Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0F04829g3.501ON2022028001e-109
Smik_16.4063.501ON2122144351e-53
TDEL0D056903.501ON2012144288e-53
Skud_16.4483.501ON2082144106e-50
Suva_16.4823.501ON2352174119e-50
YPR154W (PIN3)3.501ON2152154054e-49
KAFR0G037403.501ON2342394004e-48
KNAG0A079903.501ON2211153412e-39
NDAI0B059203.501ON2351143404e-39
SAKL0F02486g3.501ON2301113387e-39
Kwal_47.189053.501ON2361093311e-37
TPHA0A057203.501ON2201153263e-37
Suva_7.4243.501ON2491083259e-37
KLTH0G02332g3.501ON2331093161e-35
ZYRO0D09702g3.501ON1581653074e-35
Smik_6.2323.501ON2411083127e-35
YGR136W (LSB1)3.501ON2411083111e-34
Kpol_480.83.501ON2391163083e-34
NCAS0F036003.501ON2371183074e-34
Skud_7.4473.501ON2381143004e-33
KNAG0B007503.501ON2171122847e-31
Ecym_12283.501ON2531082797e-30
AFR320W3.501ON2571152762e-29
TBLA0C045303.501ON2221112663e-28
KLLA0E03873g3.501ON2201062578e-27
ZYRO0G20372gsingletonON150532003e-19
TBLA0D029103.501ON2691171768e-15
Suva_15.1991.356ON4571001561e-11
Ecym_27471.356ON452831514e-11
Smik_7.3351.356ON460631515e-11
YFR024C-A (LSB3)1.356ON459631506e-11
Skud_8.681.356ON475641481e-10
KNAG0C046305.470ON516691481e-10
Suva_6.961.356ON455641481e-10
Smik_8.811.356ON468511462e-10
Skud_6.1081.356ON459641444e-10
KNAG0C020401.356ON464501435e-10
NCAS0A089901.356ON434621435e-10
YHR016C (YSC84)1.356ON468511435e-10
NDAI0G059601.356ON423731426e-10
AFR140C5.470ON388691427e-10
NDAI0A043505.470ON459691427e-10
CAGL0I08965g1.356ON437501418e-10
KAFR0C044001.356ON459501419e-10
ACR266W2.159ON626661411e-09
NCAS0B072501.356ON441501411e-09
TDEL0D022401.356ON433501401e-09
SAKL0D09702g1.356ON428501391e-09
SAKL0E02200g2.502ON511691382e-09
TPHA0C040202.502ON485561382e-09
KLLA0A08360g1.356ON423501373e-09
AEL017W1.356ON416501373e-09
TPHA0O012801.356ON454501364e-09
NDAI0B045801.356ON424581365e-09
TDEL0A027802.502ON451701357e-09
SAKL0G03454g5.470ON468711357e-09
TBLA0A025705.470ON493571348e-09
TBLA0F034901.356ON511501331e-08
KLTH0H12980g1.356ON399501331e-08
Skud_4.6615.470ON460551331e-08
TPHA0E015005.470ON457661321e-08
TDEL0A033405.470ON473651321e-08
Kwal_0.3711.356ON217501292e-08
KLTH0F15114g5.470ON435741312e-08
KLTH0E09790g2.159ON622721312e-08
CAGL0K02761g2.502ON450531302e-08
TBLA0B054702.502ON539561312e-08
CAGL0M01650g5.470ON466561302e-08
ZYRO0G00792g1.356ON469501303e-08
Kwal_55.212875.470ON461691293e-08
KLLA0B13475g2.502ON508561293e-08
KLLA0E03059g5.470ON428641294e-08
Smik_4.6585.470ON472551294e-08
YDR388W (RVS167)5.470ON482551284e-08
KAFR0E036405.470ON441561284e-08
KAFR0D033602.502ON455501285e-08
TBLA0D049501.356ON468501285e-08
YHL002W (HSE1)2.502ON452621285e-08
KAFR0A009701.356ON396501276e-08
Suva_8.512.502ON456501277e-08
NCAS0A119205.470ON463551277e-08
ZYRO0B01298g2.502ON411621268e-08
TPHA0B028902.159ON634721269e-08
TPHA0A022101.356ON397651251e-07
KLTH0D06138g2.502ON489541251e-07
Kpol_1008.251.356ON4491071242e-07
CAGL0A02145g1.356ON391561232e-07
ABR008C2.502ON443581232e-07
Kpol_1056.372.502ON501561232e-07
NCAS0A050802.502ON450501232e-07
Smik_8.472.502ON447531232e-07
Kwal_26.79022.502ON532581232e-07
Kpol_440.105.470ON470681223e-07
SAKL0E10780g2.159ON625761223e-07
ZYRO0D11110g5.470ON459571214e-07
Ecym_54262.159ON672561189e-07
Skud_8.432.502ON454501162e-06
Ecym_24402.502ON459501162e-06
KNAG0I015801.356ON581501153e-06
Ecym_23165.470ON421631143e-06
NDAI0K021302.502ON459561144e-06
Kpol_1072.562.159ON637561101e-05
TDEL0B052202.159ON613681101e-05
KNAG0A067102.502ON419541101e-05
Kwal_47.178942.159ON621691092e-05
Ecym_23082.591ON678561082e-05
SAKL0G17600g4.335ON441761073e-05
YLR191W (PEX13)7.365ON386711054e-05
Smik_8.1922.159ON633681046e-05
Ecym_25266.366ON524511011e-04
ZYRO0G10098g4.108ON1392601021e-04
YHR114W (BZZ1)2.159ON633761011e-04
NCAS0D047406.366ON594801002e-04
Ecym_11474.335ON42270993e-04
ABR082W2.591ON68355993e-04
NDAI0I002206.366ON61574993e-04
ZYRO0D17358g6.366ON66882993e-04
KLLA0F23848g2.159ON64948984e-04
KLLA0C12551g2.591ON607108984e-04
Skud_12.2567.365ON40371984e-04
KAFR0F007502.159ON60270984e-04
KAFR0J026506.366ON55350984e-04
Suva_10.2877.365ON39272975e-04
AER140C4.335ON41470975e-04
NCAS0B069802.159ON63968967e-04
Kpol_325.126.366ON57050968e-04
KLTH0B04818g7.365ON38063958e-04
Smik_12.2517.365ON38863958e-04
Skud_8.1752.159ON63357968e-04
CAGL0C03597g6.366ON58053950.001
TPHA0H023806.366ON52883940.001
TBLA0F002806.366ON57651940.001
TPHA0F031007.365ON38172930.001
KLTH0H09416g4.45ON152861940.002
SAKL0H24222g4.45ON152671930.002
Kwal_33.148357.365ON38463920.002
SAKL0A00594g6.366ON63650920.002
Smik_3.1866.366ON59163920.002
KLLA0E23365g8.539ON57551920.002
Skud_3.1606.366ON58653920.002
Kwal_47.169434.335ON46056920.002
AGR306C5.170ON92355910.003
KLLA0D09306g4.45ON153775910.003
KNAG0C029104.108ON124482910.003
TDEL0A078106.366ON55860910.003
Suva_3.1246.366ON60053910.003
YCR088W (ABP1)6.366ON59253910.003
CAGL0E02783g4.108ON120351910.004
Kwal_23.64376.366ON63151890.005
ZYRO0B16214g2.159ON65965890.006
TDEL0E055204.45ON158968890.006
TBLA0C055602.159ON67351890.007
TDEL0F023804.108ON125563880.007
KLTH0A07348g6.366ON62651880.008
KLLA0A04983g4.108ON125160880.008
Ecym_72314.108ON114692880.008
AGL237C6.366ON57850870.009
KAFR0L015807.365ON34475860.010
KNAG0I027006.366ON57550860.012
Suva_2.564singletonON4339770.013
SAKL0H10098g8.539ON55551860.013
Kpol_538.255.170ON70756860.015
Suva_2.1184.108ON116650860.016
SAKL0F11748g7.365ON40865840.023
YBL007C (SLA1)4.108ON124450840.026
Smik_2.1134.108ON123050840.028
TDEL0C018207.365ON38963830.030
NCAS0A059704.45ON132358830.035
YLL017WsingletonOFF10347780.036
TBLA0B096202.319ON94165830.037
CAGL0I02750g2.159ON61955830.037
Ecym_42288.344ON26152810.048
AEL241W8.539ON54951820.048
ACR230C7.365ON39861810.058
KLLA0F10175g6.366ON57650810.061
Kpol_534.62.319ON88664810.062
Ecym_47107.365ON39961800.062
ADL038W4.45ON150977810.066
AGR170C4.108ON112154810.070
TBLA0A076107.365ON41363800.077
CAGL0A04147g7.365ON39163790.081
Kpol_457.12singletonON56751790.097
KLLA0E09043g2.319ON81452790.11
Suva_10.4064.45ON158762790.12
ZYRO0B02706g7.365ON39663780.12
SAKL0H15048g8.344ON20750770.13
SAKL0E06820g2.319ON90552780.15
NDAI0B033302.319ON91970780.16
Skud_2.1044.108ON121450770.18
NCAS0A034904.108ON123564770.18
KLTH0G11682g8.344ON18750750.19
NDAI0A015007.413ON104764770.19
TPHA0G009302.319ON82459770.19
TBLA0D004507.413ON100554770.19
Kpol_1030.457.365ON38871760.20
TBLA0C041004.108ON130249770.21
TPHA0K016004.108ON113663770.22
CAGL0E01045g8.344ON21350750.23
Ecym_11678.539ON55051760.24
TDEL0G024902.319ON85063760.25
KLLA0E06953g7.419ON35752750.26
TBLA0H035908.539ON60054760.27
KLLA0E19735g7.365ON40869750.27
NCAS0D019505.170ON93951760.29
TBLA0A006108.539ON59744750.30
KLTH0E07744g4.108ON124963760.31
NCAS0A145707.419ON35553740.35
KAFR0L018807.413ON93049750.36
Kpol_2000.28.344ON22550730.41
KNAG0B025207.365ON31476740.41
Kpol_1025.404.108ON120260740.44
NDAI0A033304.108ON122663740.50
NCAS0C057104.45ON167664730.66
KLLA0F14575g5.170ON85161730.67
Suva_2.3268.344ON24050710.76
KNAG0D044504.268ON68652720.77
ZYRO0A02662g2.319ON88660720.85
NDAI0J008508.344ON24550710.90
Kwal_26.83232.591ON62762710.93
Skud_4.4208.344ON23350700.95
SAKL0B11176g2.591ON63362711.0
KAFR0A022902.591ON69086711.0
KAFR0I010404.108ON120359711.1
TDEL0B030708.539ON54148711.1
Ecym_33662.319ON90653711.1
Kpol_1024.458.539ON55454711.1
TDEL0B068402.591ON59684701.3
NCAS0E027907.365ON37979701.3
Ecym_82195.170ON102455701.3
AGL169C8.344ON25250691.3
CAGL0E03476g4.45ON156463711.3
KNAG0H035002.159ON63457701.3
Smik_13.2022.591ON66363701.4
Suva_10.584.45ON125956701.7
Suva_15.3102.159ON63453691.7
TBLA0H011608.344ON22450681.7
Scer_YGOB_SDC25 (SDC25)4.45ON125247691.8
Kwal_14.23134.45ON151765691.8
TBLA0I010807.413ON155548691.8
Skud_12.514.45ON125447691.9
CAGL0F05885g2.591ON71263691.9
KAFR0B058608.344ON24950682.1
NDAI0A014707.419ON36753682.2
TPHA0K007207.413ON101154692.2
SAKL0C00924g1.23ON81074682.3
ZYRO0F13882g8.344ON28850672.4
KLLA0D16874g8.344ON22751672.4
YDR162C (NBP2)8.344ON23650672.6
KAFR0K020007.419ON33288672.9
TPHA0K006807.419ON35552673.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F04829g
         (202 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   312   e-109
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   172   1e-53
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   169   8e-53
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   162   6e-50
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   162   9e-50
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   160   4e-49
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   158   4e-48
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   135   2e-39
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   135   4e-39
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   134   7e-39
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   132   1e-37
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   130   3e-37
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   129   9e-37
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   126   1e-35
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   122   4e-35
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   124   7e-35
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   124   1e-34
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   123   3e-34
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   122   4e-34
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   120   4e-33
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   114   7e-31
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   112   7e-30
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   110   2e-29
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   107   3e-28
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   103   8e-27
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    82   3e-19
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    72   8e-15
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    65   1e-11
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    63   4e-11
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    63   5e-11
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    62   6e-11
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    62   1e-10
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    62   1e-10
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    62   1e-10
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    61   2e-10
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    60   4e-10
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    60   5e-10
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    60   5e-10
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    60   5e-10
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    59   6e-10
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    59   7e-10
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    59   7e-10
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    59   8e-10
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    59   9e-10
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    59   1e-09
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    59   1e-09
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    59   1e-09
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    58   1e-09
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    58   2e-09
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    58   2e-09
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    57   3e-09
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    57   3e-09
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    57   4e-09
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    57   5e-09
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    57   7e-09
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    57   7e-09
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    56   8e-09
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    56   1e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    56   1e-08
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    56   1e-08
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    55   1e-08
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    55   1e-08
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    54   2e-08
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    55   2e-08
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    55   2e-08
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    55   2e-08
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    55   2e-08
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    55   2e-08
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    55   3e-08
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    54   3e-08
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    54   3e-08
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    54   4e-08
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    54   4e-08
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    54   4e-08
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    54   4e-08
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    54   5e-08
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    54   5e-08
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    54   5e-08
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    54   6e-08
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    54   7e-08
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    54   7e-08
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    53   8e-08
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    53   9e-08
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    53   1e-07
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    53   1e-07
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    52   2e-07
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    52   2e-07
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    52   2e-07
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    52   2e-07
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    52   2e-07
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    52   2e-07
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    52   2e-07
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    52   3e-07
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    52   3e-07
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    51   4e-07
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    50   9e-07
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    49   2e-06
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    49   2e-06
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    49   3e-06
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    49   3e-06
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    49   4e-06
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    47   1e-05
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    47   1e-05
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    47   1e-05
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    47   2e-05
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    46   2e-05
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    46   3e-05
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    45   4e-05
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    45   6e-05
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    44   1e-04
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    44   1e-04
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    44   1e-04
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    43   2e-04
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    43   3e-04
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    43   3e-04
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    43   3e-04
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    43   3e-04
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    42   4e-04
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    42   4e-04
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    42   4e-04
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    42   4e-04
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    42   4e-04
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    42   5e-04
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    42   5e-04
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    42   7e-04
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    42   8e-04
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    41   8e-04
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    41   8e-04
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    42   8e-04
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    41   0.001
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    41   0.001
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    41   0.001
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    40   0.001
KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} simil...    41   0.002
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    40   0.002
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    40   0.002
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    40   0.002
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    40   0.002
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    40   0.002
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    40   0.002
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    40   0.002
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    40   0.003
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    40   0.003
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    40   0.003
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    40   0.003
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    40   0.003
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    40   0.003
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    40   0.004
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    39   0.005
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    39   0.006
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    39   0.006
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    39   0.007
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    39   0.007
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    39   0.008
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    39   0.008
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    39   0.008
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    38   0.009
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    38   0.010
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    38   0.012
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    34   0.013
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    38   0.013
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    38   0.015
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    38   0.016
SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {...    37   0.023
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    37   0.026
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    37   0.028
TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.3...    37   0.030
NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]...    37   0.035
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    35   0.036
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    37   0.037
CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {...    37   0.037
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    36   0.048
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    36   0.048
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    36   0.058
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    36   0.061
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    36   0.062
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    35   0.062
ADL038W Chr4 (623309..627838) [4530 bp, 1509 aa] {ON} Syntenic h...    36   0.066
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    36   0.070
TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa] ...    35   0.077
CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {...    35   0.081
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    35   0.097
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    35   0.11 
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    35   0.12 
ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {...    35   0.12 
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    34   0.13 
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    35   0.15 
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    35   0.16 
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    34   0.18 
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    34   0.18 
KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly ...    33   0.19 
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    34   0.19 
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    34   0.19 
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    34   0.19 
Kpol_1030.45 s1030 (102192..103358) [1167 bp, 388 aa] {ON} (1021...    34   0.20 
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    34   0.21 
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    34   0.22 
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    33   0.23 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    34   0.24 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    34   0.25 
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    33   0.26 
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    34   0.27 
KLLA0E19735g Chr5 complement(1756682..1757908) [1227 bp, 408 aa]...    33   0.27 
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     34   0.29 
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    33   0.30 
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    34   0.31 
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    33   0.35 
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    33   0.36 
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    33   0.41 
KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.36...    33   0.41 
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    33   0.44 
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    33   0.50 
NCAS0C05710 Chr3 complement(1170253..1175283) [5031 bp, 1676 aa]...    33   0.66 
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    33   0.67 
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    32   0.76 
KNAG0D04450 Chr4 (805173..807233) [2061 bp, 686 aa] {ON} Anc_4.2...    32   0.77 
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    32   0.85 
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    32   0.90 
Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W...    32   0.93 
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    32   0.95 
SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} simila...    32   1.0  
KAFR0A02290 Chr1 (477162..479234) [2073 bp, 690 aa] {ON} Anc_2.5...    32   1.0  
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    32   1.1  
TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 a...    32   1.1  
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    32   1.1  
Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON} (1201...    32   1.1  
TDEL0B06840 Chr2 (1211695..1213485) [1791 bp, 596 aa] {ON} Anc_2...    32   1.3  
NCAS0E02790 Chr5 (551328..552467) [1140 bp, 379 aa] {ON} Anc_7.3...    32   1.3  
Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar ...    32   1.3  
AGL169C Chr7 complement(381327..382085) [759 bp, 252 aa] {ON} Sy...    31   1.3  
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    32   1.3  
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    32   1.3  
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    32   1.4  
Suva_10.58 Chr10 (117228..121007) [3780 bp, 1259 aa] {ON} YLL016...    32   1.7  
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    31   1.7  
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    31   1.7  
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    31   1.8  
Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310...    31   1.8  
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    31   1.8  
Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016...    31   1.9  
CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} simila...    31   1.9  
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    31   2.1  
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    31   2.2  
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    31   2.2  
SAKL0C00924g Chr3 (81919..84351) [2433 bp, 810 aa] {ON} some sim...    31   2.3  
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    30   2.4  
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    30   2.4  
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    30   2.6  
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    30   2.9  
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    30   3.0  
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    31   3.1  
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    30   3.1  
TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON...    30   3.1  
CAGL0G06842g Chr7 complement(651033..654152) [3120 bp, 1039 aa] ...    30   3.2  
Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]...    30   3.6  
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    30   3.8  
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    30   3.8  
ZYRO0D04004g Chr4 (327544..327552,327618..329327) [1719 bp, 572 ...    30   3.8  
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    30   3.9  
KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.34...    30   4.1  
NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539     30   4.1  
KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369) ...    30   4.3  
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    30   4.7  
Smik_12.47 Chr12 (99536..103291) [3756 bp, 1251 aa] {ON} YLL016W...    30   5.4  
Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2)...    29   5.6  
KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakl...    30   5.6  
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    30   5.9  
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    30   6.5  
KLLA0E20879g Chr5 complement(1862894..1865941) [3048 bp, 1015 aa...    30   6.7  
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    29   7.0  
SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]...    29   8.0  

