: 1472 LEDFKKQVEEERRTLIESHQQELTARL----EASRKNFLAEKEKALEELRDSLTNVSVEA 1527

Query: 1533 -------LRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQ 1585
                   L+K+WEE+ E+   +RI EAE+ LKKRIRLPSEE+IN++IE+++  LE EF  
Sbjct: 1528 ASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTT 1587

Query: 1586 KIRDKARDLL--------------MNDHSXXXXXXXXXXXXXXXXXXXXDELQAARKKAF 1631
            K+   A  LL              + DH                      +L   +KKAF
Sbjct: 1588 KVNATALALLKENPDSIASDKADLIKDH-----QKEIVQLKKDLADKFEGQLVQVKKKAF 1642

Query: 1632 EEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKPEENSTP-----SVKKIPETL 1686
            EEG+QQ  MK  LLE KI KLESQ +     +  T+   P EN+ P      VK  P  L
Sbjct: 1643 EEGRQQGIMKVKLLESKISKLESQAKAPLGTNVPTK--IPLENTQPLAQQVPVKPSPFQL 1700

Query: 1687 NSSDTSFGN 1695
              +  +FGN
Sbjct: 1701 AYAQATFGN 1709

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  463 bits (1191), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 476/1581 (30%), Positives = 842/1581 (53%), Gaps = 119/1581 (7%)

Query: 178  RKSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXX 237
            R+SE++R  QE+  L +N+  L ++   + + F   +   +  ++++   +E+  +    
Sbjct: 166  RESEIQRLKQEVTFLNENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIKLEEATTTLKS 225

Query: 238  XXXXXXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKS 297
                        ++ T++ +N++ E K+LKD L V K + +KE+++K KLI L + Q+ S
Sbjct: 226  MEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSS 285

Query: 298  LESTLQQ------KFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHD 351
             +  L+Q      KF T   + E+ +E +KS  ++L+L   K+++++ +   L S+++  
Sbjct: 286  TQEELRQNVELNSKF-TKFPDLESQNETLKSDIQDLTL---KIEELQNENFNLNSMINQM 341

Query: 352  SNDVSLQTKGRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEK 411
            SN+ +                              +L  +   I +LK+Q+ QEK +K+ 
Sbjct: 342  SNEQNNSNNSSSIDS--------------------NLPTLYSKINLLKKQVTQEKLEKKH 381

Query: 412  LQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKK 471
            LQ Q+ESF+IELE+KIP+I+SFQE+   LE ELT+  LLL   + E     N+L +   K
Sbjct: 382  LQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSK 441

Query: 472  ISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSN--DNMAS 529
            +    S ++ L+RQR DLA+Q+++                 +EI+FI  + +N  D   S
Sbjct: 442  LLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGS 501

Query: 530  TNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEI 589
               SQ VISE L+ F +I++LQ KNMEL+ ++R+L++ L                  N+ 
Sbjct: 502  ELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHKEFQ-----NKT 556

Query: 590  FAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKS-- 647
             A+AKEAILTL+  N+ LE  ++++  ERD+FKLL++     N  S +S  K  +L S  
Sbjct: 557  IADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLN-----NNVSIDSSIKNDDLSSST 611

Query: 648  ---YNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEE 704
                NE  ++ L+  + +L  +   +  AL  ++     + S L + +EK +S+ +L  E
Sbjct: 612  SPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAE 671

Query: 705  RLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRN 764
            ++ +T+++ ++L  EN++L  R   L++ +++Q+ +     + Y+   ++ S+L+T +  
Sbjct: 672  KISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSI 731

Query: 765  LETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISE 824
             ++E   L   + SL SEL  T+EEK KLRIM++QLQSLQ+ER TLL+  Q  F  +I E
Sbjct: 732  AKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHE 791

Query: 825  VNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELER 884
            +   N  L K L  ++ EI K+     +Q  WYQ  ID+             +KN  +  
Sbjct: 792  LENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISD 851

Query: 885  LHLQNKTLEKELEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFK 944
            L+ + + LE +        +T +T             + K+L+ TK+ L++AY+Q+EE+K
Sbjct: 852  LNTKIELLESQ-------SYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYK 904

Query: 945  NLSQNSEDALKELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQS 1004
             L  ++E++LK L ++F +      D                E LK         ++  S
Sbjct: 905  QLYTSTEESLKTLESNFESVKNLMDDKISKLLSEN-------ETLKASTGEYDKRISELS 957

Query: 1005 EEAESERKRLTQTIAELQGAAQPIEEVKK-------MFEEKLQKLENDLEEQTVYANNAQ 1057
             + ++E+ + ++ IA+L      + + KK        +EEK+ KL++ LE +  +A+NAQ
Sbjct: 958  TDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQ 1017

Query: 1058 KNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYR 1117
            + YE  L +     ++I E +EQ ++L      + ++L+     +S+NE   K ++D + 
Sbjct: 1018 EKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFI 1077

Query: 1118 IQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILD 1177
              ++ ++++ID++T QN+L  +Q++LLN+    +   S   ++ +  +   LR +RD+L+
Sbjct: 1078 SDLEESKKKIDNLTNQNKLYVDQLELLNK--DFSSMDSSQLSSETKHMFNRLRADRDVLE 1135

Query: 1178 TKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNL 1237
            TK+++ E +  +   KL+ +++EL N +      E++   HSDLI N++ I  +L Q+ L
Sbjct: 1136 TKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITL 1195

Query: 1238 LRESNVTLRNELKQALDEKDKIAKDLQICRNE----LLPLQSNLESANNLIKEKDLKIAS 1293
             +ESN TLRN++ + L+EK+K    LQ   NE    L  L   L+S    + +K+  I  
Sbjct: 1196 FKESNETLRNQVSE-LNEKNKT---LQTKLNEENSKLSNLSMELKSVKESLGDKETDIML 1251

Query: 1294 ANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKK 1353
              +ES +W+ R EE+  +  KV++D  +KL   L+  K   + K ++  EL +RFN LKK
Sbjct: 1252 IKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKK 1311

Query: 1354 QAHEKLNTSKELQSSLQEQISNLISEKDDI--------RKQLDVKTXXXXXXXXXXXXFR 1405
            QAHE+LN SKE+QSSL +QI+ L +   +I        +K +D++               
Sbjct: 1312 QAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQKLS 1371

Query: 1406 EKQNDLETLREELNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLA 1465
              +++L+ L+ E N     SE+ +++L +E++S              L+K + + +++L+
Sbjct: 1372 NIESELKALKTENNSFKLSSEKEKMELTDEVDS--------------LKKSLVEAQSKLS 1417

Query: 1466 ANSTDADEQT-NRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQE------ 1518
            A  +D+ + T N  +E++K+EFE +K K + +KT E   +   E +K+  E++E      
Sbjct: 1418 AIGSDSTDSTMNAMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLLKEYEEKIEDLQ 1477

Query: 1519 NEKPDTELNV-DVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRS 1577
            + + D  + + + ++L+K+WEE+ E+   +RI EA++ LKKRIRLPSE KIN++IEKR+ 
Sbjct: 1478 SARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKH 1537

Query: 1578 ELESEFDQKIRDKARDLLMNDHSXXXXXXX------XXXXXXXXXXXXXDELQAARKKAF 1631
            ELE+E++ K+++K  ++  N +S                          ++L  A+KK+F
Sbjct: 1538 ELENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSF 1597

Query: 1632 EEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKP---EENSTPSVKKI-PETLN 1687
            EEGKQQ++MKTTLLERKI KLESQ+ E  ++ +++ D  P   +   T ++  I P +  
Sbjct: 1598 EEGKQQSSMKTTLLERKISKLESQLSEAIENDKQS-DKNPIISDLAQTSTLASIQPPSAK 1656

Query: 1688 SSDTSFGNSNNVKVLKPSSPF 1708
                SFG  N    L  +  F
Sbjct: 1657 KPAFSFGGFNTTNSLNANKGF 1677

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  384 bits (986), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 394/1351 (29%), Positives = 694/1351 (51%), Gaps = 132/1351 (9%)

Query: 397  ILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATK 456
            +LK QL++EKRQK+ LQ QVE FVIELE+++P +NS ++R   LE+EL     LLE   +
Sbjct: 361  LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETER 420

Query: 457  ENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIK 516
            E++++  EL +  +++ +    + +L+ QR DLAHQ+Q+                 DEI 
Sbjct: 421  ESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEIT 480

Query: 517  FIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXX 576
            F++ ++ + N  + +DSQK+ISE L+KF DI  LQ++NMEL+ T R LA+QL        
Sbjct: 481  FLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSV 540

Query: 577  XXXXXXVDEDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSS 636
                           E+KE I  L++    L   L+ + KE+DA+KLL       + +++
Sbjct: 541  QKITRN---------ESKEKIAKLQESINGLTSKLEKLQKEKDAYKLL-------SLQNT 584

Query: 637  NSVHKYHELKSYNETVVKDLENRLTQLTNDS--NAH-----SKALTEELNLLHKEISQLN 689
                   EL+S     ++  E +LT+L   S  ++H     +K L + +  L KE   LN
Sbjct: 585  GEQTPTEELRSQ----LQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLN 640

Query: 690  VQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYV 749
              I K  S +++AE++ K+ ++S+ELL K+ + L ++     ++LL          +  +
Sbjct: 641  NAIIKETSQRAIAEKKSKMLEDSLELLHKKYD-LAVKKYEHYETLLNDHN------AENI 693

Query: 750  EAISKNSSLETSVRNLETEV-----TLL---KDREISLKSELSNTTEEKTKLRIMVTQLQ 801
            +   +N + +  +  L+ E+      LL   KD E +L S+L+  T+EK  L   ++ ++
Sbjct: 694  KHSRENETTQAKISILQKEIESYKQNLLQYSKDNENTL-SKLAAATQEKETLGSRLSTVK 752

Query: 802  SLQSERETLLERVQSDFKKRISEVNYINEKLDK----QLSERVHEIDKIEKERNAQYEWY 857
            +   ++  L++  ++ +K    E + I+E+L K    QL +++ E+   E ++N+Q  WY
Sbjct: 753  NELEQKINLMQERETYYK----EHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWY 808

Query: 858  QKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELEGAQIRIHTYE-TIXXXXXXX 916
            QK++D  +           T ND+L+ + L NK L K +   +++I   E T+       
Sbjct: 809  QKRLDSLT-----------TTNDKLQ-VEL-NKELTK-INIQRLKISDLEKTLSQNTNGS 854

Query: 917  XXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRDAXXXXX 976
                 V ++ EK K EL +   ++ ++++L          LN +   K+R  +D      
Sbjct: 855  SSLPRVDQDFEKLKNELKEKQLEINQYRDL----------LNLAEETKNRLQKDLNKQRQ 904

Query: 977  XXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEEVK---K 1033
                   G+ E L QQL  +  E +  +   + ++ +       +Q  A   E +K    
Sbjct: 905  IVDDAMEGK-EQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLS 963

Query: 1034 MFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTA 1093
              E K+  LEN++ E+T      +  Y+++L + ++ S  I ++  +N+  K     L A
Sbjct: 964  SLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKA 1023

Query: 1094 ELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNEN 1153
             + + +D +S   + L  E+  + +Q+D  ++ ID++  Q  +   +   +    S   N
Sbjct: 1024 NIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSN 1083

Query: 1154 SSDDEANGSTA----LVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAA 1209
             +D+     T+    L+L+LRRERD LD K+++ + E  SL++++++++N L+ T++S  
Sbjct: 1084 DTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFK 1143

Query: 1210 LLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNE 1269
             LESE S        ++     L +LN L+E+N  L+ +L++   E + I   L++ +NE
Sbjct: 1144 GLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNE 1203

