Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0G02453g5.698ON59759731060.0
YKR093W (PTR2)5.698ON60160221970.0
Smik_11.3565.698ON60260221970.0
Suva_11.3295.698ON60160221770.0
TDEL0B022305.698ON57458721170.0
KNAG0C065705.698ON59056420900.0
Kpol_529.285.698ON61057220690.0
NDAI0E050205.698ON61958220520.0
NCAS0A032205.698ON61158220390.0
TBLA0A091205.698ON63361120380.0
ZYRO0G06688g5.698ON61354020320.0
TPHA0O02000singletonON62059220070.0
SAKL0E14828g5.698ON59259019830.0
TPHA0N01960singletonON59151119750.0
TBLA0E01140singletonON61157419600.0
TBLA0B04710singletonON61553419280.0
KAFR0H002405.698ON59158119080.0
KLLA0E12915g5.698ON65456519130.0
KAFR0H00230singletonON59659418870.0
Skud_11.3315.698ON39939515650.0
Kwal_47.16930na 1ON6116126401e-74
KLTH0D16544gna 1ON6266176026e-69
AGL365Cna 2ON5995275552e-62
Ecym_2823na 2ON6136175519e-62
AFR228WsingletonON5765644771e-51
ADL156Cna 3ON483132790.60
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G02453g
         (597 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...  1201   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   850   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   850   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   843   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   820   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   809   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   801   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   795   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   790   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   789   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   787   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   777   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   768   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   765   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   759   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            747   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   739   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   741   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      731   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   607   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   251   1e-74
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   236   6e-69
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   218   2e-62
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   216   9e-62
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   188   1e-51
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    35   0.60 

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score = 1201 bits (3106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/597 (97%), Positives = 581/597 (97%)

Query: 1   MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDD 60
           MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDD
Sbjct: 1   MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDD 60

Query: 61  DFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGL 120
           DFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGL
Sbjct: 61  DFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGL 120

Query: 121 LGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIP 180
           LGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIP
Sbjct: 121 LGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIP 180

Query: 181 GVTNSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNL 240
           GVTNSD                TGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNL
Sbjct: 181 GVTNSDGALGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNL 240

Query: 241 TLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKP 300
           TLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKP
Sbjct: 241 TLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKP 300

Query: 301 PVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFY 360
           PVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFY
Sbjct: 301 PVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFY 360

Query: 361 PVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPL 420
           PVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPL
Sbjct: 361 PVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPL 420

Query: 421 RPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAI 480
           RPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAI
Sbjct: 421 RPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAI 480

Query: 481 SEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLA 540
           SEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLA
Sbjct: 481 SEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLA 540

Query: 541 CACFIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDDEEAAEHVRSIKSEKS 597
           CACFIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDDEEAAEHVRSIKSEKS
Sbjct: 541 CACFIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDDEEAAEHVRSIKSEKS 597

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/602 (68%), Positives = 482/602 (80%), Gaps = 13/602 (2%)

Query: 1   MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALG--- 57
           MLN  S+ +D+    E Q D   I++  ++ V  ++D    ++  D +N+   + L    
Sbjct: 1   MLNHPSQGSDDAQD-EKQGDFPVIEEEKTQAV-TLKDS---YVSDDVANSTERYNLSPSP 55

Query: 58  EDDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNP 117
           ED+DFE PTEEE++TLRHV G IP+RCWLIAIVELSERFSYYGLSAPFQNYM+ GPND+P
Sbjct: 56  EDEDFEGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSP 115

Query: 118 KGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFIT 177
           KG+L L SQGATGLSYFFQFWCYVTPVFGG+V+DT+WGKYNTIC GT IY+ GIFILFIT
Sbjct: 116 KGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFIT 175

Query: 178 SIPGVTNSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIED 237
           SIP V N D                TGMIK+NLSVLIADQLP +KP + + K GERVI D
Sbjct: 176 SIPSVGNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVD 235

Query: 238 PNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQY 297
            N+TLQNVFMFFYF INVGSLS+MATTELEYHKGFWAAYLLPFCFFW+AV  L+FG+ QY
Sbjct: 236 SNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQY 295

Query: 298 IKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVF 357
           I+ P+GDKVI+KSFKV +IL+KNKF+  AAKPS +P+KN+PW+DKFVDEIKRAL ACKVF
Sbjct: 296 IQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVF 355

Query: 358 VFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRY 417
           +FYP+YW  YGTM+++F+TQ   MELH +PNDFLQAFDSIALIIFIPIFE+FVYPFIRRY
Sbjct: 356 IFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRY 415

Query: 418 TPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVL 477
           TPL+PITKIFFGFM GS AM WAAVLQ F+Y  GPWY+ PL H+TPNH+HV WQIPAYVL
Sbjct: 416 TPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVL 475

Query: 478 IAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYT 537
           I+ SEIFASITGLEYAYSKAP SMKSFIMSIFLLTNAFGSAIGCALSPV+VDPKF W +T
Sbjct: 476 ISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFT 535

Query: 538 GLACACFIAGWVFWFIYSGLNDEEEAMNALDY-EHDEF----MYKHHSDDEEAAEHVRSI 592
           GLA ACFI+G +FW  +   ND EE MNA+DY E DEF    +    ++D E  E + S+
Sbjct: 536 GLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESL 595

Query: 593 KS 594
           +S
Sbjct: 596 RS 597

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/602 (68%), Positives = 481/602 (79%), Gaps = 13/602 (2%)

Query: 1   MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALG--- 57
           MLN  S+ +DE    E Q D   I++  +  V  ++D    ++  D +N+   + L    
Sbjct: 1   MLNHPSRSSDEVQD-EKQGDFPVIEEEKTHAV-TLKDS---YVSDDVANSTEQYNLSHSP 55

Query: 58  EDDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNP 117
           ED+DFEAPTEEE KTLRHV G IP+RCWLIAIVELSERFSYYGLSAPFQNYM+ GPND+P
Sbjct: 56  EDEDFEAPTEEETKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSP 115

Query: 118 KGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFIT 177
           KG+LGL SQGATGLSYFFQFWCYVTPVFGG+V+DT+WGKYNTIC GT IY+ GIFILFIT
Sbjct: 116 KGVLGLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFIT 175

Query: 178 SIPGVTNSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIED 237
           SIP V N D                TGMIK+N+SVLIADQLP +KP + + K GERVI D
Sbjct: 176 SIPSVGNRDSAIGGFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVD 235

Query: 238 PNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQY 297
            N+TLQNVFMFFYF INVGSLS+MATTELEYHKGFWAAYLLPFCFFW+AV  L+FG+ QY
Sbjct: 236 SNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQY 295

Query: 298 IKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVF 357
           I+ P+GDKV++KSF+V +IL+KNKF+  AAKPS +P++N+PW+DKFVDEIKRAL ACKVF
Sbjct: 296 IQRPIGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVF 355

Query: 358 VFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRY 417
           VFYP+YW  YGTM+++F+TQ   MELH +PNDFLQAFDSIALI+FIPIFE+FVYPFIRRY
Sbjct: 356 VFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRY 415

Query: 418 TPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVL 477
           TPL+PITKIFFGFM GS AM WAAVLQ F+Y  GPWY+ PL H+TPNHIHV WQIPAYVL
Sbjct: 416 TPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVL 475

Query: 478 IAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYT 537
           I+ SEIFASITGLEYAYSKAP SMKSFIMSIFLLTNAFGSAIGCALSPV+VDPKF W +T
Sbjct: 476 ISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFT 535

Query: 538 GLACACFIAGWVFWFIYSGLNDEEEAMNALDYEH-DEF----MYKHHSDDEEAAEHVRSI 592
           GLA ACFI+G +FW  +   ND EE MNA+DYE  DEF    +    ++D E  E   S+
Sbjct: 536 GLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESL 595

Query: 593 KS 594
           +S
Sbjct: 596 RS 597

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/602 (67%), Positives = 480/602 (79%), Gaps = 13/602 (2%)