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  312 bits (800), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 159/202 (78%), Positives = 159/202 (78%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSLEYVEALYD 60
           MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSLEYVEALYD
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSLEYVEALYD 60

Query: 61  FQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRXXXXXXXXXXXXXYD 120
           FQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR             YD
Sbjct: 61  FQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAAPSANLAPPAYD 120

Query: 121 NPKLSPQPTVQSFQPPAQPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHNGLKSFGSK 180
           NPKLSPQPTVQSFQPPAQPI                              HNGLKSFGSK
Sbjct: 121 NPKLSPQPTVQSFQPPAQPIVAQPSPQPAYYQAPPQQVVVEQQPVQQSSAHNGLKSFGSK 180

Query: 181 LGNAAIFGAGATLGSDLVNSIF 202
           LGNAAIFGAGATLGSDLVNSIF
Sbjct: 181 LGNAAIFGAGATLGSDLVNSIF 202

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  172 bits (435), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 120/214 (56%), Gaps = 14/214 (6%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN----GASPVPPPMSLEYVE 56
           MS S INRSL NIR ELDFL+ESNVIS   F +I   LP       AS      SLEYVE
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRXXXXXXXXXXX 116
           ALY F PQQDGDL ++ GDKIQ+LEK S EWY+G+ NGR G+FP+NYV+           
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120

Query: 117 X----XYDNPKLSPQPT----VQSFQPPAQPIXXXXXXXXXXXXXXXXXXXXXXXXXXXX 168
                 Y   +L P PT    V S+Q   QP                             
Sbjct: 121 LPPPPQYKAQELQPVPTQNSAVSSYQ--QQPFPPPSTNYYQQPQQAPAPAPQQQQQQQQP 178

Query: 169 XXHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
             HN LKSFGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 179 NSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  169 bits (428), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 116/214 (54%), Gaps = 25/214 (11%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSLEYVEALYD 60
           MS S INRSL  +R ELDFLRESNVIS+  +  +   LP N ++        EY+EALY 
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASN-----KGGEYMEALYQ 55

Query: 61  FQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRXXXXXXXXXXXXXYD 120
           F PQQDGDLA+  GDKI+VLEKPS EW++G  NGR GMFP+NYV+              D
Sbjct: 56  FDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGS--------D 107

Query: 121 NPKLSPQPTVQ------------SFQPPAQPIXXXXXXXXXXXXXXXXXXXXXXXXXXXX 168
            P + P P  +            S+Q P  P                             
Sbjct: 108 RPSVPPPPQYEQAQRTNTGQSSGSYQQPFPPPSTNYYQQPPQQYQQPQQQQPQQEQQQQH 167

Query: 169 XXHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
             HN LK FGSKLGNAAIFGAGAT+GSDLVNSIF
Sbjct: 168 HSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  162 bits (410), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 119/214 (55%), Gaps = 18/214 (8%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPS----NGASPVPPPMSLEYVE 56
           MS S INRSL  IR ELDFL+ESNVIS   F +I   LP     + A+      SLEYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRXXXXXXXXXXX 116
           ALY F PQQDGDL ++ GDK+Q+LEK S EWY+G+ NGR G+FP+NYV+           
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNGSSN 120

Query: 117 X----XYDNPKLSPQPT----VQSFQPPAQPIXXXXXXXXXXXXXXXXXXXXXXXXXXXX 168
                 Y   +L   PT    V S+Q   QP                             
Sbjct: 121 LPPPPQYKAQELQQAPTQNSAVSSYQ--QQPF----PPPSTNYYQQPQQQPQQAPPQQQP 174

Query: 169 XXHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
             HN LKSFGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 175 SSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  162 bits (411), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 99/217 (45%), Positives = 119/217 (54%), Gaps = 15/217 (6%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPP----PMSLEYVE 56
           MS S +NRSL NIR ELDFL+ESNVIS+  F +I   LP        P      SLEYVE
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSNSASLEYVE 78

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRXXXXXXXXXXX 116
           A+Y F PQQDGDL ++ GDK+Q+LEK S EWY+G+ NGR G+FP+NYV+           
Sbjct: 79  AVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSDGQHR 138

Query: 117 X----XYDNPKLSPQPT----VQSFQP---PAQPIXXXXXXXXXXXXXXXXXXXXXXXXX 165
                 Y   +L   PT    V S+QP   P                             
Sbjct: 139 LPPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQPPPPQQQQQ 198

Query: 166 XXXXXHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
                +N LKSFGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 199 QQSSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  160 bits (405), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 98/215 (45%), Positives = 117/215 (54%), Gaps = 13/215 (6%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPP----PMSLEYVE 56
           MS S INRSL NIR ELDFL+ SNVIS   + +I   LP+       P    P SLEYVE
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASLEYVE 60

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRXXXXXXXXXXX 116
           ALY F PQQDGDL ++ GDK+Q+LEK S EWY+G+ NGR G+FP+NYV+           
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGPSN 120

Query: 117 X----XYDNPKLSPQPTVQSF-----QPPAQPIXXXXXXXXXXXXXXXXXXXXXXXXXXX 167
                 Y   +L   PT  S      Q P  P                            
Sbjct: 121 LPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQQQQH 180