Query: 1270 LLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNE 1329
            + PL+  +E   N I EKD ++   ++E++RWK R  E++ K Q+V+++++ KL E L+ 
Sbjct: 1204 MNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELST 1263

Query: 1330 TKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDV 1389
             K  LD K ++  +LNDRFNRLKKQAHEKL+ +K   +SL  +I++LI  K  +   LD 
Sbjct: 1264 LKTQLDTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDE 1323

Query: 1390 KTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELEVKLQNEIESSSLASRNTNKE 1449
            +               +  + +  L +EL+  +  S+++E  LQ  + SS   ++   +E
Sbjct: 1324 ERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEE 1383

Query: 1450 IEELQKVIDDLKTQLAANST-DADEQTNRNVEAIKREFENQKTKFIA----EKTEEFNKR 1504
            +  L+  ++ LK Q    S  D     +  +  +K  FE +KT+ I     E  ++  + 
Sbjct: 1384 VNSLKSQLETLKNQNGVISVADGSAINSETIAHLKESFEVEKTELITTLKEEFKKQLEEE 1443

Query: 1505 LIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPS 1564
              +  E+   E+ +++       +D+E ++ +WEE  EE+I +RIA+AE+NLKKRIRLPS
Sbjct: 1444 KKKLLEEKEKEYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPS 1503

Query: 1565 EEKINKIIEKRRSE---------------LESEFDQKIRDKA-RDLLMNDHSXXXXXXXX 1608
            EEKIN++IEKRR E                E+  ++++R +  R+L +            
Sbjct: 1504 EEKINRVIEKRRKELEEEYEKKLKRQGLTTETAIEEELRKEVERELRV------------ 1551

Query: 1609 XXXXXXXXXXXXDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQD 1668
                        +EL   +KKAF EGKQQ+ MKTTLLERK+ KLESQ         E+  
Sbjct: 1552 ---------KFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQ 1602

Query: 1669 VKPEENST-----PS-VKKIPETLNSSDTSF 1693
             +  E +T     PS +  +P +++++D S 
Sbjct: 1603 KENTEGATKTTLGPSKINLLPFSMSNTDDSI 1633

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  360 bits (924), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 422/1596 (26%), Positives = 792/1596 (49%), Gaps = 121/1596 (7%)

Query: 6    ESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEK 65
            E +I+ +L+V   +++ +   +  A+  + ++F + + +  R NVL++E K+   ++  K
Sbjct: 2    EDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISK 61

Query: 66   LKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLA-EINQLKTSNEGLQNNIDRANE 124
            L E L    E+    + E   LS ++ +L  ++ SK A +I+ L       +N I + N+
Sbjct: 62   LNELLGESSEEKNVSKKE---LS-RLHNLLKNERSKCARKIDALNKQLNASKNTITKLND 117

Query: 125  RYKELNGSYDEKVTELEHIRD--EKKELQTQIKTLNDKILELELKCQEYQSSELNRKSEL 182
               E     + +V + EH  +  E+  L  + K L  K+LE+E   Q  +S+ L+ K + 
Sbjct: 118  ---ERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKY 174

Query: 183  ERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVE----KLKSDXXXX 238
            +   QE  L+ +N++W+E++L+ +++  +      D+     V N+E    + ++D    
Sbjct: 175  DTVVQEKELILENKKWMEEQLSFRDEKTLV----DDVTRTSHVQNLEEQLNRTQNDYESV 230

Query: 239  XXXXXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSL 298
                        + +  ++  ++E K+LKD + +EK +F KE++++  +  L  +Q+ S 
Sbjct: 231  STNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSF 290

Query: 299  ESTLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQ 358
            E       +  + ++   +    ++ ++L   + +L+  +++C RL++I+          
Sbjct: 291  EKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIV---------- 340

Query: 359  TKGRKRTYXXXXXXXXXXELGSFDDSS---ISLSRMQGDIKILKRQLVQEKRQKEKLQNQ 415
                              +  +FD++     S++++  DIK LKRQL++E+ QK +LQNQ
Sbjct: 341  ------------ADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQ 388

Query: 416  VESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDD 475
            +ESF+ ELE K P + SF+ERT  LE+EL ++  LLE  +        EL SL++KI++ 
Sbjct: 389  MESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNC 448

Query: 476  NSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQK 535
             + +  L++QR DLA Q++                  DE+  +K L+ + ++ +  DSQ 
Sbjct: 449  EANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQI 508

Query: 536  VISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKE 595
            +I+E L++F +  +LQEKNMEL+  VR LA +L                 +N+   EAK+
Sbjct: 509  IITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKL---ENQTIKEAKD 565

Query: 596  AILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKD 655
            AI+ LE VN  LE  + I+++ERD++KLL S +  + +  + +  +   LK      +K+
Sbjct: 566  AIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKK-----IKE 620

Query: 656  LENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSME- 714
            LE+ L+    +++A  + L +EL    K  S   + ++++ + K LA E+  + Q  ++ 
Sbjct: 621  LESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDD 680

Query: 715  LLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKD 774
            L +K  +Q     S +  S+  ++ E     S Y    +K  SL   + NL  + T L+ 
Sbjct: 681  LKTKLEKQRSSAPSSIHGSIGSEETE----LSQYK---NKTKSLMCEISNLSKKNTDLRC 733

Query: 775  REISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDK 834
             + SL  +L    +EK +L++ +T+ ++  +E++   +  Q  +  +I  +    E+L+ 
Sbjct: 734  MKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNN 793

Query: 835  QLSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEK 894
            +L  +V EI+ ++  +N+Q +W Q  ID+              K   + +L L+ K LE 
Sbjct: 794  RLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEI 853

Query: 895  ELEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDAL 954
            EL+  +++   Y+ +            + KELE+++I+L DA+SQ+E ++ +    E+ L
Sbjct: 854  ELQKTKLQ---YKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTL 910

Query: 955  KELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRL 1014
            KELN        + +                   L+++L+ I+    +Q +  E    RL
Sbjct: 911  KELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRG---LQPKLKEGAL-RL 966

Query: 1015 TQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTI 1074
             Q   +L    Q I+       EK+ K+   +E   ++       Y+ +L+ + D+S  +
Sbjct: 967  VQQSEKLGNQTQRIQ----AMNEKIDKMTTIVE---LHQEVETSQYQAKLKANKDLSALV 1019

Query: 1075 SELREQNQRLKNDT--KSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITK 1132
              LR +N+ L   T  K   + L S Q+ + ++E+    E+ +Y  ++    ++ + +  
Sbjct: 1020 --LRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRV 1077

Query: 1133 QNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQ 1192
            +N  L  +ID     +   EN+ D E     +L  SLR ER+ L+TK+   + +    +Q
Sbjct: 1078 ENSALVEKID-----DGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQ 1132

Query: 1193 KLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQA 1252
            K  +++  + + +++  +   +    +D+I+ ++ I  ++ Q+N+L+E+N  L+  LK+ 
Sbjct: 1133 KNANLEKSVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKV 1192

Query: 1253 LDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKH 1312
             ++ + I K+    + E+  LQ +L      +     K+     E ++WK R + + ++ 
Sbjct: 1193 TEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQ 1252

Query: 1313 QKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQ 1372
            ++ + D+  KL   +++ K  L N      +LND+FNRLKKQAHEKL+ SK+ Q++L  +
Sbjct: 1253 KETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNE 1312

Query: 1373 ISNLISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELEVKL 1432
            +       D+++   D+K               E       L  +L K + ++E +  K 
Sbjct: 1313 V-------DELK---DMKNELEESLHSEESKVLE-------LEAKLKKHLVQAEGVS-KD 1354

Query: 1433 QNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTK 1492
            Q E  S  L      +EIE L++ +   K    ++S+D        +E +K   E +K K
Sbjct: 1355 QEEDTSKPLM-----EEIELLKRELQVFKE--TSDSSDT-------IEKMKEIMEAEKNK 1400

Query: 1493 FIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEA 1552
             I EKT EF ++L E T K       N     E   ++E L+KQW +  EE   +RI EA
Sbjct: 1401 IIEEKTTEFERKLEEATGK-------NTGATIENGENMEELKKQWLKQYEEETMRRIKEA 1453

Query: 1553 EDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIR 1588
            E+NLKKRIRLPSEE+I KII KR+ ELE EF +K++
Sbjct: 1454 EENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLK 1489

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  354 bits (909), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 461/1757 (26%), Positives = 850/1757 (48%), Gaps = 213/1757 (12%)

Query: 6    ESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEK 65
            E +I+ FL+V   ++  +       +  K  EF + + +  + NV ++E K+   ++  K
Sbjct: 2    EDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISK 61

Query: 66   LKEELDYVVED---NTKVRAENKTLSEKVWSLETSDNSKLAEIN-QLKTSNEGLQNNIDR 121
            L + L+   E+   N+KV      L +++    +    K+  +N QL  S+E ++     
Sbjct: 62   LTKLLNESSEEKVINSKVM---NRLQDQLKEERSRHTRKIDALNKQLNASHETIK----- 113

Query: 122  ANERYKELNGSYDEKVTELEHIRDE---KKELQTQIKTLNDKILELELKCQEYQSSELNR 178
               + ++  G+ +E  +  + +R++   K  L  + K L  K+LE+E   Q  +S+ ++ 
Sbjct: 114  ---KLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSL 170

Query: 179  KSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNV-------EKL 231
            + + +  +QE  L  +N++W E+ L++ NQ  +           D VT         EKL
Sbjct: 171  QFKYDTASQEKELWLQNKKWTEERLSSCNQKALV----------DEVTKTSYLQNLEEKL 220

Query: 232  KSDXXXXXXXXXXXXXXXDET---TEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLI 288
                              D+    +  ++  L+E K+LKD    EK EF KE++++ K+ 
Sbjct: 221  NQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMN 280

Query: 289  KLYENQIKSLE--STLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLES 346
             L  +Q+ S E   +L+ K K  +   +N   +   + EEL  A+ KL+  +E+C  L++
Sbjct: 281  DLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHI--DVAEELIDAKLKLEKSKEECQLLKN 338

Query: 347  ILDH--DSNDVSLQTKGRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQ 404
            I+    + N  ++ T                      + ++ ++ ++  +IK LKRQLV+
Sbjct: 339  IVSDCIEENGTTVNT----------------------NTAAPTVGKLFSNIKTLKRQLVK 376

Query: 405  EKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNE 464
            E+ QK ++QNQ++ FV+ELEHK P + SF+ERT +LE EL  +  LLE  +        +
Sbjct: 377  ERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKK 436

Query: 465  LQSLKKKISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSN 524
            L SL++KI+   + +  L+RQR DLA Q++                  DE+  ++ L+ +
Sbjct: 437  LTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLES 496

Query: 525  DNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVD 584
            +N  +  DSQ +I+E L++FK+I +LQEKNMEL+  +R LA +L                
Sbjct: 497  ENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKI-- 554

Query: 585  EDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHE 644
             +N+   EAKEAI+ +E +N  L   + I+T+ERD++KLL S +  +    +  +     
Sbjct: 555  -ENQTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGI----- 608

Query: 645  LKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEE 704
             ++  E  +++L+++L+    +S+A  + L  +L    K  +   + ++++ + K L  E
Sbjct: 609  TEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAE 668

Query: 705  RLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRN 764
            +  + Q  +  L  + E+ R+ ++      +Q  K +  T  S+ E  +K  SL+  + N
Sbjct: 669  KEAMLQERINHLKTQLEKQRLSAA----PPVQDYKYSNLTDLSHSE--NKIGSLKYEISN 722

Query: 765  LETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISE 824
            L+ E T L   + SL  +L    +EK +L + +++ ++  +E+  +    +  +  RI  
Sbjct: 723  LKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKV 782