Query: 1   MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALG--- 57
           MLN  S+ +D+    E Q +   +++  ++ V  ++D    ++  D +N+   F L    
Sbjct: 1   MLNHLSQGSDDIQD-EKQGEFPVVEEEKNQTV-TLKDS---YVSDDAANSTERFNLSPSP 55

Query: 58  EDDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNP 117
           ED++FEAPT+EEL++LRHV G IP+RCWLIAIVELSERFSYYGLSAPFQNYM+ GPND P
Sbjct: 56  EDNEFEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTP 115

Query: 118 KGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFIT 177
           KG+L L S GATGLSYFFQFWCYVTPVFGG+++DT+WGKYNTIC GT IY+ GIFILFIT
Sbjct: 116 KGMLSLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFIT 175

Query: 178 SIPGVTNSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIED 237
           SIP V N D                TGMIK+NLSVLIADQLP +KP + + K GERVIED
Sbjct: 176 SIPSVGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIED 235

Query: 238 PNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQY 297
            N+TLQNVFMFFYF INVGSLS+MATTELEYHKGFWAAYLLPFCFFWVAV  LVFG+ QY
Sbjct: 236 GNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQY 295

Query: 298 IKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVF 357
           I+ P+GDKVI+KSFKV +IL+KNKF+  AAKPS +P+K++PW+DKFVDEIKRAL ACKVF
Sbjct: 296 IQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVF 355

Query: 358 VFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRY 417
           VFYP+YW  YGTM+++F+TQ   MELH +PNDFLQAFDSIALIIFIPIFE+F YPFIRRY
Sbjct: 356 VFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRY 415

Query: 418 TPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVL 477
           TP +PITKIFFGFM GS AM WAAVLQ F+Y  GPWY  PL H+TPNH+HV WQIPAYVL
Sbjct: 416 TPFKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVL 475

Query: 478 IAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYT 537
           I+ SEIFASITGLEYAYSKAP +MKSFIMSIFLLTNAFGSAIGCALSPV+VDPKF W +T
Sbjct: 476 ISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFT 535

Query: 538 GLACACFIAGWVFWFIYSGLNDEEEAMNALDY-EHDEF----MYKHHSDDEEAAEHVRSI 592
           GLA ACFI+G +FW  +   ND EE MNA+DY E DEF    + +  ++D E  E + S+
Sbjct: 536 GLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISQPKANDIEILEPMGSL 595

Query: 593 KS 594
           KS
Sbjct: 596 KS 597

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/587 (66%), Positives = 450/587 (76%), Gaps = 19/587 (3%)

Query: 6   SKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDDFEAP 65
           +   D  ++VE QK V  +DD   + +      E+   D +                  P
Sbjct: 6   TSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDE------------------P 47

Query: 66  TEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKS 125
           TEEE+KTL+HVAG IP RCWLIA+VELSERF+YYGLS PFQNYMQNGP+D P GLL LKS
Sbjct: 48  TEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKS 107

Query: 126 QGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNS 185
           QGATGLSYFFQFWCYVTP+FGGW+SDTY GKYNTIC GT +YV GI ILF+TSIP +T  
Sbjct: 108 QGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQ 167

Query: 186 DXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNV 245
           +                TGMIKSN+SVLIADQ P ++ RV+  K G RVIEDPN+TLQNV
Sbjct: 168 NAATGGFIAAIILIGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNV 227

Query: 246 FMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDK 305
           FM FY  IN+GSLSV+ATTELE H GFWAAYLLPFCFFW+AV VL  G+N Y+KPPVGDK
Sbjct: 228 FMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDK 287

Query: 306 VISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWV 365
           VISK FKV+ I  KNKFN EAAKPS +PD+ FPW+DKFVDEI R+L ACKVF+FYPVYWV
Sbjct: 288 VISKCFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWV 347

Query: 366 CYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITK 425
           CYG MLN FV+ GGTMELH LPNDF QA DSIALI+FIPI E F+YP+IR++TP RPITK
Sbjct: 348 CYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITK 407

Query: 426 IFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFA 485
           IF+GFM G+ AMVWAAVLQHFIY  GPWY +P+  +TPNHIH+AWQ+PAYVLIA SEIFA
Sbjct: 408 IFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFA 467

Query: 486 SITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFI 545
           SITGLEYAYSKAP +MKSFIM+IFLLTNAFGSAIGCALSPV+ DP +VW Y GL  ACF 
Sbjct: 468 SITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFA 527

Query: 546 AGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDD-EEAAEHVRS 591
           AGW+FWF +   ND EEAMNALDY+ D  M KH  D  EE A+  ++
Sbjct: 528 AGWLFWFCFKHYNDTEEAMNALDYDEDPTMLKHSKDGIEECADFSKA 574

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/564 (68%), Positives = 444/564 (78%), Gaps = 4/564 (0%)

Query: 18  QKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDD----FEAPTEEELKTL 73
           Q +  S DD+  K+   +  +E  H   + S    + A   +DD    +E PTEEEL+TL
Sbjct: 5   QVNTFSEDDSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTL 64

Query: 74  RHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSY 133
           +HV GHIP+RCWLIA+VELSERFSYYGLSAPFQNYM NGP+D P GLL L S GATGLSY
Sbjct: 65  KHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSY 124

Query: 134 FFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDXXXXXXX 193
           FFQFWCYVTP+FGG+++DT+WGKYNTI VGT IY+CGIFILF+TSIP +T  +       
Sbjct: 125 FFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFI 184

Query: 194 XXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTI 253
                    TGMIKSNLSVLIADQLP +KP V   K GERVIED NLTLQNVFMFFY  I
Sbjct: 185 VAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMI 244

Query: 254 NVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKV 313
           N+GSLSV+AT+ELE H+GFWAAYLLPFCFFW+AV VLV G+NQY+KPP+GDKVISK FKV
Sbjct: 245 NIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKV 304

Query: 314 LYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNN 373
           L+IL+KN+FN +A KPS NP KN+PWSDKFVDEI+RAL ACKVF+FYP+YW CYG M++ 
Sbjct: 305 LWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSG 364

Query: 374 FVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVG 433
           FVTQG  MELH LPNDF Q  DSIA+I+FIP+ E  +YPFIR+YTP RPITKI+FGFM  
Sbjct: 365 FVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFA 424

Query: 434 SGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFASITGLEYA 493
           SG M+WAAVLQ +IY  GP Y  PL+HD PN IHVA Q+PAYVL+A SEIFASITGLEYA
Sbjct: 425 SGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYA 484

Query: 494 YSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFI 553
           YSKAP SMKSFIMSIFL+TNAFGSAIGCALSPVS DP + W YTGLA ACFI+G +FW  
Sbjct: 485 YSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVC 544

Query: 554 YSGLNDEEEAMNALDYEHDEFMYK 577
           +   ND EE MNA+DYE D  M K
Sbjct: 545 FRKYNDIEEEMNAMDYEVDATMLK 568

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/572 (65%), Positives = 451/572 (78%), Gaps = 23/572 (4%)

Query: 3   NRFSKRNDEKNAVEVQK----DVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGE 58
           + F+   D K   EV+     D +S+ ++   E+ ++ D +I + D              
Sbjct: 16  DSFASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDD-------------- 61

Query: 59  DDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPK 118
           + DF  PTEEE+KTL+HV+G IP+RCWLIA+VELSERFSYYGL+APFQNYM NGPND PK
Sbjct: 62  NQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPK 121

Query: 119 GLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITS 178
           G+L L +QGA+ LSYFFQFWCY+TP+FGG+++DTYWGKYNTIC GT IYV GIF+LFITS
Sbjct: 122 GVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITS 181

Query: 179 IPGVTNSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDP 238
           +P +   +                TGMIK+N+SVLIA+Q+P  KPRV+  K G+RVIEDP
Sbjct: 182 LPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDP 241