Query: 168 XXXHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
              H+ LKSFGSKLGNAAIFGAGA++GSD+VN+IF
Sbjct: 181 QSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  158 bits (400), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/239 (41%), Positives = 122/239 (51%), Gaps = 42/239 (17%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPS-------------------- 40
           MS + INR++ NI+ ELDFLRES +I++    EI+ +LP                     
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 41  -----------NGASPVPPPMS-LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWY 88
                      + AS  PPP + LEYVEALY F+PQQ+GDL + AGDK+Q+LEKPSAEWY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 89  RGTVNGREGMFPSNYVRXXXXXXXX---XXXXXYDNPKLSPQPTVQSFQPPAQPIXXX-- 143
           +GT NG+ GMFP+NYV+                Y N    P     S+  PA P      
Sbjct: 121 KGTCNGQIGMFPANYVKPVTKDSFAPPPPQYQQYSNNYQQP-----SYSQPAYPPASTGY 175

Query: 144 XXXXXXXXXXXXXXXXXXXXXXXXXXXHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
                                      +  LK FGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 176 YQQPQQVQVQQPQQVQVQQQPQQQSQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  135 bits (341), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 70/115 (60%), Positives = 77/115 (66%), Gaps = 10/115 (8%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLP----------SNGASPVPPPM 50
           MS S INRSL N+R ELDFLRES VISE  F +IM  LP          +          
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
            LEYVEALY FQPQQDGDL +R GDKIQVLEKPSAEWY+G   G+ GMFPSNYV+
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVK 115

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (90%)

Query: 171 HNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           HN  K FGS+LGNAAIFGAGAT+GSD+VNSIF
Sbjct: 190 HNAFKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  135 bits (340), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 85/114 (74%), Gaps = 12/114 (10%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPS----NGA-----SPVPPPMS 51
           MS S INRSL NIR ELDFL+ESNVISE  F +I  +LP     NG+     S  P   +
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAP---T 57

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           LEYVEA+Y F+PQQ+GDLA++AGDKIQV+EKPS EW++G  NG+ G+FPSNYVR
Sbjct: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 2/34 (5%)

Query: 171 HNG--LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           H G  LK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 202 HTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  134 bits (338), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 79/111 (71%), Gaps = 8/111 (7%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLP------SNGASPVPPPMSLEY 54
           MS S INRSL  IR ELDFLRES VISE  F++I   LP      +NG     P  SLEY
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSP--SLEY 58

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           VEA+Y FQ QQDGDL ++ GDKIQVLEKPS+EWY+G  NG  GMFPSNYV+
Sbjct: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 3/35 (8%)

Query: 171 HNG---LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           HNG    K FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 196 HNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  132 bits (331), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 63/109 (57%), Positives = 81/109 (74%), Gaps = 4/109 (3%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN----GASPVPPPMSLEYVE 56
           MS S+INRSL+ +R EL+FLRESNVI+E  +++I+  LP       ++P  P    E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           A+Y FQ QQDGDL ++ GDKI+VLEKPS EWY+G  NGR GMFPSNYV+
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 2/34 (5%)

Query: 171 HNG--LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           H G   K FG KLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 203 HTGAAFKKFGGKLGNAAIFGAGATIGSDIVNSIF 236

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  130 bits (326), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 79/115 (68%), Gaps = 10/115 (8%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLP-----SNG-----ASPVPPPM 50
           MS S INRSL  IR EL+FL+ES VIS+  FKEI   LP     SN      A+      
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           +LEYVEA+Y F PQQDGDLAI+ GDKIQVLEK S EWY+G+ NG+ G+FPSNY +
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTK 115

 Score = 58.5 bits (140), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 29/29 (100%)

Query: 174 LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           LKSFGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 192 LKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  129 bits (325), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 77/108 (71%), Gaps = 3/108 (2%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN---GASPVPPPMSLEYVEA 57
           MS S INRSL NIRNELDFL+ES VIS+  F  I  KLP        PVP     E+VEA
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASVEEFVEA 60

Query: 58  LYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           LYDF+PQQ+GDL ++ GDKIQ+LEK S +WYRG  N R G+FP+NYV+
Sbjct: 61  LYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVK 108

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (93%)

Query: 172 NGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           +  KSFGSKLGNAAIFGAG+T+GSD+V+SIF
Sbjct: 219 SAFKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  126 bits (316), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 80/109 (73%), Gaps = 4/109 (3%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN---GASPVPPPMSL-EYVE 56
           MS S+INRSL+ +R EL+FLRES+VI+E  +++I+  LP        P  P  +  E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQPSATQGEFVE 60

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           A+Y FQ QQDGDL ++ GDK++VLEKPS EW++G  NGR GMFPSNYV+
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVK 109

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%)

Query: 172 NGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           +  K FG KLGNAA+FGAGAT+GSD+VNSIF
Sbjct: 203 SAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  122 bits (307), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 84/165 (50%), Gaps = 19/165 (11%)

Query: 50  MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRXXXX 109
           M  E+VEA+Y F PQQ+GDLA+  GDKI+VLEKPS EW+RG  NGR GMFPSNYV+    
Sbjct: 1   MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVK---- 56

Query: 110 XXXXXXXXXYDNPKLSPQPTVQSFQPPAQP------------IXXXXXXXXXXXXXXXXX 157
                    +D P   P P        +QP                              
Sbjct: 57  ---PAFSGGFDRPAAPPPPQYDQKAMASQPSGGNAMWQQPSPYPPPSTNYYQPPPPQQQQ 113

Query: 158 XXXXXXXXXXXXXHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
                        H+GL  FGSKLGNAAIFGAGATLGSDL+NSIF
Sbjct: 114 PQPMVVQQEQGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  124 bits (312), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 76/108 (70%), Gaps = 3/108 (2%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSL---EYVEA 57
           MS + +NRSL NIRNEL+FLRESNVIS   F  I  KLP         P +    EYVEA
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60

Query: 58  LYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           LYDF+ QQDGDL+++ GDKIQVLEK S +WY+G  N R G+FP+NYV+
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVK 108

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/29 (82%), Positives = 27/29 (93%)

Query: 174 LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
            KSFGSKLGNAAIFGAG+ +GSD+VNSIF
Sbjct: 213 FKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  124 bits (311), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 3/108 (2%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSL---EYVEA 57
           MS S +NRSL NIRNEL+FL+ESNVIS   F+ I  KLP         P +    EYVEA
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60

Query: 58  LYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           LYDF+ QQDGDL+++ GDKIQVLEK S +WYRG  N + G+FP+NYV+
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%)

Query: 172 NGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           +  KSFGSKLGNAAIFGAG+ +GSD+VNSIF
Sbjct: 211 SAFKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  123 bits (308), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 81/116 (69%), Gaps = 16/116 (13%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLP-----------SNGASPVPPP 49
           MS ++INRSL +++ EL+FLR+SNVIS   F +I   LP           +N +SP    
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSP---- 56

Query: 50  MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
            +LEYVEA+Y F PQQDGDLAI+ GDKIQVLEK S EWY+G  NG+ G+FPSNYV+
Sbjct: 57  -NLEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVK 111

 Score = 58.2 bits (139), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/29 (96%), Positives = 28/29 (96%)

Query: 174 LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
            KSFGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 211 FKSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  122 bits (307), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 79/118 (66%), Gaps = 13/118 (11%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN---GASPVPPPMSL----- 52
           MS S+INRSL  IR ELDFL+ESNVIS+  F +I   LP      AS  P   S      
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 53  -----EYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
                E+VEA+Y F+PQQ GDLA++ GDKI+V+EKPS EW++G  NG+ GMFPSNYV+
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 31/32 (96%)

Query: 171 HNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           H+GLK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 206 HHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  120 bits (300), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 78/114 (68%), Gaps = 15/114 (13%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLP---------SNGASPVPPPMS 51
           MS S INRSLNNIRNEL+FL+ESNVIS   F  I   LP         +N AS      +
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNAS------T 54

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
            EYVEALYDF+ QQDGDL+++ GDKIQ+LEK S +WY+G  N   G+FP+NYV+
Sbjct: 55  EEYVEALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVK 108

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 28/29 (96%)

Query: 174 LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
            KSFGSKLG+AAIFGAG+T+GSD++NSIF
Sbjct: 210 FKSFGSKLGDAAIFGAGSTIGSDIINSIF 238

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  114 bits (284), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 74/112 (66%), Gaps = 7/112 (6%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN-------GASPVPPPMSLE 53
           MS  ++NRS+ NIR EL++L ES VIS   F E   KLP N       GA    PP   E
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           YVEA++ ++PQ+  DL ++ GDK+++LEK SA+WYRG   G+ G+FPSNYV+
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVK 112

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 171 HNGL-KSFGSKLGNAAIFGAGATLGSDLVNSI 201
           H+G  K+   + GN+ +FGAG  +GSD+VN I
Sbjct: 182 HSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  112 bits (279), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 75/108 (69%), Gaps = 3/108 (2%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEI--MMKLPSNGASPVPPPMSL-EYVEA 57
           MS S INRSL NI+ EL+FL ESNVIS+   ++I  M+  P  G         L EYVEA
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREGTMKAASQQVLKEYVEA 60

Query: 58  LYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           LY F PQQ GDL  + GDKI+VLEKPSA+WY+G  NGR GMFPSNYV+
Sbjct: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 26/29 (89%)

Query: 174 LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
            K FGSKLGNAA+FGAGAT+GS+LV+ IF
Sbjct: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  110 bits (276), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 72/115 (62%), Gaps = 16/115 (13%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLP----------SNGASPVPPPM 50
           MS + INRSL  IR EL FL +S VI+    ++I   LP          +N A PV    
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPV---- 56

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
             EYVEALY FQ QQ GDL  + G+KI+VLEKPS EWY+G  NG+ GMFPSNYV+
Sbjct: 57  --EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 27/28 (96%)

Query: 175 KSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           K FGSKLGNAAIFGAGATLGSDLV+SIF
Sbjct: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  107 bits (266), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (63%), Gaps = 7/111 (6%)

Query: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPP------PMSLEY 54
           MS S IN+SL+ I  ELDFL +SN I +  + +I   LP   A  VP         + E+
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR-APEVPSRQQSNSSKNEEW 59

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           VEA+Y F PQQDGDL +  GDKI V EKPS EW++G  NG+ G+FPSNYVR
Sbjct: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/32 (90%), Positives = 30/32 (93%)

Query: 171 HNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           H  LK+FGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 191 HKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  103 bits (257), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 7/106 (6%)

Query: 5   AINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSL-----EYVEALY 59
           ++  S+  I++EL +L+E   ++E  +K+I   LP     P PP         E VEALY
Sbjct: 3   SVEESVATIKSELKYLKEQGALAELAYKDIESLLPR--VRPQPPVADTMGQNNEIVEALY 60

Query: 60  DFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
            FQPQQDGDLA++ GDKI++LEK S EWY+G  NG+ G+FPSNYV+
Sbjct: 61  AFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK 106

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (82%), Gaps = 3/35 (8%)

Query: 171 HNG---LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           H G    K FGSKLGNAAIFGAGAT+GSDLVNSIF
Sbjct: 186 HQGSAAFKKFGSKLGNAAIFGAGATIGSDLVNSIF 220

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 81.6 bits (200), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%)

Query: 53  EYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           EYVE LY+F+PQ   DL I+ GDK++V+EK SA+WY+G  NG+EGMFP+NYV+
Sbjct: 15  EYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVK 67

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%)

Query: 171 HNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202
           H+ L   GSKLGNAAIFG GATLG+DLV+SIF
Sbjct: 119 HHALGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 72.4 bits (176), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 64/117 (54%), Gaps = 16/117 (13%)

Query: 3   QSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKL--------------PSNGASPVPP 48
           ++AI  +   IR  L+ L ++  ISE  + EI   L              P+ GA  + P
Sbjct: 7   EAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGA--LSP 64

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
               +YVEA+Y +  +Q GDL +  GD I+V+ K S +WY G +NG+ G+FP+NYV+
Sbjct: 65  RNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 20/23 (86%)

Query: 180 KLGNAAIFGAGATLGSDLVNSIF 202
           KLGNAA+FGAG+  G+D+VN IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 8/100 (8%)

Query: 8   RSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSLEYVEALYDFQPQQDG 67
           ++ +N  N+ D L      +E       +KLP++  SP    +      ALY+F  +Q G
Sbjct: 362 QAYSNGDNKADNLSHKMSKTEIDDNHSRVKLPTSLQSPTQTAV------ALYNFAGEQSG 415