Query: 825  VNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELER 884
            +    ++L+ +L  +  EI  ++  +N+Q +W Q  ID+              K   + R
Sbjct: 783  LEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGR 842

Query: 885  LHLQNKTLEKELEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFK 944
            L L+ + L  EL   +++   Y+ +            + KEL++T+IEL DA+SQ++ ++
Sbjct: 843  LSLEIENLGNELRMTKLQ---YKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYE 899

Query: 945  NLSQNSEDALKELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQS 1004
             +   +E+ LKELN        D                      K QLEN   E   + 
Sbjct: 900  EIISTNENVLKELNGELKKAKEDCET-------------------KIQLEN--KEKGAKE 938

Query: 1005 EEAESERKRLTQTIAELQ-----GAAQPIEEVKKMFEE--KLQKLENDLEEQTVYANNAQ 1057
            EE    RK L + I  LQ     GA+  + + +K+ ++  ++Q+++N +++        Q
Sbjct: 939  EELSHLRKELDE-IRCLQPKLREGASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQ 997

Query: 1058 K----NYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSER 1113
            K     Y+ EL+ + D+S+ +  L ++    + + K     L S Q+ + ++EK    E+
Sbjct: 998  KEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEK 1057

Query: 1114 DEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRER 1173
             +Y  ++    ++ + +  +N +L  +ID     E  N N    E     +L  +LR ER
Sbjct: 1058 ADYERELISNIEQTESLRVENSVLIEKID--GATEGSNSNEKYLEL---VSLFSNLRHER 1112

Query: 1174 DILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLE 1233
              L+TK+   + +   L+QK   ++  + + +R+  +  ++    + +I+ Y+ I  ++ 
Sbjct: 1113 SSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQCPAVIIDEYEKIIKEIA 1172

Query: 1234 QLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIAS 1293
            Q+N+LRE+N  L   LK   ++ + I K+L   + E+  LQ +L      +     K+ +
Sbjct: 1173 QVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLA 1232

Query: 1294 ANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETN-ELNDRFNRLK 1352
               E ++ K R +++ ++ +  + ++  KL   + + +  L N VQ  N +L ++FNRLK
Sbjct: 1233 YESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLN-VQNANADLENKFNRLK 1291

Query: 1353 KQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLE 1412
            KQAHEKL+ SK+ Q++L  +++ L   KD                               
Sbjct: 1292 KQAHEKLDASKKQQTALTNELNELKETKDK------------------------------ 1321

Query: 1413 TLREELNKEISKSEELEVKLQ------NEI--ESSSLASRNTNKEIEELQKVIDDLKTQL 1464
             L E L+ E SK  +LE+KL+       E+  +  S+A +   +EIE L+K +     Q+
Sbjct: 1322 -LEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKEL-----QV 1375

Query: 1465 AANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDT 1524
              N+ DA +      E IK   E +K K I EKT++F K+L +   K ++   E+E  ++
Sbjct: 1376 FRNANDASDA----FEKIKNNMEEEKNKIIDEKTKDFEKKLQDAVNKSKS--NESEVENS 1429

Query: 1525 ELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFD 1584
            E    +EAL+K+W ++ EE   KRI EAE+NLKKRIRLPSEE+I KII KR+ ELE EF+
Sbjct: 1430 E---HIEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFE 1486

Query: 1585 QKIRDKARDLLMNDHSXXXXXXXXXXXXXXXXXXXXDELQAARKKAFEEGKQQATMKTTL 1644
            +K+++  + L+ +  +                    DEL  +  K   E   + ++ T L
Sbjct: 1487 RKLKENNKSLVFSGSN---------------EEEAEDELWNSPSKGSSE---KPSVVTDL 1528

Query: 1645 LERKIQKLESQIQ---------EKEKDSEETQDVKPE----ENSTPSVKKIPETLNSSDT 1691
            +++K  KL+ Q++         +K   SE  ++  P+    +N  PS     + L SS+T
Sbjct: 1529 IKQKNIKLQEQLKNVKNAVTFNDKRPKSENKENNIPDSAAADNRVPSAFSFGKPLFSSNT 1588

Query: 1692 -SFGNSNNVKVLKPSSP 1707
             SF + +N     P +P
Sbjct: 1589 SSFQSFHN-----PFTP 1600

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  346 bits (888), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 424/1642 (25%), Positives = 803/1642 (48%), Gaps = 193/1642 (11%)

Query: 6    ESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEK 65
            E +I+ FLNV   +++ +   +   +  K  +F + + +  + NVL++E K+   S+  K
Sbjct: 2    EDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISK 61

Query: 66   LKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEIN-QLKTSNEGLQ--NNIDRA 122
            LK+ LD   E     + E   L +++    +    ++  +  QL  S+E ++  N+  R 
Sbjct: 62   LKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRV 121

Query: 123  NERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSEL 182
             E Y ++  S D+    L        +L  + K L  K++E+E   Q  +S+ ++ + + 
Sbjct: 122  KEEY-DIWQSRDQGNDSLND------DLNKENKLLRRKLMEMENILQRCKSNAISLQLKY 174

Query: 183  ERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKT---DLMVHDAVTNVE----KLKSDX 235
            + + QE  L+ ++++ +E++L++       + KKT   ++     V N+E    +++S+ 
Sbjct: 175  DTSVQEKELMLQSKKLIEEKLSS-------FSKKTLTEEVTKSSHVENLEEKLYQMQSNY 227

Query: 236  XXXXXXXXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQI 295
                           + ++ ++  ++E K+LKD  +VEK EF KE++++  +  L  +Q+
Sbjct: 228  ESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQL 287

Query: 296  KSLESTLQQKFKTAEANEENS------SEVVKSLKEELSLAERKLQDMEEKCVRLESILD 349
             SLE       +  E N++NS      ++V+    +EL   + +L+  + +C RL++I+ 
Sbjct: 288  TSLEKDCS--LRAIEKNDDNSCRNPEHTDVI----DELIDTKLRLEKSKNECQRLQNIV- 340

Query: 350  HDSNDVSLQTKGRKRTYXXXXXXXXXXELGSFDDSSIS--LSRMQGDIKILKRQLVQEKR 407
                                       E  +   S++S  + ++  DIK+LKRQL++E+ 
Sbjct: 341  ---------------------MDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERN 379

Query: 408  QKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQS 467
            QK +LQNQ+E F++ELEHK P + SF+ERT  LE EL  +  LLE  +     +  E+ S
Sbjct: 380  QKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITS 439

Query: 468  LKKKISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNM 527
            L++KI+   + +  L++QR DLA Q++                 +DE+  ++ ++ + N+
Sbjct: 440  LRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNI 499

Query: 528  ASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDN 587
             + NDSQ +I+E L++F ++ +LQEKN+EL+  +R LA +L                 +N
Sbjct: 500  VNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKV---EN 556

Query: 588  EIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKS 647
            +   EAK+AI+ LE +N  +E  + I+ +ERD++KLL S   E N  ++NSV     +++
Sbjct: 557  QTIKEAKDAIIELENINAKMETRINILLRERDSYKLLAS--TEENKANTNSVTS---MEA 611

Query: 648  YNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLK 707
              E  +++LE  L+    +++A  + L +EL +  K   +    +E + + K LA+E+ +
Sbjct: 612  AREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKER 671

Query: 708  ITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTF-SSYVEAISKNSSLETS----- 761
            + + +++ L  E E+                   QK++  SY+    + +S E S     
Sbjct: 672  MLEEAIDHLKAELEK-------------------QKSWVPSYIHVEKERASTELSQSRIK 712

Query: 762  VRNLETEVTLLKDREIS-------LKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERV 814
            +++LE E++ LK    S       L  +     +EK +L++ + + +   +E +      
Sbjct: 713  IKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSK 772

Query: 815  QSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXX 874
            +  +K +I E+    E+L   L  ++ EI+ I   +++Q +W Q  ID+           
Sbjct: 773  EGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTE 832

Query: 875  XXTKNDELERLHLQNKTLEKELEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELA 934
               K   +E+L  + + L+KEL   + +   Y+ +            + KELE+ +++L 
Sbjct: 833  LSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDASTLEPTLRKELEQIQVQLK 889

Query: 935  DAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLE 994
            DA SQ++ ++ +  ++E+AL EL     AK ++  DA                  ++ L 
Sbjct: 890  DANSQIQAYEEIISSNENALIELKNEL-AKTKENYDAKIELEKKEKWAR------EEDLS 942

Query: 995  NIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKMFEE--KLQKLENDLEEQTVY 1052
             ++ EL         E + L   + E  GA   +++ +K+  E  ++QK+   +E+ +  
Sbjct: 943  RLRGEL--------GEIRALQPKLKE--GALHFVQQSEKLRNEVERIQKMIEKIEKMSTI 992

Query: 1053 ANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQ-------SLQDQMSQN 1105
                +K   +E+ ++    K   +L E   RL+ D     AEL        S QD + ++
Sbjct: 993  VQLCKK---KEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKH 1049

Query: 1106 EKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTAL 1165
            E+    E+ +Y  ++    ++ + +  +N +L  ++D          N+ D +     +L
Sbjct: 1050 ERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD------DTAANNGDKDHLKLVSL 1103

Query: 1166 VLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNY 1225
              +LR ER+ L+TK+   + E   ++QK D ++  + + +R+  L E EY   + +I+ +
Sbjct: 1104 FSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEF 1163

Query: 1226 QTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIK 1285
            + I  ++ Q+N+L+E+N  L+  LK   ++  +I K L   + E+  LQ +L      + 
Sbjct: 1164 KDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVS 1223

Query: 1286 EKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELN 1345
                KI     E ++ K R +++ ++ +     D  KL   +++ K  L +      +L 
Sbjct: 1224 INSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLE 1283

Query: 1346 DRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTXXXXXXXXXXXXFR 1405
            ++FNRLKKQAHEKL+ SK+ Q++L  +++ L + KD                        
Sbjct: 1284 NKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKD------------------------ 1319

Query: 1406 EKQNDLETLREELNKEISKSEELEVKLQ-NEIESSSLAS-------RNTNKEIEELQKVI 1457
                    L ++L+ E +K  +L+ KL+ +E++S  ++        R   +EIE L+K +
Sbjct: 1320 -------KLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKEL 1372

Query: 1458 DDLKTQLAANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQ 1517
               KT  A +S+DA        E +K   E +K + I E+T+EF K+L E   K      
Sbjct: 1373 QIFKT--ANSSSDA-------FEKLKVNMEKEKDRIIDERTKEFEKKLQETLNK------ 1417

Query: 1518 ENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRS 1577
             +   + E + D+E L+K+W ++ E+   +RI EAE+NLKKRIRLPSEE+I KII KR+ 
Sbjct: 1418 -STSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKE 1476

Query: 1578 ELESEFDQKIRDKARDLLMNDH 1599
            ELE EF +K+++ A  L   D+
Sbjct: 1477 ELEEEFRKKLKENAGSLTFLDN 1498

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  318 bits (815), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 410/1617 (25%), Positives = 780/1617 (48%), Gaps = 150/1617 (9%)

Query: 6    ESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEK 65
            E +I+ FL+V   +++ +   +   +  K + F   + +  R NVL++E K+   S+  K
Sbjct: 2    EDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISK 61

Query: 66   LKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANER 125
            L + L+   E       E   L +++          + +  + +   + L   +D + + 
Sbjct: 62   LSKLLNESSEQKNIASKELSHLQDQL----------MQDRERCRRKIDALNKQLDSSRDA 111