Query: 239 NLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYI 298
           N+T QNVFMFFY  INVGSLS+MATTELE HKGFWAAYLLPFCFFW+AV VLV GRNQYI
Sbjct: 242 NITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYI 301

Query: 299 KPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFV 358
             PVGDK+ISKSFKV++IL KNK N +AAKPS NP+KN+PW+DKFV+EI+RAL+ACKVFV
Sbjct: 302 MVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFV 361

Query: 359 FYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYT 418
           FYP+YW  YG M+NNFVTQ GTMELHNLPNDFLQAFDSIA+I+FIPIFERF+YPF+RR+T
Sbjct: 362 FYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFT 421

Query: 419 PLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLD-----HDTPNHIHVAWQIP 473
           P RPITKIF+GFM GSGAM+WAAVLQ FIY  GP Y+ P+       +TPN +HVAWQ+P
Sbjct: 422 PFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVP 481

Query: 474 AYVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFV 533
           AYVLIAISEI AS+TGLEYAYS AP SMKSFIMSIFL+TNAFGSAIG A+SP + DPK+ 
Sbjct: 482 AYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYT 541

Query: 534 WFYTGLACACFIAGWVFWFIYSGLNDEEEAMN 565
           W +TGLA ACFIAG +FW  +   N+ E+AMN
Sbjct: 542 WTFTGLAVACFIAGCLFWICFRSYNNTEDAMN 573

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/582 (65%), Positives = 455/582 (78%), Gaps = 6/582 (1%)

Query: 10  DEK-NAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGE-DDDFEAPTE 67
           DEK   +   K  ++   +S++E  ++ D E ++L    +++ ++F   E ++ +E PT+
Sbjct: 20  DEKIEEITTTKKETNATTSSTEE--KLHDVETYNLSNSANDSTNDFDDDEMEEGYEEPTD 77

Query: 68  EELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQG 127
           EEL TL+ V G IPLRCWLI +VEL+ERFSYYGLSAPFQNYMQNGPND+PKG+L L S G
Sbjct: 78  EELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSG 137

Query: 128 ATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDX 187
           ATGLSYFFQFWCYVTPVFGG+V+DTYWGKYN+I VGT  Y+ GIFILFIT+IP + + + 
Sbjct: 138 ATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNA 197

Query: 188 XXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFM 247
                          TG IK+NLSVLIADQLP +KPRV I K GERVIEDPN+TLQNVFM
Sbjct: 198 SLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFM 257

Query: 248 FFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVI 307
            FY  IN+GS+SVMATTELE HKGFWAAYLLPFCFFW+AV +LVFGR  Y+K  +GD V+
Sbjct: 258 VFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVV 317

Query: 308 SKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCY 367
            KSFKV +I++KNK +  AAKPS++P++N+PW+D+FVDE+KR + ACKVFVFYP+YWV Y
Sbjct: 318 QKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQY 377

Query: 368 GTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIF 427
           G+M++ FVTQG TMELH +PNDFLQ FDSIALIIFIPIFE FVYPFIRR+TP+RPITKI 
Sbjct: 378 GSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKIT 437

Query: 428 FGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFASI 487
            GF VG  AM WAAVLQHFIY  GP YDHPL  DTPN IHVAWQIPAYVLIA SEIFASI
Sbjct: 438 IGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASI 497

Query: 488 TGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAG 547
           TGLEYAYSKAP SMKSF+MSIFLLTNAFGS +G ALS V+VDPKFVW + GLA +C + G
Sbjct: 498 TGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTG 557

Query: 548 WVFWFIYSGLNDEEEAMNALDY--EHDEFMYKHHSDDEEAAE 587
            +FW  + GLN  EE MNA+DY  E DE   +H S   +  E
Sbjct: 558 ILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHLSSGADDLE 599

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/582 (64%), Positives = 448/582 (76%), Gaps = 6/582 (1%)

Query: 5   FSKRNDEKNAVEV--QKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDD- 61
           F  R  EK+  +V  +K+   I + + ++  EI  +E      +  +    + +  D++ 
Sbjct: 2   FFHREHEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEEC 61

Query: 62  ---FEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPK 118
              +E PTEE+++TLRHV+G IPLRCWLIA+VEL+ERFSYYGLSAPFQNYM+NGPND P 
Sbjct: 62  EPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPA 121

Query: 119 GLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITS 178
           G+L L S GATGLSYFFQFWCYVTPVFGG+++DTYWGKYNTICVGT IY+ GIFILFITS
Sbjct: 122 GVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITS 181

Query: 179 IPGVTNSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDP 238
           IP + + D                TGMIK+NLSVLIADQLP +KPRV   K GERV+EDP
Sbjct: 182 IPSIASKDTSLGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDP 241

Query: 239 NLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYI 298
           N+TLQNVFM+FY  +NVGSLSV+ATTELE HK FWAA+LLPFCFFW+AV VLV GRNQY+
Sbjct: 242 NITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYV 301

Query: 299 KPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFV 358
           K    +K I KSFK+L+I+SKNKF+  +AKPS++P+KN+PW+DKFVDE  RAL ACKVF+
Sbjct: 302 KEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFL 361

Query: 359 FYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYT 418
           FYP+YWV YGTM++ FVTQG  MELH LPND  QA DS ALIIFIPI ERF+YPFIRR+T
Sbjct: 362 FYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFT 421

Query: 419 PLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLI 478
           P +PITKIFFGFM  +GAMVW+ VLQ FIY  GP+YDHPL+   PN IHV WQ+PAYVLI
Sbjct: 422 PFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLI 481

Query: 479 AISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTG 538
           A SEI ASITGLEYAYSKAP SMKSFIMS+FL +NA GS +G ALSPVSVDPKF W + G
Sbjct: 482 AFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGG 541

Query: 539 LACACFIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHS 580
           L  ACFI G +FW I+   ND EE MNA+DYE +E + +  S
Sbjct: 542 LGVACFIGGCIFWIIFRKYNDTEEEMNAMDYEDEEDLREMES 583

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/611 (62%), Positives = 457/611 (74%), Gaps = 22/611 (3%)

Query: 7   KRNDEKNAVEVQK----DVSSID--DNSSKEVYEIEDQ-EIHHLDRDKSNAESNFALGED 59
           K+N    + E +     DV++ID  DN+   V  +    +I ++       +  F   ++
Sbjct: 5   KKNKSTESFETENEQVNDVTTIDVTDNNQNVVQMVNGGGDIDYIPTQDEKRDQKFETFQE 64

Query: 60  DDFEAPTEEE-------------LKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQ 106
           D      E E             L+TL+HV G IPLRCWL+A++EL+ERFSYYGLSAPFQ
Sbjct: 65  DSSIINDENEVITEDFEEPTEEELRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQ 124

Query: 107 NYMQNGPNDNPKGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFI 166
           NYMQNGPND+P G L L S GATGLSYFFQFWCY+TPVF G+++DTYWGK+ TIC+GT I
Sbjct: 125 NYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGI 184

Query: 167 YVCGIFILFITSIPGVTNSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVV 226
           Y+ GIFILFITS+P +T+ +                TGMIK+NLSV+IA+Q+P +K RV+
Sbjct: 185 YIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVI 244

Query: 227 ITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVA 286
             K G RVIEDP++T+QNVFM FYF IN+GSLSV+ATTELE HKGFWAAYLLPFCFFWVA
Sbjct: 245 TKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVA 304

Query: 287 VAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDE 346
           V VL+ G   YIK PVGDKVISK FKVL IL +N+FN ++AKP+FNPDKN+PWSDKFVDE
Sbjct: 305 VIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDE 364

Query: 347 IKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIF 406
           I RALQACKVFVFYP+YWVCYG MLNNFV+QGGTMELH LPNDF QA DSIALI+FIPI 
Sbjct: 365 IMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPIC 424