Query: 68  DLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYVR 105
           DLA + GD I +L+K  +  +W+ G VNG+EG+FP+NYVR
Sbjct: 416 DLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 50/83 (60%), Gaps = 11/83 (13%)

Query: 24  NVISEGCFKEIMMKLPSNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKP 83
           N  S+G     +   PS+G      P ++    ALY F+ +QDGDL  R GD I +L+K 
Sbjct: 376 NTGSKGSHSASIRDRPSSGT-----PKAV----ALYTFKGEQDGDLPFRTGDVIAILKKS 426

Query: 84  SA--EWYRGTVNGREGMFPSNYV 104
           ++  +W+ G VNG+EG+FP+NYV
Sbjct: 427 NSQDDWWTGRVNGQEGIFPANYV 449

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 44  SPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE--WYRGTVNGREGMFPS 101
           +P  P  S     ALY F  ++ GDL  R GD I +L+K  ++  W+ G VNGREG+FP+
Sbjct: 395 APTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPA 454

Query: 102 NYV 104
           NYV
Sbjct: 455 NYV 457

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 44  SPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE--WYRGTVNGREGMFPS 101
           +P  P  S     ALY F  ++ GDL  R GD I +L+K  ++  W+ G VNGREG+FP+
Sbjct: 394 APTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPA 453

Query: 102 NYV 104
           NYV
Sbjct: 454 NYV 456

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 8/64 (12%)

Query: 44  SPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPS 101
           SP P  +      ALY+F  +Q GDLA + GD I +L+K  +  +W+ G +NG+EG+FP+
Sbjct: 416 SPTPTAI------ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPA 469

Query: 102 NYVR 105
           NYVR
Sbjct: 470 NYVR 473

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%), Gaps = 4/69 (5%)

Query: 39  PSNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGRE 96
           P  GA+P+P    +E V ALYD+Q Q  GDL+  AG  I+++++ +   EW+ G  NG++
Sbjct: 447 PGMGAAPMP--TGVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQ 504

Query: 97  GMFPSNYVR 105
           G+FP NYV+
Sbjct: 505 GVFPGNYVQ 513

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 43  ASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFP 100
           A+P  P  S     AL+ F  ++ GDL  R GD + +L+K  +  +W+ G VNGREG+FP
Sbjct: 389 AAPTSPSTSSPKAVALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFP 448

Query: 101 SNYV 104
           +NYV
Sbjct: 449 ANYV 452

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYVR 105
           ALY+F  +Q GDLA + GD I +L+K  +  +W+ G  NG+EG+FP+NYVR
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 43  ASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFP 100
            +P  P  S     ALY F  ++ GDL  R GD I +L+K  +  +W+ G V+GREG+FP
Sbjct: 393 TAPTSPSTSSPKAVALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFP 452

Query: 101 SNYV 104
           +NYV
Sbjct: 453 ANYV 456

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  ++ GDL  R GD I VL+K  +  +W+ G VNGREG+FP+NYV
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYV 461

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 41/62 (66%), Gaps = 3/62 (4%)

Query: 45  PVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSN 102
           P     S E V ALY F  +Q GDL+ + GDKI +L++  +  +W+ G VNG+EG+FP+N
Sbjct: 371 PTSGHASNEAV-ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPAN 429

Query: 103 YV 104
           YV
Sbjct: 430 YV 431

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYVR 105
           ALY+F  +Q GDLA + GD I +L+K  +  +W+ G  NG+EG+FP+NYVR
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 5/73 (6%)

Query: 37  KLPSNGASPVPPPMSLEYVE---ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGT 91
           +L ++  SP  P + LE  E   ALY F  +Q GDLA + GD I V++K  +  +W+ G 
Sbjct: 348 QLANSKVSPSSPSIGLEKAEKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGK 407

Query: 92  VNGREGMFPSNYV 104
           +  +EG+FP+NYV
Sbjct: 408 LGNKEGIFPANYV 420

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 39  PSNGASPVPPPMSL--EYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGR 95
           PS G+S   P  +   E   ALYDF  Q DGDL+      I++L++  A  W+ G  NGR
Sbjct: 316 PSYGSSSASPATTAAPETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGR 375

Query: 96  EGMFPSNYV 104
           EG+FP+NYV
Sbjct: 376 EGLFPANYV 384

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 5/69 (7%)

Query: 39  PSNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGRE 96
           P+ G+   P    +E V ALYD+Q Q  GDL+  AG  I+++E+ S   EW+ G  NG++
Sbjct: 390 PTAGSMAAP---GVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQ 446

Query: 97  GMFPSNYVR 105
           G+FP NYV+
Sbjct: 447 GVFPGNYVQ 455

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  ++ GDL+ R GD I +++K  +  +W+ G VNGREG+FP+NYV
Sbjct: 385 ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYV 434

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  ++ GDL  R GD I +L+K  +  +W+ G VNGREG+FP+NYV
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 456

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 7/66 (10%)

Query: 39  PSNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGREG 97
           P  GA+P      L+ V A+YD+  Q D +++IRAGD I+VL   +   W  G VNG +G
Sbjct: 565 PRKGAAP------LKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKG 618

Query: 98  MFPSNY 103
           +FPSNY
Sbjct: 619 LFPSNY 624

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  ++ GDL  R GD I +L+K  +  +W+ G VNGREG+FP+NYV
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 438

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  ++ GDL  R GD I +L+K  +  +W+ G VNGREG+FP+NYV
Sbjct: 381 ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYV 430

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F+ +Q GDL  R GD + +L+K  +  +W+ G VNG+EG+FP+NYV
Sbjct: 376 ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYV 425

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 38  LPSNGASPVPPPMS--LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR 95
           +P++  +P P P    ++ V A+YD    +  +L+ + GD I V+E+   +W+RG + GR
Sbjct: 214 VPTSEPAPTPAPAQTVIKRVRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGR 273

Query: 96  EGMFPSNYV 104
            G+FP NYV
Sbjct: 274 VGIFPLNYV 282

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 38/56 (67%)

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           P  +  V A+Y+   Q++ +L+ R GD I VLE+   +W+RGT++G+ G+FP NYV
Sbjct: 228 PNIIRKVRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYV 283

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAE--WYRGTVNGREGMFPSNYV 104
           ALY F+ ++ GDL  R GD I +++K  ++  W+ G VNG+EG+FP+NYV
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYV 420

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F+ +Q GDL  R GD I +L++  +  +W+ G +NG+EG+FP+NYV
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  ++ GDL+ + GD I +L+K  +  +W+ G VNG+EG+FP+NYV
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYV 451

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           P S     ALY F  ++  DL  R GD I +L+K  +  +W+ G VNGREG+FP+NYV
Sbjct: 364 PSSAPKAVALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 421

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%)

Query: 35  MMKLPSNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNG 94
           +  + + G +    P  +  V A+YD   ++  +L+ R GD I VLE+   +W+RGT+ G
Sbjct: 208 VQTISNQGEAKSSAPAVIRKVRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCG 267

Query: 95  REGMFPSNYV 104
           + G+FP NYV
Sbjct: 268 KVGIFPLNYV 277

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 42  GASPVPPPMS-----LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE--WYRGTVNG 94
           G S   PP +     +E V ALYD+Q Q +GDL    G  I+V+E+ +    W+ G  NG
Sbjct: 394 GGSTYTPPTTGLQPGVETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNG 453

Query: 95  REGMFPSNYVR 105
           ++G+FP NYV+
Sbjct: 454 QQGVFPGNYVQ 464

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 40/57 (70%), Gaps = 2/57 (3%)

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYVR 105
           + E V ALY++Q Q +GDL+  AG  I+++++ +   EW+ G  NG++G+FP NYV+
Sbjct: 433 AFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNYVK 489

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  ++ GDL+ R GD I +++K  +  +W+ G V+GREG+FP+NYV
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYV 508

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F+ +Q GDL  R GD I +L+K  +  +W+ G  NG+EG+FP+NYV
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYV 396

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (70%), Gaps = 2/55 (3%)

Query: 53  EYVEALYDFQPQQDGDLAIRAGDKIQVLEK-PSA-EWYRGTVNGREGMFPSNYVR 105
           E V ALYD+Q Q  GDL+  AG  I+++++ P A EW+ G  NG++G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 6/66 (9%)

Query: 46  VPPPMSL----EYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMF 99
           VPP  +     EY  +LY++Q Q  GDL+  AG  IQ++++ +   +W+ G  NG++G+F
Sbjct: 389 VPPAYTTAQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVF 448

Query: 100 PSNYVR 105
           P NYV+
Sbjct: 449 PGNYVQ 454

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 43  ASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFP 100
           A+  PP  +   V ALYD+Q Q  GDL+  AG  I+V+++     EW+ G  NG++G+FP
Sbjct: 407 ATTAPPAANT--VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFP 464

Query: 101 SNYVR 105
            NYV+
Sbjct: 465 GNYVQ 469

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  +Q GDL  R GD I +L+K  +  +W+ G  NG+EG+FP+NYV
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYV 214

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 7/74 (9%)

Query: 39  PSNGASPVPPPMSL-----EYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE--WYRGT 91
           P++  +   PP +      E V ALYD+Q Q +GDL   AG  I+V+E+ +    W+ G 
Sbjct: 359 PASAYTAYTPPTTAPASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGR 418

Query: 92  VNGREGMFPSNYVR 105
            NG +G+FP NYV+
Sbjct: 419 YNGYQGVFPGNYVQ 432

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 5/72 (6%)

Query: 39  PSNGASPVPPPM----SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVN 93
           P + A   PPP     +   V+AL+D++ Q D +++IR GD I VL+      W  G +N
Sbjct: 551 PRSSAPRAPPPRKSGNAARTVKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELN 610

Query: 94  GREGMFPSNYVR 105
           G++G+FP+NY +
Sbjct: 611 GQKGLFPTNYCQ 622

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           +  V ALYD    +  +L+ R GD I VLE+   +W+RG+++G+ G+FP NYV
Sbjct: 214 IRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYV 266

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%)

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           P  ++ V A+YD    + G+L+ + GD I+V+E+   +W+RG++ G  G+FP NYV
Sbjct: 239 PAVVKRVRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYV 294

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEK-PSA-EWYRGTVNGREGMFPSNYVR 105
           +E V ALYD+Q Q  GDL+  AG  I+V+++ P   EW+ G  NG++G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  ++ GDL  R GD I +L+K  +  +W+ G V GREG+FP+NYV
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYV 466

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 40  SNGASPVPPPMSL-EYVEALYDFQPQQDGDLAIRAGDKIQVLEK-PSAE-WYRGTVNGRE 96
           S    P   P+S  E V ALYD+Q Q +GDL   AG  I+V+E+ P    W+ G  NG +
Sbjct: 390 STYTPPTTAPLSAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTPDVNGWWTGRYNGYQ 449

Query: 97  GMFPSNYVR 105
           G+FP NYV+
Sbjct: 450 GVFPGNYVQ 458

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           P  +  V A+YDF   +  +L+ + GD I V+E+   +W+RGT+ G  G+FP NYV
Sbjct: 221 PTVIRKVRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYV 276

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 43  ASPVPPPMS-LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGREGMFP 100
           AS  PP  + +E   ALYD+  Q +GDL   AG  IQV+++  A  W+ G  NG +G+FP
Sbjct: 360 ASYTPPTSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFP 419

Query: 101 SNYV 104
            NYV
Sbjct: 420 GNYV 423

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 2/55 (3%)

Query: 53  EYVEALYDFQPQQDGDLAIRAGDKIQVLEK-PSA-EWYRGTVNGREGMFPSNYVR 105
           E V ALYD+Q Q  GDL+  AG  I+++++ P   EW+ G  NG++G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 468

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 2/55 (3%)

Query: 53  EYVEALYDFQPQQDGDLAIRAGDKIQVLEK-PSA-EWYRGTVNGREGMFPSNYVR 105
           E V ALYD+Q Q  GDL+  AG  I+++++ P   EW+ G  NG++G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE--WYRGTVNGREGMFPSNYVR 105
           +E V ALY++Q Q  GDL+  AG  I+++++ + E  W+ G  NG++G+FP NYV+
Sbjct: 383 METVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           V A+YDF   +  +L+ + GD I VLE+   +W+RG++ GR G+FP NYV
Sbjct: 216 VRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYV 265