Query: 126  YKELNGSYDEKVTELEHIRDEKKE--------LQTQIKTLNDKILELELKCQEYQSSELN 177
             K LN   D K  E   IR  K +        L  + K L  K++E+E   Q  +S+ ++
Sbjct: 112  IKRLNDEKDAK--EESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVS 169

Query: 178  RKSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXX 237
             + + +   QE  L+ +N++W E++L++ N   +         + +    + + ++D   
Sbjct: 170  LQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRES 229

Query: 238  XXXXXXXXXXXXDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKS 297
                         + +  ++  ++E K+LKD   +EK EF KE++++  +  L  +Q+ S
Sbjct: 230  ALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLAS 289

Query: 298  LESTLQQKFKTAEANEENSSEVVK------------SLKEELSLAERKLQDMEEKCVRLE 345
             E             + +S E+ K            ++ +EL   + + Q  +++C RL+
Sbjct: 290  FE------------RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQ 337

Query: 346  SIL-DHDSND-VSLQTKGRKRTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLV 403
            +I+ D    D  ++ T G                      +S ++ ++  DIK+L++QL+
Sbjct: 338  NIISDFVQEDKATVDTNG----------------------ASHTVGKLFSDIKVLRKQLI 375

Query: 404  QEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTN 463
            +E+ QK +LQNQ+E F++ELEHK P + SF+ERT  LE EL  +  LLE  +        
Sbjct: 376  KERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDER 435

Query: 464  ELQSLKKKISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVS 523
            EL SL++KI+   + + +L++QR DLA Q++                 +D++  ++ ++ 
Sbjct: 436  ELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILE 495

Query: 524  NDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXV 583
            + +  + ND+Q +ISE L++F +I +LQEKN+EL+  +RTLA +L               
Sbjct: 496  SGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTL---A 552

Query: 584  DEDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVS-EDRERNFKSSNSVHKY 642
            + + +   EAK+AI+ LE  N  +E  + I+ +ERD++KLL S ++   N  + N     
Sbjct: 553  EVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENNVNVNAKNFTEIS 612

Query: 643  HELKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLA 702
            HE K      +K+LE  L+    +S+A  + L +EL    K +    +  + + + K LA
Sbjct: 613  HEKK------IKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFENFKMLA 666

Query: 703  EERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSV 762
            +E+  I +  +  L  + E+ ++       S +Q +K    T    +++ +K   L   +
Sbjct: 667  KEKESILETRVNNLKTDLEKQKLSVP----SFVQDNKVRDST--ELLQSRTKTEILMHEI 720

Query: 763  RNLETEVT---LLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFK 819
             +L+ E     +LK+   SL  +L    +EK +L++ + + +   +E++   +     + 
Sbjct: 721  SSLKKETANSMVLKE---SLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYD 777

Query: 820  KRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKN 879
             RI ++    E+L  +L  +  EI  ++  +++Q +W Q  ID+              K 
Sbjct: 778  ARIKQLEESLERLRIELKSKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKE 837

Query: 880  DELERLHLQNKTLEKELEGAQIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQ 939
              +  L  + + L+ EL   +++   YE +            + KELE+T++EL DA+SQ
Sbjct: 838  KTVVTLSSKIENLDNELRENKLK---YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQ 894

Query: 940  LEEFKNLSQNSEDALKELNASFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNE 999
            +  ++ +   +E ALKELN+   +   DY                   +L+++L+ I+  
Sbjct: 895  VRTYEEIISTNEKALKELNSQLASMKEDYDARIELECKEKLANEEELSLLRRELDEIR-- 952

Query: 1000 LTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKN 1059
             ++Q +  E     + Q+  +L+  A+ I+E+K     K+ K+  +++   VY       
Sbjct: 953  -SLQPKLKEGTVCLVKQS-EKLRNQAEKIQEMKA----KIDKMNWNVQ---VYKKEKTSQ 1003

Query: 1060 YEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQ 1119
            ++  ++ + ++S+ ++ L ++    + + K L + L   QD +  +EK    E+ +Y  +
Sbjct: 1004 FQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERE 1063

Query: 1120 IDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLS-LRRERDILDT 1178
            +      I +I +   L      L+ +  SV E S  +E         S LR ER+ L+T
Sbjct: 1064 L------ISNIEQTESLRVENSVLIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLET 1117

Query: 1179 KINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLL 1238
            K+   + +   ++QK   ++  + + +      ++E    + +I+ +  I  ++ Q+NLL
Sbjct: 1118 KLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLL 1177

Query: 1239 RESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDES 1298
            +E+N  L+  LK   ++  +I ++L I + E+  L+S+L      +     KI     E 
Sbjct: 1178 KENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEM 1237

Query: 1299 QRWKTRLEEMIEKHQKVNVDDYTKLEETLNETK-QLLDNKVQETNELNDRFNRLKKQAHE 1357
             + K R  ++  + ++V      KL   +++ K +LLD +  +T EL ++FNRLKKQAHE
Sbjct: 1238 DQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKT-ELENKFNRLKKQAHE 1296

Query: 1358 KLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREE 1417
            KL+ SK+ Q++L  ++  L + +D + + L+ K                K  DL+T   E
Sbjct: 1297 KLDASKKQQTALTNELKELKAVRDKLEQDLNSKNF--------------KTVDLDT---E 1339

Query: 1418 LNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNR 1477
              +   +S +L ++ Q ++ S  L      +EIE L++ +   K   A NS+DA      
Sbjct: 1340 PKEHTVQSGDL-LRDQEKVASLPLI-----EEIESLKRELQVFKN--ANNSSDA------ 1385

Query: 1478 NVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQW 1537
              E ++   E +K K I E+T+EF K+L E   K ++  +  +  +     ++E L+K+W
Sbjct: 1386 -FEKLRDNMEEEKNKIINERTKEFEKKLEEIVSKSKSTGKVADNSE-----NIETLKKEW 1439

Query: 1538 EEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDL 1594
             ++ EE   +RI EAE+NLKKRIRLPSEE+I KII KR+ ELE EF +K+++ A  L
Sbjct: 1440 LKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSL 1496

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  275 bits (702), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 358/1376 (26%), Positives = 647/1376 (47%), Gaps = 143/1376 (10%)

Query: 378  LGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERT 437
            L   D++S S+S +  +I IL  +L +E   K+KL+ QV  FV ELE   P+I SF++++
Sbjct: 275  LTGNDETSHSMSELNNNISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKS 334

Query: 438  SVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYXX 497
               + ++    L LEH TK+ E    E++  KK++   + Q +IL R+R DLA QLQY  
Sbjct: 335  EQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLL 394

Query: 498  XXXXXXXXXXXXXXEDEIKFIKNLVSND---NMASTNDSQKVISEHLIKFKDIQQLQEKN 554
                            E  +IK +++ D      S+ DSQ +IS+ ++KFK I +LQ++N
Sbjct: 395  LNGFVKDSDDPLTS-SEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQN 453

Query: 555  MELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAILTLEKVNENLEKNLQIV 614
            + L+  VRTL+ +                 +  E   EAK+ +L L++ N +LE  ++ +
Sbjct: 454  INLLSAVRTLSDRAETLERKLES------GDSIEAINEAKQTLLDLQQYNSSLEAKVESL 507

Query: 615  TKERDAFKLLVS-EDRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTNDSNAHSKA 673
            T +  A +   S  D E  F +S+       L   N   ++ L+N+   L  +S+     
Sbjct: 508  TNKLKANEHFTSIGDGE--FGNSD-------LSDGNN--IQALKNKYDSLMAESSETIGH 556

Query: 674  LTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLEDS 733
            L  ++N L +  S L  + E   ++K L E+RLKITQ+ ++L   EN  LR R      +
Sbjct: 557  LYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQA 616

Query: 734  LLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKTKL 793
            L +++ ET +T   Y++ ++K   ++  + N   E  +L++ + S++++L+   +E+   
Sbjct: 617  LKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNF 676

Query: 794  RIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQ 853
            + ++ QL++LQ  ++  L+ +Q   + +I ++   N +L  ++  +            A+
Sbjct: 677  QGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAE 736

Query: 854  YEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELEGAQIR---IHTYETIX 910
             EWYQ K D  S                +E L ++ +TL+  L+ A  +   +   ET+ 
Sbjct: 737  LEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETV- 795

Query: 911  XXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRD 970
                      DV K     + ELA + ++L           D  +EL  S N   R Y+ 
Sbjct: 796  ---------DDVNKLTGALETELATSRTRL----------TDTSRELEISSNTI-RQYQS 835

Query: 971  AXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEE 1030
                            + L+ ++  +++ELT    E E E++ L + ++ L+     + +
Sbjct: 836  EIKVLNERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTK 895

Query: 1031 VKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQ----RHADVSKTISELREQNQRLKN 1086
            +++ +  +++KL+ DL++Q +     +  +++E++    R+ +  +   EL E  Q    
Sbjct: 896  LEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQNRNTETYRNELELVEIRQ---- 951

Query: 1087 DTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNR 1146
             TK              + EK L+S       QI+L ++R+   + +  LL  Q+ LL  
Sbjct: 952  -TKVFV-----------EKEKELESRIKILNEQIELDKERMKQFSDEESLLREQVKLL-- 997

Query: 1147 AESVNENSSDDEANG----STALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELE 1202
                +E +SD    G     T LV  L  E+  L++K+   ++EKN L+++L   ++E+ 
Sbjct: 998  ---ADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEI- 1053

Query: 1203 NTKRSAALLESEY----SEHSDLINNYQTIRGD--LEQLNLLRESNVTLRNELKQALDEK 1256
                  A+L   Y     E +  +NN ++ R +  + QL  L+ESN++L NE+K A    
Sbjct: 1054 ------AVLNMNYEQAKKEVAAEVNN-ESGRAEEHIAQLESLKESNMSLTNEVKLAQMRN 1106

Query: 1257 DKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVN 1316
             +I  +L   + +   ++S L+ A N++  KD+K+     E  R K    +M    Q  N
Sbjct: 1107 GEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDM---PQNGN 1163

Query: 1317 VDDYTKLEETLNETKQLL----DNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQ 1372
             D  ++L   L  +   L    DN      EL DRF RLK+QA E+L+ SK   +SL++ 
Sbjct: 1164 KDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDN 1223

Query: 1373 ISNLISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNKEISKSEELEVKL 1432
            +  L  +K  ++  ++                 E    ++ L+ EL   +SK++++E +L
Sbjct: 1224 VETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAEL 1283

Query: 1433 QNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTK 1492
                +SS+  +   N+EIE L+  +  LK   +A     +E+ +  VE++++ FE++K  
Sbjct: 1284 NETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEP-QGNEEMSGVVESMRKAFEDEKIA 1342

Query: 1493 FIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNV--------------------DVEA 1532
            F+   +E+   RL EE  K++ E +  EK    L +                    D+E 
Sbjct: 1343 FMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKARSDVPDIET 1402

Query: 1533 LRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKAR 1592
            L+KQWE  +               K+R+ L  +EK ++++  +  ELE +F  ++R+K +
Sbjct: 1403 LQKQWEASN---------------KERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEK 1447

Query: 1593 DLLMNDHSXXXXXXXXXXXXXXXXXXXXDELQAARKKAFEEGKQQATMKTTLLERKIQKL 1652
            +L                          D L A +K+AFEEGKQQATMK ++LERKI KL
Sbjct: 1448 EL----------NALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKL 1497

Query: 1653 ESQIQEKEKDSEETQDVKPEENSTPSVKKIPETLNSSDTSFGNSNNVKVLKPSSPF 1708
            E++ +  +  S+ +         TP+  K+ +       + G+  +V+    S+PF
Sbjct: 1498 EAESKATKSGSDMSVSEDAPRFVTPNNNKVQQANQPFLATAGSGFSVQS-SESNPF 1552