Query: 407 ERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDT-PNH 465
           ERFVYPFIR+YTP +PITKIF+GF  G+ +M WA VLQHFIY   P YDHP   D  PNH
Sbjct: 425 ERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNH 484

Query: 466 IHVAWQIPAYVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSP 525
           IHVA Q+PAY L+A+SEIFASITGLEYAYSKAP SMK+FIMSIFL+TNAFG+AIGCALSP
Sbjct: 485 IHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSP 544

Query: 526 VSVDPKFVWFYTGLACACFIAGWVFWFIYSGLNDEEEAMNALDYEH-DEFMYKHHSDDEE 584
           VS DPK+VW Y GLA ACF+ G +FW I+   ND EE +N LD+E  D+ +   H+ D E
Sbjct: 545 VSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIE 604

Query: 585 AAEHVRSIKSE 595
             + + S +S 
Sbjct: 605 MIQPISSRRSS 615

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/540 (69%), Positives = 439/540 (81%), Gaps = 2/540 (0%)

Query: 35  IEDQEIHHLDRDKSNAESNFALGEDDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSE 94
           IED+ +  +       E +F   E  + + PTEEEL++LRHV GHIP RCWLIAIVELSE
Sbjct: 18  IEDKSLE-VSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGGHIPFRCWLIAIVELSE 76

Query: 95  RFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYW 154
           RFSYYGLSAPFQNYMQNG +DNP G+L LKSQGATGL+YFFQFWCYVTPVFGGW++DTYW
Sbjct: 77  RFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYW 136

Query: 155 GKYNTICVGTFIYVCGIFILFITSIPGVTNSDXXXXXXXXXXXXXXXXTGMIKSNLSVLI 214
           GKY TICVGT +YV GIFILFITS+P V + +                TGMIK+NLSVLI
Sbjct: 137 GKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANLSVLI 196

Query: 215 ADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWA 274
           ADQ P +KPR+  TK+GERVIEDPN+T+QNVFMFFY  IN+GSLSV+ATTELE HKGFWA
Sbjct: 197 ADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFWA 256

Query: 275 AYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPD 334
           AYLLPFCFFW+AV VL  GR  Y++PPVGDKVI+KSF+VL  L K++F+ EA KPS +P+
Sbjct: 257 AYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHPE 316

Query: 335 KNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAF 394
           +++PW+D FV+EIKRAL+ACKVF+FYP+YWV YG M + FV+ GG M+LH LPNDF QA 
Sbjct: 317 RDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAI 376

Query: 395 DSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWY 454
           DSIALI+FIPI E ++YPFIRRYTP +PITKIFFGFM  S +M+WAAVLQHFIY  GP Y
Sbjct: 377 DSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCY 436

Query: 455 DHPLD-HDTPNHIHVAWQIPAYVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTN 513
           DHP+D  + PN+IH+ WQ+PAYVLIA SEIFASITGLEYAYSKAP SMKSFIMSIFLLTN
Sbjct: 437 DHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTN 496

Query: 514 AFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLNDEEEAMNALDYEHDE 573
           AFGSAIGCALSPV  DPK++W +TGLA A FI+G +FW  +  LND EE MNA+DYE ++
Sbjct: 497 AFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYEENQ 556

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/592 (62%), Positives = 453/592 (76%), Gaps = 25/592 (4%)

Query: 26  DNSSKEVYEIEDQEIHHLDRDKSNAE-SNFALGEDDD-------FEAPTEEELKTLRHVA 77
           D+S    + I+D+    ++ D +  E   FA+ ++ D       +  PTEEE+ TL+HVA
Sbjct: 33  DSSHDVTFNIDDK----VENDTNEEELDEFAVDDEADPYNDEWGYVEPTEEEMATLKHVA 88

Query: 78  GHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSYFFQF 137
           GHIP RCWLIA+VELSERFSYYGLSAPFQNYM NGPND PKG+L L + GATGLSYFFQF
Sbjct: 89  GHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLSYFFQF 148

Query: 138 WCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDXXXXXXXXXXX 197
           WCY+TP+FGG+++DTYW KYNTI VGT IY+ GIFILFIT+IP +   +           
Sbjct: 149 WCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGFVTAII 208

Query: 198 XXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGS 257
                TGMIK+NLSVL+A+Q+P +K RV+ TKKGERVIEDP++T+QNVFMFFY  IN+G+
Sbjct: 209 LIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLMINIGA 268

Query: 258 LSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYIL 317
           LSV+ATTELE HKGFWAAYLLPFCFFW+AV +LV GRN YI  PVGDKVISK FKV +I+
Sbjct: 269 LSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFKVTFIV 328

Query: 318 SKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQ 377
            KNKFN ++AKPS NP+  +PWSDKFVDEI R+++ACKVF+FYP+YW  YG M+NNF+TQ
Sbjct: 329 CKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMINNFITQ 388

Query: 378 GGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAM 437
            GTMELHN+PNDFLQ FDSI +I+FIPIFERFVYP IRR+TPL+PITKIF GFM GS AM
Sbjct: 389 AGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMCGSCAM 448

Query: 438 VWAAVLQHFIYTKGPWYDHPLD-----HDTPNHIHVAWQIPAYVLIAISEIFASITGLEY 492
           VWAAVLQ FIY  GP YDHP+       + PN +HVAWQIPAYV+IA SEIFAS+TGLE+
Sbjct: 449 VWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASVTGLEF 508

Query: 493 AYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWF 552
           AYS AP+SMK+FIMSIFL TNA G+A+G A+SP SVDPK+ W +TGLA +CF+AG +FW 
Sbjct: 509 AYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAGCLFWI 568

Query: 553 IYSGLNDEEEAMNALDYEHDEFMYKHHSDDEEAA-------EHVRSIKSEKS 597
            +   ND +  M A+D+  D+ M     D E+ A       E + S++S KS
Sbjct: 569 CFHHYNDIDADMKAIDFVEDD-MINASGDVEKTASSGFSTVEPIISMRSAKS 619

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/590 (64%), Positives = 460/590 (77%), Gaps = 15/590 (2%)

Query: 13  NAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKS-NAESNFALGEDDDFEAPTEEELK 71
           N  E +  V+S  +NS +++   E   +  LD+++  NA+S       D    PT+EE+K
Sbjct: 9   NKTETEVVVTSSPENSVEKIARPESF-VDVLDKNQYINADS-------DHGREPTDEEMK 60

Query: 72  TLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGL 131
           TLRHV+  IP+RCWL+A+VEL+ERFSYYGLSAPFQNYMQNGPND PKG+L LK+QGAT L
Sbjct: 61  TLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATAL 120

Query: 132 SYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDXXXXX 191
           SYFFQFWCYV+P+ GG+V+DTYWGKY TICVGT IYV GIFILFITS+P +T        
Sbjct: 121 SYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGG 180

Query: 192 XXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYF 251
                      TGMIK+N+SVLIADQ+P  +P V + K GERVIEDPN+T+QN+FMFFY 
Sbjct: 181 FITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYL 240

Query: 252 TINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSF 311
            IN+GSLSV+ATTE+E H GFWAAYLLPFCFF+VAV VL+ GRNQY+K PVGDKVISKSF
Sbjct: 241 MINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSF 300

Query: 312 KVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTML 371
           KV +I+ +NKF  +AA+PS NP+  +PWSDKF+DEIKRA+ ACKVFVFYP+YWVCYG ML
Sbjct: 301 KVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQML 360

Query: 372 NNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFM 431
           +NFV+Q G MELH LPNDFLQA DSIALI+FIPI ERF+YPFIRR+TP RPITKIF+GF+
Sbjct: 361 SNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFI 420

Query: 432 VGSGAMVWAAVLQHFIYTKGPWYDHPLD-----HDTPNHIHVAWQIPAYVLIAISEIFAS 486
            G+ AM WAAVLQHFIY  GP Y +P+       +TPN IH+AWQ+PAYVLIA SEIFAS
Sbjct: 421 FGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFAS 480