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY F  ++ GDL+ R GD I +++K  +  +W+ G  NG EG+FP+NYV
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYV 465

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 43  ASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSN 102
           A  +P    +  V ALYD    +  +L+ R GD I VLE+   +W++G + G  G+FP N
Sbjct: 210 AHKIPAQTVVRRVRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLN 269

Query: 103 YV 104
           YV
Sbjct: 270 YV 271

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 37/50 (74%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           ALY+F  +++GDL  + GD I ++++  +  +W+ G +NG+EG+FP+NYV
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYV 393

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           V A+YD    +  +L+ R GD I VLE+   +W++G + GR G+FP NYV
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYV 275

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 2/55 (3%)

Query: 53  EYVEALYDFQPQQDGDLAIRAGDKIQVLEK-PSA-EWYRGTVNGREGMFPSNYVR 105
           E V ALY++Q Q  GDL+  AG  I+++E+ P   EW+ G  NG++G+FP NYV+
Sbjct: 405 ETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQQGVFPGNYVQ 459

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 38/62 (61%), Gaps = 4/62 (6%)

Query: 43  ASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSN 102
           AS  PP    + V+ALYD    +  +LA + GD I VLE+   +W+RG++ G  G+FP N
Sbjct: 224 ASAAPP----KRVKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLN 279

Query: 103 YV 104
           YV
Sbjct: 280 YV 281

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 6/72 (8%)

Query: 40  SNGASPVPPP-----MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVN 93
           S G +PV PP      +   V+ALYD++ Q D +++I  GD I V++      W  G +N
Sbjct: 563 SRGPAPVAPPSRRKTTTTRKVQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELN 622

Query: 94  GREGMFPSNYVR 105
           G +G+FPS+Y +
Sbjct: 623 GIKGLFPSSYCK 634

 Score = 30.8 bits (68), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 56  EALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYR--GTVNGREGMFPSNYV 104
           + LY +  Q   +++I  GD I +++  +   W R      G EG+ P++YV
Sbjct: 505 KVLYQYNKQDADEISIDVGDSISLVQADTGSGWTRIKNNTTGEEGLVPTSYV 556

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%), Gaps = 7/65 (10%)

Query: 43  ASPVPP-PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMF 99
           +SP+P  P ++    AL+ F+ +Q GDL+   GD + +L+K     +W+ G VN +EG+F
Sbjct: 334 SSPIPQGPKAI----ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIF 389

Query: 100 PSNYV 104
           P+NYV
Sbjct: 390 PANYV 394

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 35/54 (64%)

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           ++  V AL+D   ++  +L+ R GD I V+E+   +W+RG + GR G+FP NYV
Sbjct: 213 TVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYV 266

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 52/107 (48%), Gaps = 12/107 (11%)

Query: 4   SAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNG----ASPVPPPMSLEYVEALY 59
           S+ NR ++++ N     R S             + PS G    +S  P  +      ALY
Sbjct: 346 SSRNRDVDDLSNRFSKSRISQNRDRDSHSRPAAEKPSFGGTRQSSSTPKAI------ALY 399

Query: 60  DFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
            F  ++ GDL  + GD I +L+K  +  +W+ G VN  EG+FP+NYV
Sbjct: 400 SFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYV 446

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           S   V ALYDF  QQ GDL+ +  D I V +K  +  +W+ G  +G EG+FP+NYV
Sbjct: 333 SFPKVRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%)

Query: 47  PPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           P P  +  V+A++D    +  +L+ + GD I V+E+   +W+RG + G+ G+FP NYV
Sbjct: 207 PQPQIVRRVKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           P  +  V A+YD    +  +L+ + GD I VLE+   +W++GT+ G  G+FP NYV
Sbjct: 234 PTVVRKVRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYV 289

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           V ALYD    +  +L+   GD I VLE+   +W+RGT+ G  G+FP NYV
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYV 269

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           ++ V ALYD    +  +L+ R GD I VLE+   +W++G + G+ G+FP NYV
Sbjct: 214 VKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYV 266

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 37/58 (63%)

Query: 47  PPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           P P  +  V AL+D   +   +L+ R GD I+V+E+   +W+RG++ G+ G+FP NYV
Sbjct: 221 PGPPVVRKVRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYV 278

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 6/68 (8%)

Query: 44  SPVPPPMSL----EYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREG 97
           +P PP  S     E   +LY++Q Q  GDL+  AG  I+++E+ +   EW+ G  NG++G
Sbjct: 400 APGPPAYSAAPQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQG 459

Query: 98  MFPSNYVR 105
           +FP NYV+
Sbjct: 460 VFPGNYVQ 467

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 46/76 (60%), Gaps = 7/76 (9%)

Query: 36  MKLPSNGASPVPPPM----SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPS--AEWYR 89
           +K  ++     PPP     S+  +EALYD+Q Q D +L+I AG  ++VL KP   + W  
Sbjct: 551 IKESTHSVPHAPPPRKCVSSVRTIEALYDYQAQGDDELSIYAGSVVKVL-KPDDGSGWTY 609

Query: 90  GTVNGREGMFPSNYVR 105
           G ++G +G+FP++Y +
Sbjct: 610 GELDGAKGLFPTSYCK 625

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 2/57 (3%)

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKP--SAEWYRGTVNGREGMFPSNYVR 105
           S+E V ALYD+Q Q  GDL+  A   I+++++   + EW+ G  +G+ G+FP NYV+
Sbjct: 399 SVETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGREGMFPSNY 103
           P SL  V A+YD+  +   +++IRAGD I+V+   +   W  G V G  G+FPSNY
Sbjct: 615 PTSLRTVIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNY 670

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           V ALYD    +  +L+ R  D I VLE+   +W++G + G+ G+FP NYV
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYV 274

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           V A+Y     +  +L+   GD I V+E+   +W+RGT+ G+ G+FP NYV
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYV 280

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSA--EWYRGTVNGREGMFPSNYV 104
           AL+DF   + GDL  + GD I ++++  +  +W+ G +N REG+FP+NYV
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYV 578

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 44  SPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKP-SAEWYRGTVNGREGMFPSN 102
           S  P P   E   +LY F  Q   DL   A   I++L++  S+ W+ G  NG+EG+FP N
Sbjct: 358 STAPAP---ETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGN 414

Query: 103 YVR 105
           YVR
Sbjct: 415 YVR 417

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           P  +  V ALYD       +L+ + GD I VLE+   +W++G +  + G+FP NYV
Sbjct: 227 PTIVRKVRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYV 282

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGREGMFPSNYVR 105
           S+  VEA+YD++   D +L+I  G+ I+V+       W  G  NG +G+FPS+Y +
Sbjct: 582 SIRTVEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 43  ASPVPPP----MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGREG 97
           A  VPPP    M    ++A YD++ Q D +L++   D + V+       W  G +NG +G
Sbjct: 546 APKVPPPRRTNMPTRTMQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKG 605

Query: 98  MFPSNYVR 105
           +FP++Y R
Sbjct: 606 LFPTSYCR 613

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%)

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           +++ V A+YD +     +LA R  D I V+E+   +W+ G++  R G+FP NYV
Sbjct: 215 TIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYV 268

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 41  NGASPVPPPM---SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGRE 96
           + A   PPP    +   VEA+Y +Q Q + + ++  GD I VL+      W  G VNG +
Sbjct: 553 SSAPRAPPPRKGGATRTVEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEK 612

Query: 97  GMFPSNYVR 105
           G+FP++Y +
Sbjct: 613 GLFPTSYCK 621

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVN---GREGMFPSNYV 104
           PM       LY +Q Q D +++I  GD I +L   +   +    N   G+ G+ P+ YV
Sbjct: 487 PMESNTNTVLYLYQKQDDDEVSISPGDPITLLVADTGSGWTKIKNDRTGQTGLVPTTYV 545

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 4/56 (7%)

Query: 54  YVEALYDF-QPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV---NGREGMFPSNYVR 105
           Y +ALY F +P ++  L  + GD + + EK + +WY G V   NGR+G+ P NYV+
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 10/76 (13%)

Query: 36  MKLPSNGASPVPPPMSLEYVEALYDF--QPQQDG---DLAIRAGDKIQVLEKPSAEWYRG 90
           ++   N A+   P +   Y  ALYD+   P Q G   DL  + GD I+V++K    W+ G
Sbjct: 363 LQFRDNAANGTVPTV---YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYG 419

Query: 91  TV--NGREGMFPSNYV 104
            V    R G FP N+V
Sbjct: 420 EVLRTKRRGYFPVNFV 435

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 41  NGASPVPPPMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEKP-----SAEWYR-GTVN 93
           NG+ P+ P   LE+  ALYDF P+  + ++A++ GD + +L K       ++W++  T N
Sbjct: 298 NGSEPIDPS-KLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKN 356

Query: 94  GREGMFPSNYV 104
           G  G  P NY+
Sbjct: 357 GNIGYIPYNYI 367

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 5/68 (7%)

Query: 43  ASPVPPP----MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGREG 97
           A  VPPP    + +  +EA+Y ++ Q D +++I  GD I V+       W  G  +G +G
Sbjct: 566 APEVPPPRRSTLPIRTLEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKG 625

Query: 98  MFPSNYVR 105
           +FP++Y +
Sbjct: 626 LFPTSYCK 633

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 56  EALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVN---GREGMFPSNYVR 105
           + LY +  Q D +++I  GD+I ++ + +   +    N   G  G+ P+ Y+R
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIR 551

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYVR 105
           A YD++  +D +L  + GD+I  +E    +W+ G +   G +G+FPSNYV+
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 12/60 (20%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPSNYV 104
           V+ALYD++PQ D +LAI+  D + +LEK    EW+  TV  R          G+ PSNYV
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWW--TVKKRVIGLDAEEPTGLVPSNYV 65

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 36  MKLPSNGASP-VPPP----MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYR 89
           +K    G +P VPPP    + +  +EA+Y ++ Q D +++I  GD I V+       W  
Sbjct: 558 VKANDRGPAPEVPPPRRSTLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTY 617

Query: 90  GTVNGREGMFPSNYVR 105
           G  +G +G+FP++Y +
Sbjct: 618 GECDGLKGLFPTSYCK 633

 Score = 29.3 bits (64), Expect = 7.2,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 56  EALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVN---GREGMFPSNYVR 105
           + LY +  + D ++ I  GDKI ++ + +   +    N   G  G+ P+ Y+R
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIR 551

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 13/80 (16%)

Query: 38  LPSNGASPVPPPMSLEYVE-----------ALYDFQPQQDGDLAIRAGDKIQVLEKPSAE 86
           LPS     VPPP      E           A YD++  +D +L     DKI  +E    +
Sbjct: 511 LPSRNTEAVPPPPPRRSAEPEKKKEEPWAIAEYDYEAGEDNELTFSENDKIINIEFVDDD 570

Query: 87  WYRGTV--NGREGMFPSNYV 104
           W+ G +  +G +G+FPSNYV
Sbjct: 571 WWLGELESSGEKGLFPSNYV 590

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 7/70 (10%)

Query: 40  SNGASPVPPPMSLEYVEALYDFQPQQDG--DLAIRAGDKIQVLEKPSAEWYRGTV--NGR 95
           SN      P M   Y   LYD++PQ +    L+I+ GD IQ++ +    W+ G +     
Sbjct: 350 SNSLQKAVPTM---YATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYGDLLRTKT 406

Query: 96  EGMFPSNYVR 105
           +G+FP +YV+
Sbjct: 407 KGLFPQSYVQ 416

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 54  YVEALYDFQPQQDGD-LAIRAGDKIQVLEKPSAEWYRGTV---NGREGMFPSNYV 104
           Y  A+Y F    D D L    GD + + EK + +WY G V   NG++G+ P NYV
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYV 679

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query: 40  SNGASPVPPPMSLE-------YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV 92
           +N   P PP  ++E       +  A YD+   ++ +L     DKI  +E    +W+ G +
Sbjct: 538 ANSVPPPPPRRTMEPKEETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGEL 597

Query: 93  --NGREGMFPSNYV 104
             NG +G+FPSNYV
Sbjct: 598 EKNGEKGLFPSNYV 611

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 17/82 (20%)