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  252 bits (644), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 385/1490 (25%), Positives = 681/1490 (45%), Gaps = 224/1490 (15%)

Query: 263  NKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQKFKTAEANEENSSEVVKS 322
            NK L D L+ ++ +F++EL+ +DKL  + + Q+ SL S L    +T    E N     +S
Sbjct: 197  NKTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQS 256

Query: 323  LKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKRTYXXXXXXXXXXELGSFD 382
                 S  E ++ + +E+   L  IL   +  ++                          
Sbjct: 257  -----SQHEEEISNYKEQVEELLGILGQGAPSIAH------------------------- 286

Query: 383  DSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEK 442
                           L++ L++E+++   L+ Q+ESFVIELEH++P +   +++   +++
Sbjct: 287  ---------------LRKLLLKERKENVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQ 331

Query: 443  ELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYXXXXXXX 502
            +L      +   +K       EL S ++K+   N     L  QR+DLAHQ+Q+       
Sbjct: 332  KLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQRSDLAHQIQFLLTVNSS 391

Query: 503  XXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVR 562
                       E+ FIK ++ N+N  +  DSQ+++S+ L++F +I +LQE+NM+LV TVR
Sbjct: 392  DTVLP----PSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVR 447

Query: 563  TLAQQLXXXXXXXXXXXXXXVDEDNEIFAEA-KEAILTLEKVNENLEKNLQIVTKERDAF 621
            +L  ++               D D+ +  EA K  I  LE+ N  LE  ++      +  
Sbjct: 448  SLVDKVESWE----------ADNDSGLTLEAAKLQISKLEQSNAQLESEVKNWEALMETL 497

Query: 622  KLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNLL 681
            K   S D + N        K  EL+S              +LT+   +H     +++N+L
Sbjct: 498  KDGDSLDSKINVTMVEQQKKIEELES--------------KLTDVGESH----VQKINVL 539

Query: 682  HKEISQ-------LNVQIEKY----RSAKS----LAEERLKITQNSMELLSKENE--QLR 724
            +K I +       LN QI+       +AKS       E L +TQ   ++ +K+NE  +L 
Sbjct: 540  NKTIDRNQSTINMLNEQIKNTVKSDMNAKSELIACKRENLSLTQ---QISTKQNELDELN 596

Query: 725  IRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELS 784
             +S+       Q++++ Q   +    A +K  S E S   L  E T ++ ++ SL  ++ 
Sbjct: 597  SKSA-------QKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQ 649

Query: 785  NTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEID 844
              +++  +L     +L+   S +E   +R +     +I+ ++  N+ L   L+ +  E+ 
Sbjct: 650  QESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVK 709

Query: 845  KIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELEGAQIRIH 904
            +  ++   Q +WYQ+ IDE S             ND+L  L       EK L      + 
Sbjct: 710  QFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLS------EKSLSNKPYPVG 763

Query: 905  TYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAK 964
            T               ++  EL   K  L  + SQ   +K       D L E N +F   
Sbjct: 764  T------------ELKELQNELNGMKAALEVSESQATLYK-------DTL-ERNQNF--- 800

Query: 965  DRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELT--------VQSEEAE------SE 1010
               Y ++             + E L +Q E ++N++T        +Q E         SE
Sbjct: 801  ---YNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSE 857

Query: 1011 RKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQT---VYANNAQKNYEQELQRH 1067
            +  L + +  L  + + I E+K  ++ ++QK+E++L+ Q+   +   +A  + E+EL  +
Sbjct: 858  KTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSY 917

Query: 1068 ADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRI 1127
            A     I +L  +  +L +D  +LT        + ++  K L  ERD    ++ LA QRI
Sbjct: 918  A---VQIEQLNTEIAKLNSDIAALT--------EPAEARKTLIKERDSLGQELKLANQRI 966

Query: 1128 DDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEK 1187
            + +  QN +LY+    +   ++  E + D        LV++LR ERD+  ++    + + 
Sbjct: 967  ESLAAQNSILYDTFSGMRHVDADAEPNED-----LRNLVINLRIERDMHQSQETTAQRDV 1021

Query: 1188 NSLQQKLDDIQNELENTKRSAALLESEYSEHSD--LINNYQTIRGDLEQLNLLRESNVTL 1245
              L++ L +I  +L  T     + E   +E  D  L   ++ I  +LE L   +E N+ L
Sbjct: 1022 KLLKKNLKEITEKLAIT--CPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYL 1079

Query: 1246 RNELKQALDEKDKIAKDLQICRNELLPLQSNLESA---NNLIKEKDL--KIASANDESQR 1300
               +K +L+E      D +  + E+  L+ + E A   ++ I E++   KI +   ES++
Sbjct: 1080 DESIK-SLNE------DKRTLQEEVSRLRESEELAKKNSSAISEQEWQQKIETYQQESEK 1132

Query: 1301 WKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLN 1360
            WK   ++M E        +   L++ L   K  +  K QE ++LNDRF RLKKQAHEKLN
Sbjct: 1133 WKLMCQQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLN 1188

Query: 1361 TSKELQSSLQEQISNLISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREELNK 1420
             SK    SL  ++S L +  D ++++L+ +                       L  +L +
Sbjct: 1189 ASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNA-----------ALILQLKE 1237

Query: 1421 EISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVE 1480
            E  +++ LE++L++ ++SS        K I ++ K +  LK      S + ++ T+R +E
Sbjct: 1238 ENKQAKSLELELRHSVDSSE-------KLIADMTKELTTLKENPIQGSVNVEDYTHR-LE 1289

Query: 1481 AIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEED 1540
             +K EFE++K   I + T E  +R   E +++ N            N ++E LRK  EE+
Sbjct: 1290 QLKSEFEDEKRVLIEKTTSELTERFEREKKELMNN-----------NANLEELRKPLEEE 1338

Query: 1541 SEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHS 1600
             E    +RI EA++NLKK IRLP+EEKI ++I KR+++LE +F  K+ ++A  L +++ S
Sbjct: 1339 WERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSELS 1398

Query: 1601 XXXXXXXXXXXXXXXXXXXXDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKE 1660
                                ++ +  +KKAFEEG+QQA+MKTTLLERKI KLE+++Q   
Sbjct: 1399 NKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGGT 1458

Query: 1661 KDSEETQDVKPEENSTPSVKKIPET----LNSSDTSFGNSNNVKVLKPSS 1706
               +    +      +P +   P T    L+    +F  +    + +P+S
Sbjct: 1459 GPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFAGATTTTISQPTS 1508

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  200 bits (509), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 190/586 (32%), Positives = 303/586 (51%), Gaps = 93/586 (15%)

Query: 1120 IDLAQQRIDDITKQNQLLYNQIDL-LNRAESVNENSSDDEANGSTALVLSLRRERDILDT 1178
            +DLA +RIDD+  QN LL+ Q++  L+  ++ N++   D       +++ ++RERD L  
Sbjct: 983  LDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIKD-------IIVCMKRERDTLQK 1035

Query: 1179 KINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLL 1238
            K+ ++E E   L+++   +++EL+   +         S   +L+  ++ I  +L++++LL
Sbjct: 1036 KLAIVEREGEVLRERCAGLKSELDAVSKGQQWHNLPLS---NLLTGHEKILDELKEVHLL 1092

Query: 1239 RESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDES 1298
            RE+NV+L  E+ Q   +   +  +L   R    PLQ    +     KEKD +I+   DE 
Sbjct: 1093 RENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEI 1152

Query: 1299 QRWKTRLEEMIEKHQKVNVDDYTKLEET----LNETKQLLDNKVQETNELNDRFNRLKKQ 1354
            +RWK R ++M+ +      DD   LE      ++  K L++ + +E  +L+++F  LKKQ
Sbjct: 1153 ERWKKRWQQMVHRQ-----DDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQ 1207

Query: 1355 AHEKLNTSK----ELQSSLQE------QISNLISEKDDIRKQLDVKTXXXXXXXXXXXXF 1404
            AHEKL+ +K     L + L E      Q+  ++ EKD   +++++               
Sbjct: 1208 AHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIEL--------------- 1252

Query: 1405 REKQNDLETLREELNKEISKSEEL---------EVKLQNEIESSSLASRNTNKEIEELQK 1455
                    TL+E L K   K E+L         E KL   I      +   N+E+  L++
Sbjct: 1253 --------TLKENLEK-FDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLRE 1303

Query: 1456 VIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNE 1515
             I+ L+ +        D++TN+ +  +K +FE +K + I EK  E N++     E  RNE
Sbjct: 1304 EINVLRKK--------DDETNQLISTMKLDFEREKDRLIEEKVRELNEKF----ESGRNE 1351

Query: 1516 F----QENEKPD-TELNVDV--EALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKI 1568
                  EN   D T  NVD   + LRK WEE +     +RI EA++NLK+ IRLPSEEKI
Sbjct: 1352 VLSKQSENVTNDNTGSNVDKLKQELRKDWEEQT----LQRIEEAKENLKRHIRLPSEEKI 1407

Query: 1569 NKIIEKRRSELESEFDQKIRDKARDLLMNDHSXXXXXXXXXXXXXXXXXXXXDELQA--- 1625
             +IIEKRR+ELES+FD+++ +KA  + + D +                     +LQA   
Sbjct: 1408 QRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAKLE 1467

Query: 1626 -ARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVK 1670
              R KAFEEGK+QA MKTTLLERK+ KLESQ+    KD+E    V+
Sbjct: 1468 TIRTKAFEEGKRQAEMKTTLLERKLSKLESQVA---KDNESGSKVR 1510

 Score =  189 bits (481), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 197/719 (27%), Positives = 358/719 (49%), Gaps = 70/719 (9%)

Query: 152 TQIKTLNDKILELELKCQEYQSSELNRKSELERNAQEILLLRKNQEWLEQELTNKNQHFM 211
           T I  +ND+IL L+ + +  +S  L  +SE ER+ ++  L+R++ +WLE+ L    +  M
Sbjct: 94  TSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELM 153

Query: 212 FYRKKTDLMVHDAVTNVEKLKSDXXXXXXXXXXXXXXXDETTEQLQNNLIENKDLKDVLA 271
             +K++ L + +    ++ L+ +                E +E +Q  LIE K   D  +
Sbjct: 154 -TQKQSILKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYS 212

Query: 272 VEKQEFDKELSIKDKLIKLYENQIKSL--ESTLQQKFKTAEANEENSSEV-VKSLKEELS 328
            ++QEF  E+ +KD++    E Q+K +  E ++Q        NE+N+S    + + E+L 
Sbjct: 213 TKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQ--------NEDNTSRAESQKIMEQLI 264

Query: 329 LAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKRTYXXXXXXXXXXELGSFDDSSISL 388
              ++L+D   +C RL+S ++   NDV+                      G +  SS  L
Sbjct: 265 DTRKQLKDSRNECTRLKSYVNEFINDVN----------------------GEYSSSSSLL 302

Query: 389 SRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTA 448
            +            ++ K QK+ L+ QVE+F+ ELE K+PVI+S +++   LEKEL+D  
Sbjct: 303 KKEL----------LKVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVT 352

Query: 449 LLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXX 508
            L++  + E E    E QS K+K   ++  ++ L  QR+DLAHQ+Q+             
Sbjct: 353 SLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNA 412

Query: 509 XXXEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQL 568
              +DE  FI+ L  ND  A  NDSQ +ISE L+KF DI +LQ++NM+++ TVR LA QL
Sbjct: 413 LLSKDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQL 472

Query: 569 XXXXXXXXXXXXXXVDEDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSED 628
                            + +   EAK+A+L L++   +LE+ L+   KERD +KLL    
Sbjct: 473 EEQEKLRQADHHTI---ERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGK 529