Query: 487 ITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIA 546
           ITGLEYAYSKAP SM+SFIMSIFLLT AFGSA+G ALS VSV+PKFVW ++GLA +CFIA
Sbjct: 481 ITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIA 540

Query: 547 GWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDDEEAAEHVRSIKSEK 596
           G +FW  +   ND EEAMNA+DYE D+ +  +        E + S+ S+K
Sbjct: 541 GCLFWAFFHKYNDTEEAMNAIDYEEDDVL-NYGVSIHYDLEPIASVNSDK 589

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/511 (69%), Positives = 420/511 (82%), Gaps = 5/511 (0%)

Query: 64  APTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGL 123
           APTEEELKTLRHV+G+IPLRCWLIAIVEL+ERFSYYGLSAPFQNYM NGPND PKGLL L
Sbjct: 56  APTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQL 115

Query: 124 KSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVT 183
            S GAT +SYFFQFWCYVTP+FGG+++DT+WGKYNTIC GT IYV GIFILF+TSI  +T
Sbjct: 116 NSSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESIT 175

Query: 184 NSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQ 243
             +                TGMIKSN+SVLIA+Q+P +K RV+ T KGERVIEDP LT+Q
Sbjct: 176 TQNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQ 235

Query: 244 NVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVG 303
           N+FMFFY  IN+GSLSV+ATTELE HKGFWAAYLLPFCFFW+AV VL+ G+ QY++ PVG
Sbjct: 236 NIFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVG 295

Query: 304 DKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVY 363
           DKVISK F + +I  KNK + ++AKPS +P+ N+PW+DKFV+E++RA++ACKVF+FYP+Y
Sbjct: 296 DKVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIY 355

Query: 364 WVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPI 423
           W  YG MLNNFVTQ GTMELH LPNDFLQA DSIA+I+FIPI E+F+YPFIR++TP R I
Sbjct: 356 WCVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSI 415

Query: 424 TKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLD-----HDTPNHIHVAWQIPAYVLI 478
           TKIF+GFM GS AM+WAAVLQ FIY  GP +D PL        TPN +H+AWQ+PAYVLI
Sbjct: 416 TKIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLI 475

Query: 479 AISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTG 538
           A SEIFASITGLEYAYS APESMKSFIMSIFLLT AFGSA+G A+SP SVDPKF W +TG
Sbjct: 476 AFSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTG 535

Query: 539 LACACFIAGWVFWFIYSGLNDEEEAMNALDY 569
           LA +CFIAG +FW  +   N+ E++M+ +D+
Sbjct: 536 LAVSCFIAGCLFWICFRKYNNTEDSMDEIDF 566

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/574 (64%), Positives = 441/574 (76%), Gaps = 7/574 (1%)

Query: 25  DDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDD----FEAPTEEELKTLRHVAGHI 80
           DD +   + E E   I     + ++ E N+    DDD    F  PTEEE++TL+ V G+I
Sbjct: 27  DDKNYNFITEDEPNSIASTIIEGNSNEENYNRSTDDDDDEDFIEPTEEEMRTLKRVGGYI 86

Query: 81  PLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSYFFQFWCY 140
           P RCWL+A++ELSERFSYYGLSAPFQNYMQNGP D P G L L +QGATGLSYFFQFWCY
Sbjct: 87  PARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLNTQGATGLSYFFQFWCY 146

Query: 141 VTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDXXXXXXXXXXXXXX 200
           +TP+FGG+++DTYWGKYNTI VG   Y+CGIFILF+TS+P +T+                
Sbjct: 147 ITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTSYSAAMGGFIVSIIIIG 206

Query: 201 XXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSV 260
             TGMIK+NLSV+IA+Q+P +K R++  K G RVIEDP++TLQNVFM FYF INVGSLSV
Sbjct: 207 LGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQNVFMAFYFMINVGSLSV 266

Query: 261 MATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKN 320
           MATTELE  KGFWAAYLLPFCFFWVAV VL+ G  ++IK P+GDK ISKSFKV+ IL KN
Sbjct: 267 MATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGDKTISKSFKVVGILIKN 326

Query: 321 KFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGT 380
           KFN E+AKPS +P+ N+PW+DKFV+EI+RA++AC VF FYP+YWVCYG MLNNFVTQGG 
Sbjct: 327 KFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYWVCYGQMLNNFVTQGGQ 386

Query: 381 MELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWA 440
           MELH+LPNDFLQ  DSIALI+FIPI ER +YPF+RR+TPLRPITKI  GF  GS +MVWA
Sbjct: 387 MELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPITKITIGFFFGSFSMVWA 446

Query: 441 AVLQHFIYTKGPWYDHPLD-HDTPNHIHVAWQIPAYVLIAISEIFASITGLEYAYSKAPE 499
           AVLQ F+Y K P Y HP +  + PNHIHV WQ+PAY LIA+SEIFASITGLEYAYSKAP 
Sbjct: 447 AVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEIFASITGLEYAYSKAPA 506

Query: 500 SMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLND 559
           SMKSFIMSIFL T A GSA+G ALSPVS+DPKF W Y GLA +CFIAG  FW  +S  ND
Sbjct: 507 SMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSCFIAGIAFWLCFSRYND 566

Query: 560 EEEAMNALDYEHD--EFMYKHHSDDEEAAEHVRS 591
           EE+ +N +D + D  +   ++ +DD EA   +RS
Sbjct: 567 EEDELNNIDDQPDVIQISSENENDDLEAKNSIRS 600

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/534 (68%), Positives = 432/534 (80%), Gaps = 2/534 (0%)

Query: 65  PTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLK 124
           PTEEELKTL   AGHIP  CWL+AI+EL+ERFSYYGLSAPFQNYMQN P+DNP G L L 
Sbjct: 67  PTEEELKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLN 126

Query: 125 SQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTN 184
           S GATGLSYFFQFWCYVTP+F G+++DTYWGK+NT+C+GT IY+ GIFILFITS+P +T+
Sbjct: 127 STGATGLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITS 186

Query: 185 SDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKK-GERVIEDPNLTLQ 243
            +                TGMIK+NLSV+IADQLP KK RVV  KK G+RVIEDP LT+Q
Sbjct: 187 YNTALGGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQ 246

Query: 244 NVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVG 303
           NVFM FYF INVGSLSV+ATTELE H GFWAAYLLPFCFFW+AV VL FG  +++K P+G
Sbjct: 247 NVFMAFYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIG 306

Query: 304 DKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVY 363
           D+VISK F ++ IL KN FN + AKP++NP+KN+PWSDKFVDEI+R+L+ACKVF+FYP+Y
Sbjct: 307 DRVISKCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIY 366

Query: 364 WVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPI 423
           WVCYG MLNNFVTQG TM+LH LPNDF QA +SIALI+FIPI E+FVYPFIR++TPL+PI
Sbjct: 367 WVCYGQMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPI 426

Query: 424 TKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLD-HDTPNHIHVAWQIPAYVLIAISE 482
           TK+  GF+ GS AMVWAAVLQHFIY  GP YDHP+   + PNH+HVAWQ+PAY LI++SE
Sbjct: 427 TKVTIGFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSE 486

Query: 483 IFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACA 542
           IFASITGLE AYSKAPESMKSFIMS+FL+TNAFG+AIGCALS VS DPK+VW YTGLA  
Sbjct: 487 IFASITGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVT 546

Query: 543 CFIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDDEEAAEHVRSIKSEK 596
           CF AG  FWF +   NDEE+AMN +D+E D    K+     E  E  ++  ++K
Sbjct: 547 CFCAGIAFWFTFKHYNDEEDAMNNIDFESDNENEKNEYSQIENLELSQTKTTDK 600

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/581 (60%), Positives = 433/581 (74%), Gaps = 16/581 (2%)