Query: 40  SNGASPVPPPMSLEYVE---------------ALYDFQPQQDGDLAIRAGDKIQVLEKPS 84
           +N   P PP +   +VE               A YD+   +D +L  R  DKI  +E   
Sbjct: 583 ANEQGPPPPTLPARHVENENESGNTSSNPSAIAEYDYDAAEDNELTFRENDKIVNIEFVD 642

Query: 85  AEWYRGTV--NGREGMFPSNYV 104
            +W+ G +   G +G+FPSNYV
Sbjct: 643 EDWWLGELGSTGEKGLFPSNYV 664

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGREGMFPSNY 103
           A Y +Q Q   +L+++ GDKI+VL++     W  G +NG +G+FP+ Y
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTY 647

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 59/108 (54%), Gaps = 11/108 (10%)

Query: 2   SQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSLEYVEALYDF 61
           S   ++R++    N L+ +R   V  +G  +++ + +  +  +PV     ++YV+A+Y +
Sbjct: 504 SNLTVSRTVLPFSNSLNIMRCKRVTIDG--EQLNLPIVDSMKNPV-----VKYVKAMYSY 556

Query: 62  -QPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV---NGREGMFPSNYVR 105
            +P ++  L   +GD + ++E  + +WY G V   N + G+ P NYV+
Sbjct: 557 TEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVK 604

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 41  NGASPVPPPMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEK-----PSAEWYR-GTVN 93
           +G+ P+ P   LE+  ALYDF P+    ++A+  GD + +L K      +++W++  T N
Sbjct: 315 SGSEPIDPS-KLEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKN 373

Query: 94  GREGMFPSNYV 104
           G+ G  P NY+
Sbjct: 374 GKIGYIPYNYI 384

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 39  PSNGASPVPPP--MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGR 95
           P      VPPP    +  +E ++D+  Q D +++I  GD + V++      W  G +NG 
Sbjct: 533 PVRAKPSVPPPRRKHVRTLEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGL 592

Query: 96  EGMFPSNYVR 105
           +G+ P++Y +
Sbjct: 593 KGLVPTSYCK 602

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           A YD++  +D +L     DKI  +E    +W+ G +  NG +G+FPSNYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 8/72 (11%)

Query: 41  NGASPVPPPMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEK-----PSAEWYR-GTVN 93
           NG  P+ P   LE+  ALYDF P+    ++A++ GD + +L K       ++W++  T N
Sbjct: 304 NGDEPIDPS-KLEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKN 362

Query: 94  GREGMFPSNYVR 105
           G  G  P NY+ 
Sbjct: 363 GSIGYIPYNYIE 374

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 7/70 (10%)

Query: 40  SNGASPVPPPMSLEYVEALYDFQPQQDG--DLAIRAGDKIQVLEKPSAEWYRGTV--NGR 95
           +N  S + P +   Y  ALYD+ PQ +    L+I+ GD IQV+ +    W+ G +     
Sbjct: 342 ANAFSGIIPTV---YATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLLRTKT 398

Query: 96  EGMFPSNYVR 105
           +G+FP +YV+
Sbjct: 399 KGLFPQSYVQ 408

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 42  GASPVPPP-----MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGR 95
           G +P  PP     +    + A Y +  Q D +++I AGD I V+       W  G +NG 
Sbjct: 570 GNAPAAPPPRRSTLPTRTMTAKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGV 629

Query: 96  EGMFPSNY 103
           +G+FP++Y
Sbjct: 630 KGLFPTSY 637

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           A YD+   +D +L    GDKI  +E    +W+ G +   G +G+FPSNYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 49  PMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEKP-----SAEWYR-GTVNGREGMFPS 101
           P +LE+  A+YDF P+    + A+R GD + V+ K      ++EW++  T  G  G  PS
Sbjct: 307 PRNLEFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPS 366

Query: 102 NYV 104
           NYV
Sbjct: 367 NYV 369

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 49  PMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEKP-----SAEWYR-GTVNGREGMFPS 101
           P  LE+  ALYDF P+  + ++A++ GD + +L K       ++W++  T NG  G  P 
Sbjct: 307 PSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPY 366

Query: 102 NYV 104
           NY+
Sbjct: 367 NYI 369

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 50  MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGREGMFPSNYVR 105
           + +  +EA+Y ++ Q D +++I  GD+I V+       W  G  +G +G+FP++Y R
Sbjct: 577 LPVRTMEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 30.8 bits (68), Expect = 2.5,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 56  EALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVN---GREGMFPSNYVR 105
           + LY +  Q D ++ I  GDKI ++ + +   +    N   G  G+ P+ Y+R
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIR 551

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           +  A YD++  +D +L     DKI  +E    +W+ G +   G +G+FPSNYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 11/83 (13%)

Query: 33  EIMMKLPSNGAS-PVPPPMSLEYVE--------ALYDFQPQQDGDLAIRAGDKIQVLEKP 83
           E  + LP+  +S P PPP  +   E        A YD+   +D +L    G KI  +E  
Sbjct: 442 EATLPLPARESSAPPPPPRKVATQEKPALATAVAEYDYDAAEDNELTFVEGTKIINIEFV 501

Query: 84  SAEWYRGT--VNGREGMFPSNYV 104
             +W+ G     G +G+FP+NYV
Sbjct: 502 DDDWWLGENGTTGEKGLFPANYV 524

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYVR 105
           A YD++  +D +L     DKI  +E    +W+ G +  +G +G+FPSNYV 
Sbjct: 523 AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 7/72 (9%)

Query: 40  SNGASPVPPPMSLEYVEALYDFQPQ-QDGDLAIRAGDKIQVLEKP-----SAEWYR-GTV 92
           S+G +      +LE+  AL+DF P+ +  +L +  GD + +L K      +++W++  T 
Sbjct: 294 SHGVNEKIDLSNLEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTK 353

Query: 93  NGREGMFPSNYV 104
           NG  G  PSNY+
Sbjct: 354 NGDTGYVPSNYI 365

>KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1528

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRG-TVNGR------EGMFPSNYV 104
           ++ V A  DF P +   L + AGD + VL K  + W+ G TV GR       G FP N+ 
Sbjct: 24  VDVVVATCDFTPTKKAQLRLSAGDVVYVLGKNESGWWDGVTVCGRSPQRVARGWFPHNFT 83

Query: 105 R 105
           R
Sbjct: 84  R 84

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query: 40  SNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV-----NG 94
           S+G++ V P   ++ V A YD+ P +   L +  GD + VL K  + W+ G +       
Sbjct: 14  SSGSTLVRP---VDVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKA 70

Query: 95  REGMFPSNYVR 105
             G FP NY +
Sbjct: 71  SRGWFPCNYSK 81

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 49  PMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEK------PSAEWYRGTVNGREGMFPS 101
           P SLE+  A+YDF P+    +L ++ GD + V+ K      PS  W   T  G  G  P 
Sbjct: 304 PRSLEFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTKKGDIGYVPY 363

Query: 102 NYV 104
           NY+
Sbjct: 364 NYL 366

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           A YD++  ++ +L    GDKI  +E    +W+ G +   G +G+FPSNYV
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 632

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 44  SPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPS 101
           +P   P    +  A YD+   +D +L     DKI  +E    +W+ G +  +G +G+FPS
Sbjct: 525 TPEKKPKENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPS 584

Query: 102 NYV 104
           NYV
Sbjct: 585 NYV 587

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGT--VNGREGMFPSNY 103
           ++ALY++Q Q  G+L+   GD   V ++   +WY  +   +G+ GM P NY
Sbjct: 68  IKALYNYQAQSAGELSFNKGDFFHV-QQEENDWYEASNPADGKRGMVPKNY 117

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%)

Query: 47  PPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREG 97
           P  M   Y   LYDFQ ++  +L   AG+ + +      EW+     GR G
Sbjct: 163 PSNMGTLYAIVLYDFQAEKADELTAYAGENLFICAHHDFEWFIAKPIGRLG 213

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           +  A YD+   +D +L     DKI  +E    +W+ G +  +G +G+FPSNYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 54  YVEALYDFQP---QQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           Y  AL+D++P    Q  DL  R  + I+V++K    W+ G      + G FP+NYV
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYV 454

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 39.7 bits (91), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV-----NGREGMFPSNYV 104
           V A Y ++   DGDL    G +I+V+     +WY G       N +EG+FP NYV
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYV 67

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 36  MKLPSNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR 95
           M  P  G S +  P  L+ V A YDF P +   L   AGD I V+ K  + W+ G +   
Sbjct: 9   MNPPKAGLSTIIKP--LDIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYN 66

Query: 96  E-----GMFPSNYVR 105
           +     G FP +Y +
Sbjct: 67  KSLVLRGWFPRSYTK 81

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 12/82 (14%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L   +A+YD++PQ + +LA+R  D + +L+K    +W+  TV  R          G+ PS
Sbjct: 5   LGVYKAVYDYEPQTEEELAVRENDMLYLLQKSDVDDWW--TVKKRVIGSDVEEPSGLVPS 62

Query: 102 NYVRXXXXXXXXXXXXXYDNPK 123
           NY+              YD P+
Sbjct: 63  NYIEESPVIGQWRALYDYDQPQ 84

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 47  PPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           PP  +     A YD++  ++ +L     DKI  ++    +W+ G +  NG +G+FPSNYV
Sbjct: 496 PPKPAAPSATAEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           +  A YD+   +D +L     DKI  +E    +W+ G +  +G +G+FPSNYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           +  A YD+   +D +L     DKI  +E    +W+ G +  +G +G+FPSNYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 33/51 (64%), Gaps = 3/51 (5%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVL-EKPSAEWYRGTV--NGREGMFPSNYV 104
           ALYDF+ +   +L IR GD + V+ +K S +W+   +  NG++G+ P+ ++
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFI 427

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L   +A+Y ++PQ   +LAI+  D + +LEK    +W+  TV  R         +G+ PS
Sbjct: 5   LGVYKAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWW--TVKKRIIGSDAEEPQGLVPS 62

Query: 102 NYV 104
           NY+
Sbjct: 63  NYI 65

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYVR 105
           A YD + ++  +LA + GDKI  +     +W+ G +   G +G+FPSNYV+
Sbjct: 578 AEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 46  VPPPMSLE----YVEALYDFQPQQDGDLAIRAGDKIQVL-EKPSAEWYRGTVNGREGMFP 100
           VPPP   +     +   YD+  Q++ ++ +  GD + VL E   + W    ++G  G+ P
Sbjct: 595 VPPPRGSKKPSLTLTVQYDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIP 654

Query: 101 SNYVR 105
           +NY +
Sbjct: 655 TNYCK 659

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 43  ASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRG---TVNGR--EG 97
           +SP+     ++ V A++D+  +   +L ++ GD I V+ K  + W+ G     NG+   G
Sbjct: 39  SSPICNVSPVDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRG 98

Query: 98  MFPSNYVR 105
            FP NY R
Sbjct: 99  WFPQNYCR 106

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 33/51 (64%), Gaps = 3/51 (5%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPS--AEWYRGTVNGREGMFPSNYVR 105
           ALY ++ Q D ++++  GD I+V+ KP   + W  G +N ++ +FP++Y +
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 56  EALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVN---GREGMFPSNYV 104
           + LY +    D +++I  GD I V+EK +   +    N   G  G+ PS+Y+
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYL 589

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L   +ALYD++PQ   +LAIR  + + +LEK    EW+  TV  R          G+ PS
Sbjct: 5   LGVYKALYDYEPQTTEELAIREDELLYLLEKSDVDEWW--TVKKRVIGSDADEPVGLVPS 62

Query: 102 NYV 104
           NYV
Sbjct: 63  NYV 65

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYVR 105
           A YD + ++  +LA   GDKI  +     +W+ G +   G +G+FPSNYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 48  PPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVL-EKPSAEWY--RGTVNGREGMFPSNYV 104
           P M+ +  +A+YDF      +L ++ GD I +L ++ S +WY       G+ G+ P+ +V
Sbjct: 408 PAMTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFV 467

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 12/63 (19%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L   +ALYD+  Q D +L ++ GD + +LEK S  +W+  TV  R          G+ P 
Sbjct: 5   LGVYQALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWW--TVKKRVIGSDQDEPVGLVPK 62

Query: 102 NYV 104
            Y+
Sbjct: 63  TYI 65

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 7/92 (7%)