Query: 629 RERNFKSS--NSVHKY------HELKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNL 680
              + K S  N + K+      +EL+   E + K++E +LT+   D             +
Sbjct: 530 SPSSNKPSECNDIDKHTTGKLQNELQQTREYLTKEIE-KLTRTNKD-------------I 575

Query: 681 LHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKE 740
           L+K+  +L   ++K  SAK  AE + ++ +N++ +L +  + +  ++  L+  L Q++ +
Sbjct: 576 LNKK-KELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAK 634

Query: 741 TQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQL 800
             +      E  S+ + L+    + +++   L+ +  + + EL    EEK  L++ + +L
Sbjct: 635 LAELTQDLHELTSQYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHEL 694

Query: 801 QSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQK 859
           +  ++E + +   V+    +R++E     + L K + ++  +I  +E +R  +  WYQK
Sbjct: 695 EISRNECKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQK 753

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  186 bits (473), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 263/1070 (24%), Positives = 518/1070 (48%), Gaps = 91/1070 (8%)

Query: 191  LLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDXXXXXXXXXXXXXXXD 250
            L  K ++  E E  +K +HF  Y+ + +L   + + N+  + ++               +
Sbjct: 139  LTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNE 198

Query: 251  ETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQ----QKF 306
            E ++ L+  + E K L++ L     +F  E  ++D+LI   +NQIK+L+  L+    +KF
Sbjct: 199  ELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKF 258

Query: 307  KTAEANEENSSEV---VKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRK 363
                  + +  E+   +K+L E+L ++ER+   +       ++I + +S+ VS    GR 
Sbjct: 259  DDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSSVSSHASGR- 317

Query: 364  RTYXXXXXXXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIEL 423
                              ++S++SLS   GD+ IL++  ++E++QK +L+ Q+   + EL
Sbjct: 318  ------------------NNSALSLS---GDVNILRKHFLKERQQKRQLEEQMRQILQEL 356

Query: 424  EHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILL 483
            E  +P ++S++ER++ LEKEL  + +LLEH  KEN  K+ EL+  + + S+  S +  L 
Sbjct: 357  ERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLA 416

Query: 484  RQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVISEHLIK 543
             QRT LA Q++Y                  +++ +   ++ +   + +DS+K++ E L +
Sbjct: 417  FQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQ 476

Query: 544  FKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAILTLEKV 603
            FK++++LQ +NM+L++  R LA +                 E++E   +AKEAIL L++ 
Sbjct: 477  FKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQIS---SEEDETINDAKEAILVLQEY 533

Query: 604  NENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQL 663
            ++ LE  ++ ++ E      L  + +E+  K S S     E  + + T+  DL  +L+  
Sbjct: 534  SQKLESQIKELSDE------LAVQKKEKTEKESISAMSKIEDDASSHTI--DLGKQLSAN 585

Query: 664  TNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQL 723
               S     AL  E+  LH+  + +N+ ++K +SA+ LAE+R  + + ++ LL  E E+L
Sbjct: 586  LKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEEL 645

Query: 724  RIRSSRLEDSLLQQDKETQKTFSS--YVEAISKNSSLETSVRNLETEVTLLKDREISLKS 781
            +   ++L+ ++L  DKE Q ++SS  Y+   SK S+ E  + +L  E  L  + + +L++
Sbjct: 646  QEEVNKLQQNIL--DKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRT 703

Query: 782  ELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDF--KKRISEVNYINEKLDKQLSER 839
            +      E+  LR+ VTQ+ SL +E +TLL+  +S +  K +IS +     + + QL   
Sbjct: 704  KKEALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCT--QTNNQLQLV 761

Query: 840  VHEIDKIEKERNAQYEWYQKKIDEASXXXXXXXXXXXTKNDELERLHLQNKTLEKELEGA 899
               + +++ + +++ +WY+  ID+              K +++E     +KTLE      
Sbjct: 762  QQRMSELKSQNDSEIKWYKATIDDLKANVFELNEELKQKEEKIEEF---SKTLE------ 812

Query: 900  QIRIHTYETIXXXXXXXXXXXDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNA 959
               +    T+            + KEL + K +L  +  +++E++N+   S+        
Sbjct: 813  --NVQNELTLANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSK-------R 863

Query: 960  SFNAKDRDYRDAXXXXXXXXXXXXGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIA 1019
            SF  K   Y D                  L++ L  ++  + VQ +E  S       T++
Sbjct: 864  SFENKSIQYEDRIKALASKLDSELRERTTLQENLSTLQARMVVQQDELTSN----NNTLS 919

Query: 1020 ELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELRE 1079
            EL+ +   +   +K F++K  +L + +  +T   ++  K+YE+ +Q ++++SK +  LRE
Sbjct: 920  ELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLRE 979

Query: 1080 Q-NQRLKN--------DTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDI 1130
            +   R  N        DT+S+  + Q + D+          E+  + +QI    +R+ ++
Sbjct: 980  EVKNRTSNGEKEGDLEDTESIIKKGQDVWDE----------EKKVFEVQITNLNERLSEL 1029

Query: 1131 TKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSL 1190
             ++N+ L  +++  ++    N  S++  A G+   + +LR ER  L  K+   + E+ S+
Sbjct: 1030 LEENESLLARLESQDKGN--NSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSV 1087

Query: 1191 QQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRE 1240
            + KL + ++ L         ++S+  E S L  N   I   L  L   RE
Sbjct: 1088 RHKLRETEHALSENAFELKKIKSQIFELSSLPQNEHDILRHLVHLKEQRE 1137

 Score =  108 bits (270), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 117/215 (54%), Gaps = 31/215 (14%)

Query: 1446 TNKEIEELQKVIDDLKTQL--AANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEEFNK 1503
             NK   E Q+ I DL+ QL  A N      + +  V+ +K  FE +K+  ++++ +E  K
Sbjct: 1153 PNKVTTEAQEKIQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFEKEKSSLLSQQEQEIEK 1212

Query: 1504 RLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLP 1563
                          +NE+           LR+ +EE+    IQK++++AE+NLKKRIRLP
Sbjct: 1213 ------------LTDNERK----------LREFYEEE----IQKKVSQAEENLKKRIRLP 1246

Query: 1564 SEEKINKIIEKRRSELESEFDQKIRDKARDLLMN---DHSXXXXXXXXXXXXXXXXXXXX 1620
            +EEKIN IIEKR+SELES F+QKI+++A+ LL++   D                      
Sbjct: 1247 TEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDDKIKKIYKEIEESGRETLQQEFD 1306

Query: 1621 DELQAARKKAFEEGKQQATMKTTLLERKIQKLESQ 1655
            ++L   RKKAFEEGKQ   MK+  LERKI  LE Q
Sbjct: 1307 EQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  174 bits (440), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 134/375 (35%), Positives = 203/375 (54%), Gaps = 45/375 (12%)

Query: 256 LQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKS----LESTLQQKFKTAEA 311
           LQ  L   KDL D L   KQEF KE+++K ++ +L  N+I S    +E    +  +T E 
Sbjct: 259 LQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPE- 317

Query: 312 NEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKRTYXXXXX 371
                    K + +EL   + KL + E++C  L+S +D                Y     
Sbjct: 318 ---------KKIIQELVDLKEKLVNSEKECNELKSTVDK---------------YINIDE 353

Query: 372 XXXXXELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVIN 431
                + G+           +  I+IL+RQLV+EKR K+ LQ QVESF++ELE K+P+I+
Sbjct: 354 KKLISKFGN----------PKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMID 403

Query: 432 SFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAH 491
           SF+ER S LE+EL      LE   KE ++K  EL +L+KKIS++    + LLRQR+DLAH
Sbjct: 404 SFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAH 463

Query: 492 QLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQ 551
           Q+QY                E E   +K +VSN+N  +  DS K+IS+ L+ F+++++LQ
Sbjct: 464 QVQY----LLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQ 519

Query: 552 EKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAILTLEKVNENLEKNL 611
           +KNMEL++T R L Q L              + ++N+I   AK   + LEK  + LE  +
Sbjct: 520 QKNMELLRTTRQLVQTL--ERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKI 577

Query: 612 QIVTKERDAFKLLVS 626
            I+++ERD++KLLV+
Sbjct: 578 NIISQERDSYKLLVT 592

 Score =  152 bits (384), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 157/465 (33%), Positives = 243/465 (52%), Gaps = 44/465 (9%)

Query: 1238 LRESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDE 1297
            L ESN  L  E++      + ++  L   + +L PL+  +      + EK+  +    +E
Sbjct: 1072 LEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEE 1131

Query: 1298 SQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHE 1357
             +RWK R + ++++ + V  + + K  E +   ++ L+    E  +L DRF+RLKKQAHE
Sbjct: 1132 LERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHE 1191

Query: 1358 KLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTXXXXXXXXXXXXFREKQNDLETLREE 1417
            KL+ +K +Q +L  QI+ L   K ++ K L                    Q ++E   + 
Sbjct: 1192 KLDAAKTMQINLTTQINELNETKVNLEKSL--------------------QQEIEKNNQS 1231

Query: 1418 LNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKV---IDDLKTQLAANSTDADEQ 1474
             N    +SEE+ ++L+ E+E S+  S    K++E+ +K    I+ LK++L   S  A E 
Sbjct: 1232 GNGAADESEEI-IRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSEL--QSVKAYEN 1288

Query: 1475 TNRN---VEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVE 1531
            +  N   ++ +K  F+ +K + I +  +EF  +L +E E I  + + N   + + + ++E
Sbjct: 1289 STVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIE 1348

Query: 1532 ALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKA 1591
             L+K+WEE+ E LI KRI EAE+NLKKR+RLPSEEKIN +IEKRR  LE EF+ K+    
Sbjct: 1349 ELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL---- 1404

Query: 1592 RDLLMNDHSXXXXXXXXXXXXXXXXXXXXDELQAARKKAFEEGKQQATMKTTLLERKIQK 1651
            R+L +N                        EL   +KKAFEEGKQQ+ MK+TLLERK+ K
Sbjct: 1405 RELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSK 1464

Query: 1652 LESQI--QEKEKDSEETQDVKPEENSTPSVKKIPETLNSSDTSFG 1694
            LESQ     K  DS ETQ         PS   +   +NSS    G
Sbjct: 1465 LESQTLSPTKNNDSNETQ--------VPSKINLS-NINSSSPPLG 1500

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  161 bits (408), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 144/465 (30%), Positives = 250/465 (53%), Gaps = 29/465 (6%)

Query: 407 RQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQ 466
           +Q   L++ +++++ ELE ++P+I +F+     L+  L    L++E    + +     + 
Sbjct: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268

Query: 467 SLKKKISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXXXEDEIKFIKNLVSNDN 526
           S+KK I++ +S +E L  QRTDLAHQLQY                + EI F++NL++ D 
Sbjct: 269 SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328

Query: 527 MASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLXXXXXXXXXXXXXXVDED 586
              ++D Q VIS+ LIKFKDI  LQEKNMEL K++R LA  L               + D
Sbjct: 329 QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRE---NYD 385

Query: 587 NEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELK 646
           N+   EAKE IL+L++ N  L+  L+I T +    +L      + +  +S    K H   
Sbjct: 386 NDTINEAKETILSLQEYNNVLK--LEIGTLQSKISEL------QSSIPNSKESEKQH--F 435

Query: 647 SYNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERL 706
           +Y+  +VKDLE++L++L+  S +  + L +++  L+ E + + + +EK +S+  LA E+L
Sbjct: 436 NYHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKL 495

Query: 707 KITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLE 766
            + QNS +LL+ ENE+L  ++S LE  L +++K      + Y++        +T++ +  
Sbjct: 496 TLLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKC-------KTNLLDFT 548