Query: 11  EKNAVEVQKDVSSIDDNSSK--EVYEIEDQEIHHLDRDKSNAESNFALGEDDDFEAPTEE 68
           EKN +E++    S  D   K  E Y ++D  I     D           +++ +E PT++
Sbjct: 19  EKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDY----------QEEGYEIPTQD 68

Query: 69  ELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGA 128
           E+KTLR V G IP RC+L+A+VEL+ERFSYYGLSAPFQNYMQNGP D+P G+L L S GA
Sbjct: 69  EMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGA 128

Query: 129 TGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDXX 188
           TGLSYFFQFWCY+TP+FGG+++DT WG+YNTI VGT IY+ GIFILFITS   V   D  
Sbjct: 129 TGLSYFFQFWCYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGA 188

Query: 189 XXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMF 248
                         TG+IKSNLSVLIADQ+P K+PRV   K GERVIED ++T+QNVFMF
Sbjct: 189 LAGFILALILIGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMF 248

Query: 249 FYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVIS 308
           FY  IN+GSLSV+ATTELE + GFWAAYLLPFCFFW+AV V+V G+ QYI  P GD+VI+
Sbjct: 249 FYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIA 308

Query: 309 KSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYG 368
           KSFKV +IL KNKF+  +AKPS++P+  FPW DKFVDEI+RAL ACKVF+FYP+YW CYG
Sbjct: 309 KSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYG 368

Query: 369 TMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFF 428
            M+NNF+T G  M+LH LPND  QA +SI+LIIFIPI E+F+YPFIRR+TPLRP+T+IF 
Sbjct: 369 QMVNNFITMGSMMQLHGLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFC 428

Query: 429 GFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFASIT 488
           GF+  + AMVW+ VLQHFIY+ GP Y+ PL+    N IHV WQ+PAYV IA SEIFASIT
Sbjct: 429 GFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASIT 487

Query: 489 GLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGW 548
           GLEYAYSKAP +MKSFIM++FL  NAFGSAIGCALSPVS DP + W Y  LA ACF++G 
Sbjct: 488 GLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGL 547

Query: 549 VFWFIYSGLNDEEEAMNALDY---EHDEFMYKHHSDDEEAA 586
           +FW  +   N  E+ MNALD+   E DE + +   D++ A+
Sbjct: 548 IFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVAS 588

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/565 (62%), Positives = 430/565 (76%), Gaps = 14/565 (2%)

Query: 18  QKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDD----FEAPTEEELKTL 73
           +K      +N+  +VY  +D   HH   DK +     A+ EDD+       PTEEEL TL
Sbjct: 51  EKKDEKFKNNTDIKVYISKD---HHASSDKIDFIG--AVDEDDNQNENGREPTEEELSTL 105

Query: 74  RHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSY 133
           RHV+  IP  CWLIAIVEL+ERFSYYGLSAPFQNYMQNGPND PKG+L LKSQGAT LSY
Sbjct: 106 RHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSY 165

Query: 134 FFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDXXXXXXX 193
           FFQFWCYVTP+ GG+++DT+WGKYNTICVG   YV GI ILF+T+IP + + +       
Sbjct: 166 FFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFI 225

Query: 194 XXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTI 253
                    TG IK+NLSVLIADQ+P  +PR+ + K GE+VIEDPN+T+QNVFMFFY  I
Sbjct: 226 VSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMI 285

Query: 254 NVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKV 313
           N+GSLSVMATT LE   GFWAAYLL FCFFWV + VLVFGR +Y++ P+GD VI++ FK+
Sbjct: 286 NIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKI 345

Query: 314 LYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNN 373
            +I   N FN   A PS NP+K +PW+D F+DEI+RA +ACKVF FYP+YWV YG MLNN
Sbjct: 346 CWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNN 405

Query: 374 FVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVG 433
           FVTQ GTMELH LPNDFLQA +SIALI+FIPI E+F+YPFIRR+TP RP+TKIF GF  G
Sbjct: 406 FVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFG 465

Query: 434 SGAMVWAAVLQHFIYTKGPWYDHPLD-----HDTPNHIHVAWQIPAYVLIAISEIFASIT 488
           S AMV+AAVLQHFIY  GP YD P+       +TPN +H+ WQ+PAYVLI++SEIFASIT
Sbjct: 466 SSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASIT 525

Query: 489 GLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGW 548
           GLEYAYSKAP +MK+FIMSIFL+TNA GSA+G ALSP + +PK+VW ++GLA ACFIAG 
Sbjct: 526 GLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGC 585

Query: 549 VFWFIYSGLNDEEEAMNALDYEHDE 573
           +FW  +   N +EEA+NALDY+ +E
Sbjct: 586 LFWLCFHHYNKDEEALNALDYKTEE 610

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/594 (60%), Positives = 430/594 (72%), Gaps = 10/594 (1%)

Query: 4   RFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDDFE 63
           + S   DEKN ++++K   S +D       +I D E + L  D +  +      +++ +E
Sbjct: 12  KLSVITDEKNNIDLKKTTVSSED-------QILDTESYKLQND-NEFDPEHPDYQEEGYE 63

Query: 64  APTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGL 123
            PTEEEL+TLRHV+G IP RC+LIA+VELSERFSYYGLSAPFQNYM N P+D+P G+L L
Sbjct: 64  MPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQL 123

Query: 124 KSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVT 183
            S GATGLSYFFQFWCY+TPV GG+++DT WG+YNTI VGT IY+ GIF+LFITS   + 
Sbjct: 124 NSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIA 183

Query: 184 NSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQ 243
             +                TG IK+NLSVLIADQ+P K+PRV   K GERVIED ++T+Q
Sbjct: 184 GKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQ 243

Query: 244 NVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVG 303
           NVFMFFY  IN+GSLSV+ATTELE H GFWAAYLLPFCFFW+AV VLV GR  Y   P  
Sbjct: 244 NVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTS 303

Query: 304 DKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVY 363
           D+VI KSFK  + L+KNKFN  A  P+ NP+  F W DKFV+EI+ AL ACKVF+FYP+Y
Sbjct: 304 DRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIY 363

Query: 364 WVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPI 423
           W CYG M NNFVT G  ++LH LPND  QA DSIALI+FIPI E+F YPFIRR+TP RPI
Sbjct: 364 WTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPI 423

Query: 424 TKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEI 483
           TKI +GF + S +MVWA VLQ+FIY  GP Y HPL  D PN++HVAWQ+PAYVLIA SEI
Sbjct: 424 TKITYGFWLASASMVWACVLQYFIYKTGPNYKHPL-ADGPNNVHVAWQVPAYVLIAFSEI 482

Query: 484 FASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACAC 543
           FASITGLEYAYSKAP SMKSFIM++FL  NAFGSAIGCALSPVS DP + W Y GLA   
Sbjct: 483 FASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTA 542

Query: 544 FIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDDEEAAEHVRSIKSEKS 597
           FI G  FWF +   ND E+ MNAL+YE DE +   ++ D E    + +  S KS
Sbjct: 543 FITGCAFWFCFRHYNDIEDEMNALNYE-DEDIITENNQDIEMVHPLSAYTSPKS 595

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/395 (72%), Positives = 333/395 (84%), Gaps = 5/395 (1%)

Query: 205 MIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVMATT 264
           MIK+NLSVLIADQLP +KP + + K GERV+ DPN+TLQNVFMFFYF INVGSLS+MATT
Sbjct: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60

Query: 265 ELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKNKFNA 324
           ELEYHKGFWAAYLLPFCFFW+AV  L+ G+ QYI+ P+GDKVI+KSF+V +IL+KNKF+ 
Sbjct: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120

Query: 325 EAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELH 384
            AAKPS +P++++PW+DKFVDEIKRAL ACKVF+FYP+YW  YGTM+++F+TQ   MELH
Sbjct: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180

Query: 385 NLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWAAVLQ 444
            +PNDFLQAFDSIALIIFIPIFE+F+YPFIRRYTP +PITKIFFGFM GS AM WAAVLQ
Sbjct: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240