Query: 52  LEYVEALYDFQPQQ--DGDLAIRAGDKIQVLEKPSAEWY--RGTVNGREGMFPSNYVRXX 107
           L  V A+YD++  Q  D +L+ + GD   + +   A+W+  R   + + G  P NYV   
Sbjct: 71  LYQVHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRAVKDKKVGFIPGNYVETI 130

Query: 108 XXXXXXXXXXXYD---NPKLSPQPTVQSFQPP 136
                       D    P+  P     S QPP
Sbjct: 131 EEGGRGGNVSNVDMTEAPRKGPSAAASSMQPP 162

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGRE---------GMFPS 101
           L   +A+Y ++PQ D +L I   D + VLEK    +W+  TV  RE         G+ P+
Sbjct: 5   LGVYKAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWW--TVKKREIGTDTEELVGLVPN 62

Query: 102 NYV 104
           NY+
Sbjct: 63  NYI 65

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           A YD++  +D +L    GD I  ++    +W+ G +   G++G+FPSNYV
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYV 574

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 37  KLPSNGASPVPPPMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEKP-----SAEWYR- 89
           +L SN  +    P  LE+  A+Y+F P+  + ++ ++ GD + +L K       ++W++ 
Sbjct: 244 RLASNNNNIQLDPTKLEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKV 303

Query: 90  GTVNGREGMFPSNYV 104
            T NG  G  P NY+
Sbjct: 304 RTKNGSVGFVPFNYI 318

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           A YD+   ++ +L     DKI  +E    +W+ G +  NG +G+FPSNYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 34.3 bits (77), Expect = 0.013,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query: 69  LAIRAGDKIQVLEK-PSA-EWYRGTVNGREGMFPSNYVR 105
           L   AG  I+++++ P A EW+ G  NG++G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGT--VNGREGMFPSNY 103
           ++A+Y++Q Q  G+L+   GD   VL +   EWY  +   +G+ GM P +Y
Sbjct: 71  IKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRGMVPKSY 120

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 46  VPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREG 97
           +P  M   Y   LYDFQ ++  +L   AG+ + V    + EW+     GR G
Sbjct: 150 MPSKMGSLYAIVLYDFQAEKSDELTSYAGENLFVCAHHNYEWFIAKPIGRLG 201

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 37.7 bits (86), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGRE-----GMFPSNYVR 105
           V A+  ++PQ   DL I  GDKI VL      WY G    ++     G+FPS++V+
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 59  YDFQPQQDGDLAIRAGDKIQVL-EKPSAEWYRGTV--NGREGMFPSNYVR 105
           YDF  +   +L I++GDK+ +L +K S++W+   +  +G+ G+ P+ +V 
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVE 403

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 12/64 (18%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L    A+YD++PQ   +LAI   D + +L+K    +W+  TV  R          G+ PS
Sbjct: 5   LGIYRAIYDYEPQTPEELAIHEDDLLYLLQKSDIDDWW--TVKRRVIGSDSDEPVGLVPS 62

Query: 102 NYVR 105
            Y+ 
Sbjct: 63  TYIE 66

>SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 47  PPPMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEKP-----SAEWYR-GTVNGREGMF 99
           P P +LE+  A+YDF P+    ++ ++ GD + ++ K       ++W++  T  G  G  
Sbjct: 318 PDPKNLEFARAVYDFTPENPQIEVTLKKGDLMAIISKQDPIGNESQWWKVRTKKGDIGYV 377

Query: 100 PSNYV 104
           P NY+
Sbjct: 378 PYNYI 382

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 59  YDFQPQQDGDLAIRAGDKIQVL-EKPSAEWYRGTV--NGREGMFPSNYVR 105
           YDF  +   +L I++GDK+ +L +K S +W+   +  +G+ G+ P+ ++ 
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIE 411

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 59  YDFQPQQDGDLAIRAGDKIQVL-EKPSAEWYRGTV--NGREGMFPSNYVR 105
           YDF  +   +L I++GDK+ +L +K S +W+   +  +G+ G+ P+ ++ 
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIE 408

>TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.365
           YLR191W
          Length = 389

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 49  PMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEKP-----SAEWYR-GTVNGREGMFPS 101
           P  LE+  ALYDF P+    ++ ++ GD + ++ K       +EW++  T +G  G  P 
Sbjct: 305 PSKLEFARALYDFTPENPQMEVTLKKGDLMAIMSKQDSLGRDSEWWKVRTKSGDIGYVPF 364

Query: 102 NYV 104
           NY+
Sbjct: 365 NYI 367

>NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]
           {ON} Anc_4.45
          Length = 1323

 Score = 36.6 bits (83), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 7/58 (12%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNG-------REGMFPSNYVR 105
           V  +YDF P     L +R  + + VL KP+  W+ G           + G FP  +V 
Sbjct: 63  VRVVYDFTPSSSDQLQLRQNEIVYVLNKPNTGWWDGITISESPQQQIKRGWFPQTFVH 120

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 34.7 bits (78), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 46 VPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV 92
          +P    ++ VE  Y +  +    L++R GD I VL K S  W+ G +
Sbjct: 22 IPCLQPIDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDGVL 68

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 44  SPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV---NGREGMFP 100
           +P+ PP     V+A Y +  Q  GDL    GD ++V  K + +WY G +       G FP
Sbjct: 7   APLAPPFK---VKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCSGYFP 62

Query: 101 SNYVR 105
           +N+V+
Sbjct: 63  NNFVK 67

>CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38822 Saccharomyces cerevisiae
           YHR114w BZZ1
          Length = 619

 Score = 36.6 bits (83), Expect = 0.037,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 50  MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAE-WYRGTVNGREGMFPSNY 103
           + +  + A Y++  Q D +L++  GD + VL+      W  G +NG +G+ P++Y
Sbjct: 563 LPVRTITAQYEYTSQGDDELSLAVGDVVTVLKGDDGSGWTYGELNGHKGLVPTSY 617

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 35.8 bits (81), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRG-TVNG-REGMFPSNYV 104
           V ALYDF P+ D +L ++ GD I +  K    W     ++G R G+ P  YV
Sbjct: 119 VVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV 170

>AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR200W
           (BEM1); 1-intron
          Length = 549

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYR--GTVNGREGMFPSNY 103
           ++ALY +  Q  G+L+   G+  QV      EWY    T  GR+GM P +Y
Sbjct: 67  LKALYTYHAQSPGELSFNKGELFQV-NGEDGEWYEVTSTEGGRKGMVPKSY 116

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR---EGMFPSNYV 104
           Y   LYDF+ ++  +L+  AG+ + +    + EW+     GR    G+ P  +V
Sbjct: 148 YAIVLYDFKAEKSDELSAFAGENLFICAHHNFEWFIAKPIGRLGGPGLVPVGFV 201

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 35.8 bits (81), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 51  SLEYVEALYDFQPQQDG-DLAIRAGDKIQVLE------KPSAEWYRGTVNGREGMFPSNY 103
           SLE+  A+YDF P+    + A++ GD + ++       K S  W   T  G  G  P NY
Sbjct: 313 SLEFARAIYDFTPENPRIECALKKGDLMAIISRQDPTGKESQWWKVRTKKGDVGYVPCNY 372

Query: 104 V 104
           +
Sbjct: 373 I 373

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 35.8 bits (81), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           A YD++  +D +L     ++I  ++    +W+ G +  +G +G+FPSNYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 35.8 bits (81), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 44  SPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV---NGREGMFP 100
           S + PP     V A Y +  Q  GDL    GD ++V +K + +W+ GT+       G FP
Sbjct: 2   SQINPPFK---VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFP 57

Query: 101 SNYV 104
            N+V
Sbjct: 58  KNFV 61

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 51  SLEYVEALYDFQPQQDG-DLAIRAGDKIQVLEK------PSAEWYRGTVNGREGMFPSNY 103
           +LE+  A+YDF P+    + +++ GD + ++ K       S  W   T  G  G  PSNY
Sbjct: 313 NLEFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNY 372

Query: 104 V 104
           +
Sbjct: 373 I 373

>ADL038W Chr4 (623309..627838) [4530 bp, 1509 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR310C (CDC25),
           YLL016W and YLL017W; YLL016W and YLL017W represent one
           ORF in this genome
          Length = 1509

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 32/77 (41%), Gaps = 14/77 (18%)

Query: 43  ASPVPPPM--SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV-------- 92
            S  PP +    + V AL DF P +   L ++AGD + VL +  + W  G +        
Sbjct: 6   TSSQPPTLVKCKDVVRALCDFVPLKKQHLPLKAGDVVYVLSRHESGWCDGIIIEQTAKGN 65

Query: 93  ----NGREGMFPSNYVR 105
                 + G FP  Y R
Sbjct: 66  STVTQCQRGWFPRTYTR 82

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 35.8 bits (81), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 55  VEALYDFQPQQ--DGDLAIRAGDKIQVLEKPSAEW--YRGTVNGREGMFPSNYV 104
           V ++YD++  Q  D +L  R GD+  V +   A+W   R   +G  G  P NYV
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYV 127

>TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa]
           {ON} Anc_7.365 YLR191W
          Length = 413

 Score = 35.4 bits (80), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 49  PMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEKPS-----AEWYR-GTVNGREGMFPS 101
           P  LE+  ALYDF P+    +  ++ G+ + +L++       +EW++  T NG  G  P 
Sbjct: 328 PSRLEFGRALYDFIPENPRIEATMKKGELLAILDRRDVFGNESEWWKVRTKNGSTGYVPY 387

Query: 102 NYV 104
           NY+
Sbjct: 388 NYI 390

>CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191w PAS20
          Length = 391

 Score = 35.0 bits (79), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 49  PMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEKP-----SAEWYR-GTVNGREGMFPS 101
           P  LE+  ALYDF P+    ++ ++ GD + ++ K      S++W++     G+ G  P 
Sbjct: 313 PSKLEFARALYDFTPENPQIEITLKKGDLVAIISKADPLGRSSDWWKVRNRAGQNGYAPY 372

Query: 102 NYV 104
           NY+
Sbjct: 373 NYL 375

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 35.0 bits (79), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREG---MFPSNYV 104
            LYDF+P++  +L   AGDKI +    + EW+  +     G   + P ++V
Sbjct: 169 VLYDFKPERPDELEANAGDKITIYAHHNDEWFIASHTDSSGKPYLIPIDFV 219

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           V+  + +  ++  DL    GD I+V  + + +WY G +  N ++G FPSNYV
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEVT-RVTGDWYFGKLIRNKKQGYFPSNYV 61

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 11/62 (17%)

Query: 55  VEALYDFQ--PQQDGD---LAIRAGDKIQVLEKPSAEWYRGTV----NGR--EGMFPSNY 103
           V A YDF    ++DG    L+++ GD I +L K S+ W+ G V    +G+   G FP N+
Sbjct: 66  VVAAYDFNHPTKKDGSSQLLSVQQGDTIYILNKNSSGWWDGLVIDDSSGKVDRGWFPQNF 125

Query: 104 VR 105
            R
Sbjct: 126 GR 127

>ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 396

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 49  PMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEK--PS---AEWYR-GTVNGREGMFPS 101
           P  LE+  ALYDF P+    +  ++ G+ + ++ K  PS   +EW++  T  G  G  P 
Sbjct: 310 PSKLEFARALYDFTPENPQIEAPLKKGELMAIITKQHPSGNNSEWWKVRTKTGNMGYVPF 369

Query: 102 NYV 104
           NYV
Sbjct: 370 NYV 372

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR--EGMFPSNYV 104
           A+YDF P+ D +LA++ GD + +  K    W       R   G+ P  YV
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV 144

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYV 104
           V+A+Y +  +++ DL     D I+V  K    WY G +  N + G FP+NYV
Sbjct: 12  VKAIYSWSGEKEYDLGFIEEDIIEVT-KAKGGWYYGRLLRNKKSGSFPANYV 62

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.319
           YDL117W
          Length = 919

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 7/70 (10%)

Query: 38  LPSNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGT-VNGRE 96
           + SN +S + PP     V A Y +  Q  GDL    GD ++V  + + +W+ G  +  R+
Sbjct: 1   MTSNISSSLKPPFK---VRAKYGWSGQAKGDLGFLEGDIMEVT-RVAGDWFYGKLLRNRK 56