Query: 767 TEVTLLKDREI-------SLKSELSNTTEEKTKLRIMVTQL-QSLQSERETLLERVQSDF 818
             +TLL + ++       SLK E+ +  E+   L      L QSL++E     ++V+ + 
Sbjct: 549 NRLTLLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVK-EL 607

Query: 819 KKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDE 863
           +  IS++N     L+++L  +  EID +      Q  WYQKK+D+
Sbjct: 608 ELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQ 652

 Score =  151 bits (382), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 171/558 (30%), Positives = 281/558 (50%), Gaps = 71/558 (12%)

Query: 1165 LVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYS---EHSDL 1221
            + +SLR ERD L  ++   E +   +   L+ +Q+EL          E++ +   +H   
Sbjct: 760  IFVSLRYERDTLSDQVVNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKG 819

Query: 1222 INNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQI--CRNELLPLQSNLES 1279
              N +T+   L +L+ L+E N+ L  E+  AL+E + IA   Q+      L PL++ +  
Sbjct: 820  NVNEETLIEKLTELDELKERNMELTQEI-HALNENN-IALKCQLEESLERLKPLETKISE 877

Query: 1280 ANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQ 1339
             N LI++KD  I  +N++++ WKTR  E+    +  + +D   L++ + E       K +
Sbjct: 878  LNILIEDKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDLINLQKQVEE-------KSK 930

Query: 1340 ETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTXXXXXXXX 1399
            E  EL+DRFNRLKKQA+E+L+ SK  Q++L EQ + L +   D+ + L            
Sbjct: 931  ENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNL----------SE 980

Query: 1400 XXXXFREKQNDLETLREELNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDD 1459
                F+E +N + +L+++   E+    +L+ +L N ++ S        K + E + ++ D
Sbjct: 981  QMERFKELENSI-SLKDQ---ELGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSD 1036

Query: 1460 LKTQL-AANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQE 1518
            LK ++ + N     ++++  ++  + E EN K   IAE  E+ NK   E   K + E + 
Sbjct: 1037 LKNEIESLNEKLKSKESSVGLQ--ESEIENAKKILIAELEEKLNKTKSELDLKHKEELK- 1093

Query: 1519 NEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSE 1578
                          L+ ++E D    IQKR+AEAE+ LK++IRLPSEEKIN IIE + ++
Sbjct: 1094 -------------VLKTEYEGD----IQKRVAEAEEALKRKIRLPSEEKINTIIESKVAD 1136

Query: 1579 LESEFDQKIRDKARDLLMNDHSXXXXXXXXXXXXXXXXXXXXDELQAARKKAFEEGKQQA 1638
            LE ++ +K+   + +                           D L  A+KKAFEEGKQQA
Sbjct: 1137 LEEDYKKKLETVSAE---------------STDIEKIKQEFEDNLVNAKKKAFEEGKQQA 1181

Query: 1639 TMKTTLLERKIQKLESQIQEKEKD-SEETQDVKPEEN--STPSVKKIPETLNSSDTSFGN 1695
            +MKT  LE KI KLESQ+Q  E D +++  +VK  +N  S P + K     + + +   N
Sbjct: 1182 SMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSNPELDKQEAKPSFTFSPPPN 1241

Query: 1696 SNNVKVLK----PSSPFG 1709
            SN     +    P S FG
Sbjct: 1242 SNPFTTTQDTDSPVSVFG 1259

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 96.3 bits (238), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 126/496 (25%), Positives = 248/496 (50%), Gaps = 56/496 (11%)

Query: 393 GDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLE 452
            D  ILK+++ + + Q++ LQ ++E  + ELE+  P +N+  ++ + LE  L+      E
Sbjct: 296 CDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLSKEKNTSE 355

Query: 453 HATK-----ENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXX 507
           H        ENE K N +  LK  +SDD  ++E L  +  DL +Q+Q+            
Sbjct: 356 HFKTTIKEIENE-KKNIISRLK--LSDD--KIETLREENNDLTNQIQFMLISNSIQNDKY 410

Query: 508 XXXXEDEIKFIKNLVSNDNMASTN---DSQKVISEHLIKFKDIQQLQEKNMELVKTVRTL 564
               E+EIKFIK L       S N   +SQ +IS+ LI+F+ +  LQ+KNMEL+KT+R +
Sbjct: 411 GELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLI 470

Query: 565 AQQLXXXXXXXXXXXXXXVDEDNEIFAEAKEAILTL--------EKVNENLEKNL---QI 613
            ++L                E++++  EAKE IL +        EK++E L++ L   + 
Sbjct: 471 TKKLDNQEHELRAKWEA---ENDDVLNEAKEEILKVVSESDKLKEKISE-LQQQLNANRP 526

Query: 614 VTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNET---VVKDLENRLTQLTND-SNA 669
           V+ E++  + +++E+                 K Y E    ++ +L+N + + T   SN 
Sbjct: 527 VSHEKNGHESVLAEN-----------------KLYTEGDRLILDELKNNIPEFTKQASNI 569

Query: 670 HSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSR 729
            S    +  +L +K +     +++ Y+S + + +++L + Q+  + LS  NE+L+     
Sbjct: 570 ISMNFDQLTSLYNKNLELTADRLKAYQS-RDITQKKLDLLQDKYDYLSISNEKLKEHMEV 628

Query: 730 LEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLET---EVTLLKDREISLKSELSNT 786
           ++D++ ++D+    T +++V+  +   S+   + +L T   E+  LKD++  + +EL   
Sbjct: 629 IKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELK-- 686

Query: 787 TEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKI 846
             E+ +L++ +  ++++Q + +      ++    +I+++   N  L K L  +  E+   
Sbjct: 687 -MEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDF 745

Query: 847 EKERNAQYEWYQKKID 862
              +N + +WYQKK D
Sbjct: 746 ISTKNRELDWYQKKFD 761

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 43/55 (78%)

Query: 1337 KVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVKT 1391
            K +E +E  DRFNRLKKQA+ +L++SKE Q++L EQIS+L  +  +++ +L+V++
Sbjct: 980  KSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQS 1034

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 81.6 bits (200), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 127/482 (26%), Positives = 235/482 (48%), Gaps = 48/482 (9%)

Query: 393 GDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVI--NSFQERTSVLEKELTDTALL 450
            +I  +K +L++EK +K  L+ +   F+ ++E K+P +  NS +  T+   K + +  ++
Sbjct: 281 NNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNK-IEEQKII 339

Query: 451 LEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYXXXXXXXXXXXXXXX 510
            EH +    LK  E QSLK K++D  S ++ LL+QR+DL HQ+ Y               
Sbjct: 340 HEHDS----LKL-ENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKI 394

Query: 511 -XEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLX 569
             E+E+ FI+NLV+      + ++Q +ISE L+KF ++  L  KN++L+  VR L  ++ 
Sbjct: 395 LTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKM- 453

Query: 570 XXXXXXXXXXXXXVDEDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDR 629
                        ++ D +   EAK+ ++ L++  EN+ KN  I+ +     KLL  ED+
Sbjct: 454 ESIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKE--ENV-KNKDIINQIISEKKLL--EDK 508

Query: 630 ERNFKSSNS-VHKYHELKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQL 688
                S+ + ++K  E+K   E  +K+LE    Q TN S            LL K  +QL
Sbjct: 509 IHGLNSTVTELNKSMEIKR--EPTLKNLE---LQKTNQS------------LLEKN-NQL 550

Query: 689 NVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRL----EDSLLQQDKETQKT 744
           +++I       S A    KI +   +LL K   +L+   S +    + S++ +D      
Sbjct: 551 SIEI-------SNASNENKILKEKFDLLIKSYTELKELKSEISTYTKSSVISKDGNETAK 603

Query: 745 FSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQ 804
            S  V+  +K  +LE S ++ E++   L+    ++K EL     E    +     + S  
Sbjct: 604 ISELVDLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFN 663

Query: 805 SERETLLERVQSD---FKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKI 861
             + ++     ++    K+ ++ V  +N+ L+ ++  + ++I  + ++  +Q +WYQ KI
Sbjct: 664 QNKNSIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKI 723

Query: 862 DE 863
           DE
Sbjct: 724 DE 725

 Score = 33.5 bits (75), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 1327 LNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNL 1376
            ++E K+ ++ K +E  E  DRF RLKKQA +KLN  K  ++ L+E   +L
Sbjct: 753  IDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDL 802

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 56/103 (54%), Gaps = 12/103 (11%)

Query: 393 GDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERT----SVLEKELTDTA 448
            D K+LK+ LV EK    KLQ ++ S ++EL  K+P + S +E+     SV E  ++   
Sbjct: 207 NDNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNE 266

Query: 449 LLLE--HATKENELKTNELQSLKKKISDDNSQLEILLRQRTDL 489
            LL+  H+       T+++ S+  KI D    L+ LL QRT+L
Sbjct: 267 ELLQQFHSN------TDKIASMNNKIVDYEQSLKQLLSQRTNL 303

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 7/70 (10%)

Query: 1318 DDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLI 1377
            +DY  L+++  E       K +E  E ND+F+RLK+QA+E+LN SK  Q  L + + +L 
Sbjct: 648  NDYENLKKSFEE-------KSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLE 700

Query: 1378 SEKDDIRKQL 1387
             E+ + ++ +
Sbjct: 701  DERTNFKEHI 710

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 40.0 bits (92), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 60/107 (56%), Gaps = 4/107 (3%)

Query: 1168 SLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKR----SAALLESEYSEHSDLIN 1223
            SLRR+ D + +K+  ++ + NS  Q +D IQ E+E+ K     +  +LE   S+   L+ 
Sbjct: 864  SLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIEDLKSEKRNNDKILEKANSQQRLLLK 923

Query: 1224 NYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNEL 1270
              +T + D+E+  + + + +T R+EL+Q + E   +A+D     N+L
Sbjct: 924  KLETFQKDVEKTMIKKTALITRRDELQQKIREIGLLAEDALNAFNDL 970

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
            YLR309C
          Length = 824

 Score = 38.9 bits (89), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 91/323 (28%), Positives = 153/323 (47%), Gaps = 73/323 (22%)

Query: 1085 KNDTKSLTAELQSLQDQMSQNEK---HLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQI 1141
            KN+T  L+++L  +++++ Q EK   +L+ +  EY    +  +Q +D + ++N+ L N+I
Sbjct: 421  KNETDKLSSQLNQVKNKLIQKEKTVIYLEKQIKEYAENQEPVKQAMDLLKRENKQLSNRI 480

Query: 1142 DLL-NRAESVN----ENSSDDE----ANGSTALVLSLRRERDILDTKINVIETEKNSLQQ 1192
            DLL N  ES+N    +NSS  E     NG       L    DIL  K + ++  KN+   
Sbjct: 481  DLLKNENESLNNDLKKNSSTYEDYLKENGK------LTERIDILQEKYDTLQNLKNNSSD 534

Query: 1193 KLDDIQNELE--NTKRSAA-----LLESEYSEHSDLINN----YQTIRGDLEQLNLLRES 1241
             +D I+ + E  N K   A      LE E S+++ +I +      T+R       LL ES
Sbjct: 535  HMDSIKKQCEELNVKLREANKKIISLEDELSDYTSIIQDKAREADTMRR------LLSES 588

Query: 1242 NVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQR- 1300
            N    N+ K  LDE +     + I  N  L  + NL+S+ N I+ ++L+  S ND+SQ  
Sbjct: 589  N----NDEKNKLDEMETKLNSM-IDENNNLKSELNLQSSRNKIELQNLQ--SLNDQSQNE 641