Query: 445 HFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFASITGLEYAYSKAPESMKSF 504
            FIY  GPWYD PL H+TPN +HV WQIPAYVLI+ SEIFASITGLEYAYSKAP SMKSF
Sbjct: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300

Query: 505 IMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLNDEEEAM 564
           IMSIFLLT AFGSAIGCALSPV+VDPKF W +TGLA ACFI+G +FWF +   ND EE M
Sbjct: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEM 360

Query: 565 NALDY-EHDEF----MYKHHSDDEEAAEHVRSIKS 594
           NA+DY E DEF    +    ++D E  E + S++S
Sbjct: 361 NAMDYEEEDEFDLNPISAPKANDIEILEPMESLRS 395

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  251 bits (640), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 175/612 (28%), Positives = 283/612 (46%), Gaps = 53/612 (8%)

Query: 26  DNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDDFEAPTEEELKTLRHVAGHIPLRCW 85
            +  K  Y + + + H  D D+ + ++         F  PTE E   LR V GH     +
Sbjct: 2   SSEKKNQYAVAEIDGHSEDFDELDTQT---------FPEPTERERSELRRVLGHPKWYVY 52

Query: 86  LIAIVELSERFSYYGLSAPFQNYMQN-------------GPNDNPKGLLGLKSQGATGLS 132
            I ++E SER SYYG      N++Q                ++   G LG+  Q AT L+
Sbjct: 53  FICLIEFSERASYYGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATALN 112

Query: 133 YFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVT-NSDXXXXX 191
               F  Y  P+  G+V+D YWG+   + +G F+ +    +  I S+P V  +       
Sbjct: 113 LLLTFLAYCFPLITGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAP 172

Query: 192 XXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYF 251
                      T  +K  L   +  Q P+    V     GERVI D + +LQ + M FY+
Sbjct: 173 CIIGIITLAIATAFVKPILLPTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYW 232

Query: 252 TINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIK--PPVGDKVISK 309
           +INVGS   +AT+      G+W A+L+P   F +  AVL+  R +YIK  PP G  +I+ 
Sbjct: 233 SINVGSFLSVATSYSARDVGYWLAFLIPLALFMIMPAVLLVLR-RYIKDEPPSGRSLIAD 291

Query: 310 SFKVLYILSK----NKFNA----EAAKPS---------FNPDKNFPWSDKFVDEIKRALQ 352
             KVL +  +    +++ A    + AKPS         +   K   + +  V + +  + 
Sbjct: 292 CLKVLKVCFERNWWSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFYPESLVQDARVTIS 351

Query: 353 ACKVFVFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYP 412
           AC +F++Y +Y +  G + +   +Q  ++    +PND +  F+ + +I+F+PI +R VYP
Sbjct: 352 ACTIFLYYVIYNINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYP 411

Query: 413 FIRRYT-PLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQ 471
            +R+     RP+ +IF GFMV + A    A++QH IY   P  ++  + +        W 
Sbjct: 412 LLRKLRWNFRPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISMWV 471

Query: 472 IP-AYVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDP 530
           +   Y L   SE  A  TG E A+ ++P  MK+F+M++FL  +A  +A+G  ++P  VDP
Sbjct: 472 VAIEYALTGFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDP 531

Query: 531 KFV---WFYTGLACA-CFIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHS----DD 582
             V       GL  A  F   W +W ++  +  E     AL  + +  +    S     D
Sbjct: 532 HLVIPFGVLAGLGAAVAFAFLWRYWNLHHVMEQERIEREALAKQEEPALNTIRSYISGAD 591

Query: 583 EEAAEHVRSIKS 594
               EHV S+ S
Sbjct: 592 LGDEEHVLSVTS 603

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  236 bits (602), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 165/617 (26%), Positives = 274/617 (44%), Gaps = 55/617 (8%)

Query: 30  KEVYEIEDQEIHHLDRDKSNAESNFALGEDDDFEAPTEEELKTLRHVAGHIPLRCWLIAI 89
           +++  +E  ++  L+ D  +   +   G       PTE E  TLR V  H     + I +
Sbjct: 5   EKLSSVEKSQVAVLETDTYSEGGS---GTPLSLPEPTEHERTTLRRVLEHPKWYVYFICL 61

Query: 90  VELSERFSYYGLSAPFQNYMQN----------------GPNDNPKGLLGLKSQGATGLSY 133
           +E SER SYYG      N++Q                   +    G LG+  Q AT L+ 
Sbjct: 62  IEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDSATAGALGMGLQTATALNL 121

Query: 134 FFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVT-NSDXXXXXX 192
              F  Y  P+  G+++D YW +   + +G F+ +    I  I ++P V  N        
Sbjct: 122 LLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFIIGALPPVLGNGQAALAPC 181

Query: 193 XXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFT 252
                     T  +K  L   +  Q P++   V     GERV+ D + +LQ + M FY++
Sbjct: 182 VIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERVLVDRDASLQRMTMTFYWS 241

Query: 253 INVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAV-LVFGRNQYIKPPVGDKVISKSF 311
           IN+GS   +AT+      G+W A+L+P   + +  AV LV GR    +PP G  +++   
Sbjct: 242 INIGSFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLGRYLRDEPPSGRSMLADCC 301

Query: 312 KVLYILSK----NKFNA----EAAKPS-FNPDKNFPWSDK---------FVDEIKRALQA 353
           KVL +  +     ++ +      A+PS         W  K          V + +  L A
Sbjct: 302 KVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRAGWRRKGAGGFYAESLVQDTRVTLSA 361

Query: 354 CKVFVFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPF 413
             +F++Y +Y +  G + +   +Q  ++  + +PND +  F+ + +I+F+P+ +  +YP 
Sbjct: 362 SAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFNPLCIIVFMPVLDHVLYPV 421

Query: 414 IRRYT-PLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQI 472
           +R+     +P+ +IF GFM+ + A    A++Q  IY   P   +  + D        W +
Sbjct: 422 LRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCGRYATECDKGVSPVSMWVV 481

Query: 473 PA-YVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPK 531
              Y L  +SE  A  TG E A+ ++P  MKSF+M++FL T+A  +A+G  ++P  VDP 
Sbjct: 482 AVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTSALSAALGEIVTPSLVDPH 541

Query: 532 FVWFYTGLAC----ACFIAGWVFWFI----------YSGLNDEEEAMNALDYEHDEFMYK 577
            V  +  LA       F+  W +W +             L  EE AM A+          
Sbjct: 542 LVIPFGVLAGLGAFMAFVFLWRYWSLDKTMELERAERRALEAEEGAMPAITSVRSYVSGA 601

Query: 578 HHSDDEEAAEHVRSIKS 594
              D  E  EHV S+ S
Sbjct: 602 EDVDHPEGLEHVLSVTS 618

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  218 bits (555), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 151/527 (28%), Positives = 253/527 (48%), Gaps = 34/527 (6%)

Query: 71  KTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQ-----------NGPNDNPKG 119
           K LRHV        ++I ++EL+ER SYYG      N+ Q            GP+D   G
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 120 LLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSI 179
            LG   Q AT L+   +F  Y  P+  G+V+D Y G+   + +G +  V    I  I ++
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL 163

Query: 180 PGVT-NSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDP 238
           P V  +++                T  +K  L  ++  Q P++   V     GERVI + 
Sbjct: 164 PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNR 223

Query: 239 NLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYI 298
           + +LQ + M FY+ INVGS   +AT       G+W ++L+P   F +  A+L+  +N  +
Sbjct: 224 DASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKV 283

Query: 299 KPPVGDKVISKSFKVLYILSK----NKFNAEA----AKPS---------FNPDKNFPWSD 341
            PP+G+ + ++  KV+ +  +     ++ + +    AKPS         +   K   + +
Sbjct: 284 TPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKE 343

Query: 342 KFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALII 401
             V++ +  L AC +F++Y +Y +    + +    Q G+M    +PND +  F+ +A+II
Sbjct: 344 SLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIII 403

Query: 402 FIPIFERFVYPFIRRY-TPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLD- 459
            +PI +  + P +RR     +P+ +IFFGFM+   A V  A++Q  IY   P   H    
Sbjct: 404 TMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTC 463

Query: 460 HDTPNHIH--VAWQIPA-YVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFG 516
            +T   +     W +   YVL  +SE FA  TG E A+ ++P+ MK+F+MS+FL+T A  
Sbjct: 464 SETIRQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTALS 523

Query: 517 SAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLNDEEEA 563
           S +    + +  DP  V  +   A    +   +F + Y  L+   EA
Sbjct: 524 SILTQIFNGIMTDPYLVIPFILFAVLGTLFAILFLYRYWNLDKVMEA 570

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  216 bits (551), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 172/617 (27%), Positives = 279/617 (45%), Gaps = 56/617 (9%)

Query: 18  QKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDDFEAPTEEELKTLRHVA 77
           + DVS++   S+    +   QE+    +++S+ E             PTEEE +TLR + 
Sbjct: 11  ESDVSTLGSGSNAATVQEAPQEV----KERSDIEIGL----------PTEEEERTLRRIV 56

Query: 78  GHIPLRCWLIAIVELSERFSYYGLSAPFQNY----MQNGPN---------DNPKGLLGLK 124
            H     +LI  +EL+ER SYYG      NY    +  G N         +   G LG  
Sbjct: 57  VHPSWYVYLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGATAHGSEANSGALGKG 116

Query: 125 SQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGV-T 183
              AT L    +F  Y  P+  G++ D Y G   T+  G +  V    I  ++++P V  
Sbjct: 117 LATATSLGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTGVASHIIFILSALPVVLK 176

Query: 184 NSDXXXXXXXXXXXXXXXXTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQ 243
           + D                T  +K  L  L+  Q P++   V   + GERVI D + +LQ
Sbjct: 177 HPDAAMALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVKTLETGERVIIDRDASLQ 236

Query: 244 NVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIK--PP 301
            + M FY+ IN+G+   +AT+      GFW A+L+P   + +A+ V+      +IK   P
Sbjct: 237 RMTMTFYWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIY-MAMPVVFSLVQPHIKDRAP 295

Query: 302 VGDKVISKSFKVLYILSKNKFNAEA--------AKPSFNPD-------KNFP-WSDKFVD 345
            G  +++   KVLY+     +NA          A PS           K  P + +  V 
Sbjct: 296 SGYSLLADCMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGKVGWRKKSPFYKESLVQ 355

Query: 346 EIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPI 405
           + K  L AC +F +Y +Y +    +     +Q G+M  + +PND +  F+ +++I+ IPI
Sbjct: 356 DTKITLSACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSIIVLIPI 415

Query: 406 FERFVYPFIRRY-TPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPL---DHD 461
            +  +YP +RR     +P+ +IF GFM+   + V  A++Q  IY       H     +  
Sbjct: 416 LDYGLYPLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIYETSSCGYHATTCSEKG 475

Query: 462 TPNHIHVAWQIPA-YVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIG 520
                  +W +   Y L   SE  A  T  E AY ++PE MKSF++++FL T+A  +AI 
Sbjct: 476 LGVSPLSSWIVAVEYTLSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLFTSAVSAAIT 535

Query: 521 CALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHS 580
             ++P+  DP  +  +   A   FI+G  F + +  L+ E   M     E +       S
Sbjct: 536 QIVNPILKDPLLIVPFALFAGIGFISGCHFLWKFRNLDKE---MLQEKRERELLQESSES 592

Query: 581 DDEEAAEHVRSIKSEKS 597
           D+ E  E ++ +K  +S
Sbjct: 593 DELEVVE-IKDVKGSRS 608

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  188 bits (477), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 146/564 (25%), Positives = 257/564 (45%), Gaps = 48/564 (8%)

Query: 43  LDRDKSNAESNFA--------LGEDDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSE 94
           ++ +K  A+ NF         + E +  + PTE E  TLR +     +  + I ++E +E
Sbjct: 1   MNEEKETAKVNFVQDLEKEKYITETETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAE 60

Query: 95  RFSYYGLSAPFQNYMQ------------NGPNDNPKGLLGLKSQGATGLSYFFQFWCYVT 142
           R S+YG      N+ Q             GP +   G LG     AT +    +F  Y  
Sbjct: 61  RGSFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTF 120

Query: 143 PVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGV-TNSDXXXXXXXXXXXXXXX 201
            +  G++SD Y G+   + +G ++ V    +  I ++P V  +++               
Sbjct: 121 SIITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAALPSVLAHTNVAYALSVVALLSLSL 180

Query: 202 XTGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVM 261
            T  +K  L  L+  Q P K   V     GERVI D + +LQ + M FY+ INVG+   +
Sbjct: 181 CTSFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSL 240

Query: 262 ATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKP--PVGDKVISKSFKVLYILS- 318
           AT       G+W A+ +P   + + + ++++   + IK   P  + V+++S KVL +   
Sbjct: 241 ATAYSAQRVGYWLAFTVPLIIY-LLMPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYE 299

Query: 319 ----KNKFNAE---AAKPS---------FNPDKNFPWSDKFVDEIKRALQACKVFVFYPV 362
               K  ++ +    AKP+         +   K   + +K+V + K  + AC +F++Y +
Sbjct: 300 WGWIKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYVI 359

Query: 363 YWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRY-TPLR 421
           Y + +  +     +Q G+ME   +PND    F+ I++I+ +PI +  +YP +RRY    +
Sbjct: 360 YQM-HSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISIIVVMPILDYVLYPLLRRYRINFK 418

Query: 422 PITKIFFGFMVGSGAMVWAAVLQHFIYTKGPW-----YDHPLDHDTPNHIHVAWQIPAYV 476
           P+ +IF GFM+G       A++Q  +Y   P         P  H   + +        Y 
Sbjct: 419 PVYRIFCGFMIGCLGSTVGAIIQWRVYNTSPCGYMGATTCPELHHKKSPLSRWLVAIEYA 478

Query: 477 LIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFY 536
           L   SE  A  TG E A+ ++P+ MK F++++F+ T A  SAI   ++P   DP  +  +
Sbjct: 479 LGGTSECLAMTTGYEIAFERSPKKMKGFVLALFMFTVAISSAIILPITPFFKDPYLIQPF 538

Query: 537 TGLACACFIAGWVFWFIYSGLNDE 560
              A    +   +F + Y  L+ +
Sbjct: 539 AVCAGVGALTAIIFLWRYWDLDKQ 562

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 53/132 (40%), Gaps = 13/132 (9%)

Query: 46  DKSNAESNFALGEDDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPF 105
           D+  AE   A  E    EA  E +++      G+   R WL  +      F  +G +   
Sbjct: 43  DEDGAEEVLAADEKAATEATNELDVEEEYPDGGY---RAWLTVLGSFVGIFPIWGTANAL 99

Query: 106 QNYMQNGPNDNPKGLLGLKSQGATGLSYFFQF---WCYVTPVFGGWVSDTYWGKYNTICV 162
             Y     N        L S GA  +S+ F      C+V  VF G   D   G+   I V
Sbjct: 100 GAYEGYISNHQ------LASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQ-KAIIV 152

Query: 163 GTFIYVCGIFIL 174
           G+ +YV GIF++
Sbjct: 153 GSVLYVFGIFMM 164

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,424,918
Number of extensions: 3042751
Number of successful extensions: 11137
Number of sequences better than 10.0: 68
Number of HSP's gapped: 11476
Number of HSP's successfully gapped: 69
Length of query: 597
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 482
Effective length of database: 40,294,809
Effective search space: 19422097938
Effective search space used: 19422097938
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)