Query: 1301 ----------------WKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLL---DNKVQE- 1340
                               +L E  +KH+  + +D   L++T+N  K  L   ++K+ E 
Sbjct: 642  IKSLQLNKLQLLSEIETLNKLNENFKKHKDNDFNDSHNLQKTINNLKDSLSRSESKITEL 701

Query: 1341 ----------TNELNDRFNRLKK 1353
                       N++N +F+R+ K
Sbjct: 702  QSANDELMSLNNDINKKFDRISK 724

>Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {ON}
            YLR309C (REAL)
          Length = 913

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 109/206 (52%), Gaps = 23/206 (11%)

Query: 1035 FEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAE 1094
            +E K+ +L+N ++     A + + +  ++ + HA + K +++L E+  +L  +  +LT E
Sbjct: 447  YETKIIELKNKIDSLNKEAEHLKTSSAEKEEEHAVLQKKVAKLNEEISQLTCERSNLTKE 506

Query: 1095 LQSLQDQMSQNEK---HLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVN 1151
            L SL+    Q +K   +L+ +  ++  Q D A++  + + K+N  + N++DLL +    N
Sbjct: 507  LTSLRISYKQKDKTVGYLEEQVKQFSEQKDAAEKSTEQLQKENVKMSNKLDLLKKE---N 563

Query: 1152 ENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQ-------QKLDDIQNEL--- 1201
            E   +D A    +  + L +E   L  ++N+++ + N+LQ       + +D I+ +    
Sbjct: 564  ETLHNDIAKNGNSYEMYL-KENGKLSERLNILQEKYNTLQNVKSNSNEHIDTIKRQCEEL 622

Query: 1202 -----ENTKRSAALLESEYSEHSDLI 1222
                 E+TK+  + LE E SE+++++
Sbjct: 623  NVKLKESTKKILS-LEDELSEYTNIV 647

>TPHA0N00540 Chr14 complement(107050..111780) [4731 bp, 1576 aa] {ON}
            Anc_7.68 YAL029C
          Length = 1576

 Score = 37.0 bits (84), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 1302 KTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLK 1352
            K  LEEM+ +H+++ ++   +LEE LN+TKQLL     ET +L  + N LK
Sbjct: 1034 KKELEEMVTRHEQLKIEAMQQLEE-LNKTKQLLSESSTETTDLQGQVNSLK 1083

>Kwal_8.599 s8 complement(21951..23831) [1881 bp, 626 aa] {ON} [contig
            311] FULL
          Length = 626

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 11/87 (12%)

Query: 1308 MIEKHQKV-NVDDYTKLEET---------LNETKQLLDNKVQETNELNDRFNRLKKQAHE 1357
            +I  H KV   D YT+L+           +N   Q +  K+ E  ++ND F R+ K A E
Sbjct: 180  LIHDHLKVIGADCYTQLDGVRLIRCASHIINLQFQRVVEKLMEDEDINDAFQRISKVA-E 238

Query: 1358 KLNTSKELQSSLQEQISNLISEKDDIR 1384
            +L  S +L++S+QE    LI  + ++R
Sbjct: 239  RLKWSSQLRASIQEYDLPLIPLEPEVR 265

>Smik_13.65 Chr13 complement(113555..116722) [3168 bp, 1055 aa] {ON}
            YML075C (REAL)
          Length = 1055

 Score = 35.0 bits (79), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 58/138 (42%), Gaps = 18/138 (13%)

Query: 1052 YANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLT---AELQSLQDQMSQNEKH 1108
            Y   A++N +  LQ   DVSK +S       RL+ND KSL        SL D  S+N   
Sbjct: 125  YTVFAKENTKYILQEDLDVSKEVSSADGTKWRLRNDRKSLFDVKTLTYSLYDVFSKNV-- 182

Query: 1109 LKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNEN---SSDDEANGSTAL 1165
              ++ D + + I         +T    + Y    L N       N   S+    N +++L
Sbjct: 183  --TQADPFDVLI--------IVTAYLMMFYTIFGLFNDMRKSGSNFWLSASTVVNSASSL 232

Query: 1166 VLSLRRERDILDTKINVI 1183
             L+L   + +L  +++ +
Sbjct: 233  FLALYVTQCVLGKEVSAL 250

>Kwal_14.716 s14 complement(5384..7687) [2304 bp, 767 aa] {ON} [contig
            245] FULL
          Length = 767

 Score = 35.0 bits (79), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 11/87 (12%)

Query: 1308 MIEKHQKV-NVDDYTKLE---------ETLNETKQLLDNKVQETNELNDRFNRLKKQAHE 1357
            +I  H KV   D YT+L+           +N   Q +  K+ E  ++ND F R+ K A E
Sbjct: 321  LIHDHLKVIGADCYTQLDGVRLIRCASHIINLQFQRVVEKLMEDEDINDAFQRISKVA-E 379

Query: 1358 KLNTSKELQSSLQEQISNLISEKDDIR 1384
            +L  S +L++S+QE    LI  + ++R
Sbjct: 380  RLKWSSQLRASIQEYDLPLIPLEPEVR 406

>ZYRO0A09548g Chr1 (770850..772805) [1956 bp, 651 aa] {ON} weakly
            similar to uniprot|Q04924 Saccharomyces cerevisiae
            YDR221W Hypothetical ORF
          Length = 651

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 35/56 (62%)

Query: 1061 EQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEY 1116
            +QEL+ H    +T+ +L+ Q+       + L+ +++SL +Q+S NEK L SE+ +Y
Sbjct: 142  QQELENHHHGMQTLLQLKAQSPAPVKTQEGLSEQIRSLSEQLSNNEKILASEKADY 197

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 1084 LKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRI--------DDITKQNQ 1135
            L+ND   L  +L SL+ Q++Q+++ LK +  E + QIDLA+  I        DD+ + NQ
Sbjct: 714  LENDLSILNTDLMSLKTQLAQSKRMLKEKETEIQYQIDLAEGEIEPRIKTLKDDLHRYNQ 773

>CAGL0H00594g Chr8 (57283..58644) [1362 bp, 453 aa] {ON} weakly
           similar to uniprot|Q12365 Saccharomyces cerevisiae
           YPL255w BBP1 cell division control protein
          Length = 453

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query: 153 QIKTLNDKILELELKCQEYQSSELNRKSELERNAQEILLLRKNQEWLEQELTNKNQHFMF 212
           +I+ LN+KIL+LE +CQE ++ +L     LER+  E+ +     +  EQ ++N   +F  
Sbjct: 360 EIQNLNEKILKLESRCQELEAEKL-----LERDKYELRIASLEAKLREQNISNGKNYFSD 414

Query: 213 Y 213
           Y
Sbjct: 415 Y 415

>SAKL0F08844g Chr6 (675792..677642) [1851 bp, 616 aa] {ON} similar to
            uniprot|P34909 Saccharomyces cerevisiae YER068W MOT2
            Component of the CCR4-NOT transcription regulatory
            complex which represses transcription at least in part by
            inhibiting functional TBP-DNA interactions and also aids
            in transcription elongation interacts with C- terminal
            region of Not1p
          Length = 616

 Score = 33.5 bits (75), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 13/84 (15%)

Query: 1475 TNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQE-------------NEK 1521
            T  N++AI+    N  T F++E  E+F    IE  +     F+              N +
Sbjct: 2    TTTNMQAIQAALSNYDTSFLSEDEEDFCPLCIEPMDITDKNFKPCPCGYQICQFCYNNIR 61

Query: 1522 PDTELNVDVEALRKQWEEDSEELI 1545
             + ELN    A R++++++S E I
Sbjct: 62   QNPELNGRCPACRRKYDDESVEYI 85

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 33.5 bits (75), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 7/67 (10%)

Query: 699 KSLAEERLKITQNSMEL-LSKENEQ------LRIRSSRLEDSLLQQDKETQKTFSSYVEA 751
           K L E  +K   NS+ + ++K  EQ      LRIRSS+LED+L+         F  ++++
Sbjct: 779 KKLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDS 838

Query: 752 ISKNSSL 758
           I +N SL
Sbjct: 839 IMQNKSL 845

>Skud_11.154 Chr11 (284835..287168) [2334 bp, 777 aa] {ON} YKL072W
            (REAL)
          Length = 777

 Score = 33.1 bits (74), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 1158 EANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNEL---ENTKRSAALLESE 1214
            E  G T+L   LR    ILD ++  +ET  +   +KL+D++ +L    N+K  + +LES 
Sbjct: 653  EKKGMTSLSSKLRYNVRILDRRVRDVETSVDHFDRKLEDVRKKLLEQNNSKEISMVLESP 712

Query: 1215 YSE 1217
            Y +
Sbjct: 713  YGK 715

>AFR273W Chr6 (923039..925948) [2910 bp, 969 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGL238W (CSE1)
          Length = 969

 Score = 33.1 bits (74), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 46/94 (48%), Gaps = 14/94 (14%)

Query: 1232 LEQLNLLRESNVTLRNELKQALDEKDKI--------------AKDLQICRNELLPLQSNL 1277
            L  L+++  +N+     L  AL  K+ I              A+D+++ + E++PL   L
Sbjct: 52   LTLLHVVASNNLAASTRLAGALFFKNFIRRRWVDENGEHLLSARDVELVKKEIVPLMIQL 111

Query: 1278 ESANNLIKEKDLKIASANDESQRWKTRLEEMIEK 1311
             S   +   + + + + +D  +RW T L+++++K
Sbjct: 112  GSHLQVQIGESIAVIADSDFPERWPTLLDDLVDK 145

>TBLA0A04090 Chr1 complement(1014784..1016967) [2184 bp, 727 aa] {ON}
            Anc_8.346 YLR139C
          Length = 727

 Score = 33.1 bits (74), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 103/226 (45%), Gaps = 45/226 (19%)

Query: 986  FEILKQQLENIKNELTV---QSEEAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKL 1042
            FE +  Q E+I N L +   Q  +A+ ++  + +    L+ AA+ I+ +K +        
Sbjct: 109  FEGVDLQAEHIGNYLPLKPLQMIKAQGKKLLIFENKVSLEQAAKSIQYLKPV-------- 160

Query: 1043 ENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQM 1102
                 ++ +    +Q+ ++ EL +H D + TI +LR   ++  N + +            
Sbjct: 161  -----DEVI----SQQRFD-ELTKHLDSAYTIVQLRAYTRKFFNKSNA------------ 198

Query: 1103 SQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQ--IDLLNRAES---VNENS--S 1155
                 HL  ER   RI ++    ++DD   Q   L N+  IDL  +A     V +NS   
Sbjct: 199  -----HLTKERLIKRIIMEYWHCKVDDKALQKDKLINESVIDLEPKALFLLLVTDNSKIF 253

Query: 1156 DDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNEL 1201
             + AN    +++++   + I++  +NVI   + +L + L++I  ++
Sbjct: 254  HNFANMGARIIVAVDENKIIVNATVNVIRYIELALGKILNNISTKV 299

>NCAS0C05560 Chr3 complement(1128856..1130133) [1278 bp, 425 aa] {ON}
            Anc_4.86 YGR149W
          Length = 425

 Score = 32.7 bits (73), Expect = 8.7,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (55%)

Query: 1107 KHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEAN 1160
            K  K E D+ RI++D  QQ+++D   Q   L  + D  + A+SV  N SD  +N
Sbjct: 365  KTFKHEVDKLRIEVDNLQQQLNDKNIQLDYLLVERDKESGADSVFNNISDISSN 418

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.309 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 170,642,481
Number of extensions: 7952264
Number of successful extensions: 87696
Number of sequences better than 10.0: 4105
Number of HSP's gapped: 72017
Number of HSP's successfully gapped: 10979
Length of query: 1780
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1656
Effective length of database: 39,262,815
Effective search space: 65019221640
Effective search space used: 65019221640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)