Query: 97  --GMFPSNYV 104
             G FP+N+V
Sbjct: 57  CAGYFPNNFV 66

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 59  YDFQPQQDGDLAIRAGDKIQVLE-KPSAEWYRGTV--NGREGMFPSNYVR 105
           Y+F  +   +L +++GDK+ +L+ K S +W+   +  +G+ G+ P+ ++ 
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIE 404

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 12/64 (18%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L   +A+YD++PQ   +L I   D + +LEK    EW+  TV  R          G+ PS
Sbjct: 5   LGVYKAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWW--TVKKRVIGSDVVEPVGLVPS 62

Query: 102 NYVR 105
           NY+ 
Sbjct: 63  NYIE 66

>KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly
           similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 187

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWY--RGTVNGREGMFPSNYV 104
           ALYDF P+ D +L +R GD + +  +    W         R G+ P  YV
Sbjct: 73  ALYDFVPENDNELELREGDVLFIGYRHGQGWLVAENAERTRTGLVPEEYV 122

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 7/64 (10%)

Query: 44  SPVPPPMSLEY--VEALYDFQPQQDGDLAIRAGDKIQVL---EKPSAEWY--RGTVNGRE 96
           SP+ P +  +Y     + ++  + + +L +R GDKI+VL   E+ +  WY  R    G E
Sbjct: 31  SPISPKVQKQYPMYICINEYSKRMEDELDMRPGDKIEVLTDDEEYNDGWYFGRNLRTGEE 90

Query: 97  GMFP 100
           G++P
Sbjct: 91  GLYP 94

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 50  MSLEY-VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV---NGREGMFPSNYV 104
           MS+ + V+A Y +  Q  GDL    GD + V  K + +WY G +      +G FP N+V
Sbjct: 1   MSVAFMVKARYGWSGQAKGDLGFLEGDIMNV-TKTTGDWYYGFLLRNKKSKGYFPKNFV 58

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAE---WYRGT--VNGREGMFPSNYVR 105
           A+ ++Q + D +L +  GDKIQVL   S     WY G       +G++P N+ +
Sbjct: 26  AVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEKGLYPLNFTQ 79

>Kpol_1030.45 s1030 (102192..103358) [1167 bp, 388 aa] {ON}
           (102192..103358) [1167 nt, 389 aa]
          Length = 388

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 41  NGASPVPPPMSLEYVEALYDFQPQQDG-DLAIRAGDKIQVLEKPSA-----EWYR-GTVN 93
           NG +     + +E+  A YDF P+ +  ++ +   D + VL K  A      W++  T +
Sbjct: 307 NGETDSNGTVPIEFARACYDFTPENNKFEVPLNKDDIVAVLRKQDALGRNSNWWKVQTKD 366

Query: 94  GREGMFPSNYV 104
           G+ G  P NY+
Sbjct: 367 GKTGYVPYNYI 377

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%), Gaps = 3/49 (6%)

Query: 59  YDFQPQQDGDLAIRAGDKIQVL-EKPSAEWYRGTV--NGREGMFPSNYV 104
           YDF  +   +L + AGD + V+ ++ S+EW+   +   G++G+ P+++V
Sbjct: 403 YDFLAESHDELTVHAGDAVYVIDDQKSSEWWMVELISTGKKGVVPADFV 451

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 12/63 (19%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L   +A+Y ++PQ   +LAI   D + +LEK    +W+  TV  R          G+ PS
Sbjct: 5   LGIYKAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWW--TVKKRVLGTDADEPTGLVPS 62

Query: 102 NYV 104
           NYV
Sbjct: 63  NYV 65

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1136

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L   +A+Y+++PQ   +LAI+  D + +LEK    +W+  TV  R          G+ PS
Sbjct: 5   LGIYKAIYNYEPQTPEELAIQEDDLLYLLEKSDVDDWW--TVKKRVIGSDAEEPSGLIPS 62

Query: 102 NYV 104
           NY+
Sbjct: 63  NYI 65

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWY--RGTVNGREGMFPSNYV 104
           ALYDF+P+ D +L ++ GD I +  +    W   +     + G+ P  +V
Sbjct: 101 ALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFV 150

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNY 103
           ++ALY +  Q  G+L+   G+ + V+ +   EW+  +   +GR+GM P +Y
Sbjct: 69  LKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGRKGMVPKSY 118

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR---EGMFPSNYV 104
           Y   LYDF+ ++  +L+  AG+ + +    + EW+     GR    G+ P  +V
Sbjct: 150 YAIVLYDFKAEKSDELSAFAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFV 203

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 45  PVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV---NGREGMFPS 101
           P+ PP     V+A Y +  Q  GDL    GD ++V  + + +W+ G +       G FP+
Sbjct: 6   PLAPPFK---VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGKLLRNKKCSGYFPN 61

Query: 102 NYV 104
           N+V
Sbjct: 62  NFV 64

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 56  EALYDFQPQQDG--DLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           EALY +Q  Q    +++   G+ ++V +     W     NG  G+ PSNYV+
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {ON}
           Anc_8.539 YBR200W
          Length = 600

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR---EGMFPSNYV 104
           Y   LYDFQ ++  +L + AG+ + +    + EW+     GR    G+ P ++V
Sbjct: 162 YAIVLYDFQAEKSDELTVFAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV 215

>KLLA0E19735g Chr5 complement(1756682..1757908) [1227 bp, 408 aa]
           {ON} similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 7/69 (10%)

Query: 43  ASPVPPPMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLEKP-----SAEWYR-GTVNGR 95
           A  +  P +LE+  A+YDF P+    +  ++ GD + ++ K      ++EW++  T  G 
Sbjct: 303 AQQILDPNNLEFARAIYDFVPENPRIECNLKKGDLMAIISKKDPLGNNSEWWKVRTKQGN 362

Query: 96  EGMFPSNYV 104
            G  P NY+
Sbjct: 363 IGYVPYNYL 371

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           V+A + ++ + + DL       I V      EWY G    +EG+FP ++V+
Sbjct: 10  VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREG 97
           Y   LYDF+  ++ +L + AG+ + +      EW+ G   GR G
Sbjct: 165 YALCLYDFEAAKEDELTVYAGETLFIYAHYEEEWFIGRPLGRIG 208

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L   +A++ ++PQ D +LAI  GD + +L+K    +W+  TV  R          G+ P+
Sbjct: 5   LGIYKAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWW--TVKKRVIGSDAEEPVGLVPN 62

Query: 102 NYV 104
           NY+
Sbjct: 63  NYI 65

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 56  EALYDFQPQQDGDLAIRAGDKIQVL-EKPSAEWYRGTV--NGREGMFPSNYV 104
           + +YDF  +   +L I AG  + +L +K S +W+   +   G++G+ P+ +V
Sbjct: 379 KVVYDFIGESGDELTITAGQIVNILDDKKSKDWWMCELPETGKKGVVPAQFV 430

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 55  VEALYDFQPQQDG--DLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           V+ALY ++       +L+   GD ++V +     W     NG+ G+ PSNYV+
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVL---EKPSAEWY--RGTVNGREGMFP 100
           A+  +  + + +++I+ GDKIQV+   E  +  WY  R    G+EG+FP
Sbjct: 33  AVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFP 81

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR--EGMFPSNYV 104
           ALYDF P+ D +L +  GD + +  K    W      GR   G+ P  +V
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFV 156

>KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.365
           YLR191W
          Length = 314

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 8/76 (10%)

Query: 37  KLPSNGASPVPPPMS-LEYVEALYDFQPQQDG-DLAIRAGDKIQVL-EKPS----AEWYR 89
           ++ S G    P  ++ L++  ALYDF P+    ++ ++ GD + ++ EK +    ++W+R
Sbjct: 228 QILSKGLDDDPVDLTKLKFARALYDFVPENAKIEVPLKKGDLMAIISEKDTFGRDSQWWR 287

Query: 90  -GTVNGREGMFPSNYV 104
             T +G  G  P NYV
Sbjct: 288 VRTRDGNVGYIPYNYV 303

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 12/60 (20%)

Query: 56  EALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPSNYVR 105
           +A+Y+++PQ   +L I+  D + +LEK +  +W+  TV  R          G+ PSNYV 
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWW--TVKKRVIGSDIDEPAGLVPSNYVE 66

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 58  LYDFQPQQDGDLAIRAGDKIQVL-EKPSAEWYRGTV--NGREGMFPSNYVR 105
           LYDF  + + +L I+ G  + ++ ++ S +W+   +  +G+ G+ PS+++ 
Sbjct: 388 LYDFTAESNDELTIKQGQVVYIINDQKSKDWWLCELIDSGKRGVVPSHFIE 438

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 52  LEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPS 101
           L   +A+YD++PQ   +L ++  D + +LEK    +W+  TV  R          G+ PS
Sbjct: 5   LGVYKAIYDYEPQTPEELELKENDLLYLLEKSEVDDWW--TVKKRVIGSDAEEPVGLVPS 62

Query: 102 NYV 104
           NY+
Sbjct: 63  NYI 65

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVL-EKPSAEWYRGTV--NGREGMFPSNYV 104
           S +    L DF  + + +L ++ GD + +L +K S +W+   +   G +G+ P+ ++
Sbjct: 370 SKKQARVLVDFIAESNDELTVKEGDMVYILNDKKSKDWWMCELVKTGEKGVVPAQFI 426

>NCAS0C05710 Chr3 complement(1170253..1175283) [5031 bp, 1676 aa]
           {ON} Anc_4.45
          Length = 1676

 Score = 32.7 bits (73), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 10/64 (15%)

Query: 52  LEYVEALYDFQ---PQQDGDLAIRAGDKIQVLEKPSAEWYRG-------TVNGREGMFPS 101
           ++ V AL+DF     + +  L+ + GD I VL K ++ W+ G         N   G FP 
Sbjct: 84  IDIVVALFDFNYPLKKSNQHLSFQQGDTIYVLNKNNSGWWDGLTINDNNNTNINRGWFPQ 143

Query: 102 NYVR 105
            Y R
Sbjct: 144 TYTR 147

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 50  MSLEY-VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNG-----REGMFPSNY 103
           MS+ + VEAL+ +    + DL    G  I VLE    EW+ G         ++G+FP  +
Sbjct: 1   MSVPFKVEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGF 60

Query: 104 V 104
           V
Sbjct: 61  V 61

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 32.0 bits (71), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGRE--GMFPSNYV 104
           ALYDF+P+ D +L +  GD + +  K    W       R   G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>KNAG0D04450 Chr4 (805173..807233) [2061 bp, 686 aa] {ON}
          Anc_4.268 YDL074C
          Length = 686

 Score = 32.3 bits (72), Expect = 0.77,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 3  QSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPMSLEY 54
          + A+ R LN  RNE ++L E   +S+  + EI MKL +  A  V     LEY
Sbjct: 31 KEALFRCLNQRRNEYNYLHERYEVSKKSYMEISMKLANIIALVVTLAKFLEY 82

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 48  PPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV---NGREGMFPSNYV 104
           PP+  + V+A Y +  Q  GDL    GD ++V  + + +W+ G +       G FP+N+V
Sbjct: 8   PPLPFK-VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGRLLRNKKCSGYFPNNFV 65

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 32.0 bits (71), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR--EGMFPSNYV 104
           ALYDF+P+ D +L ++  D + +  K    W       R   G+ P  YV
Sbjct: 111 ALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYV 160

>Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W
           (HOF1) - SH3 domain containing-protein [contig 59] FULL
          Length = 627

 Score = 32.0 bits (71), Expect = 0.93,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 52  LEYVEALYDFQPQQDGDLA-IRAGDKIQVLEKPSAEWYRGTV--------NGREGMFPSN 102
           L+Y +ALY F    +  +   RAGD + + E+   +W+ G V          R G+ P N
Sbjct: 562 LKYAKALYTFMEANEQQIVNFRAGDYLLLTEQLDQDWFIGEVLDSHDVEPEYRYGIIPRN 621

Query: 103 YV 104
           Y+
Sbjct: 622 YI 623

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 31.6 bits (70), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGRE--GMFPSNYV 104
           ALYDF+P+ D +L +  GD + +  K    W       R   G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain-containing protein
           required for cytokinesis
          Length = 633

 Score = 32.0 bits (71), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 52  LEYVEALYDF-QPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNG--------REGMFPSN 102
           ++Y +ALY + +P ++  +  R  D I + ++ + +WY G V          R G+ P+N
Sbjct: 568 IKYAKALYTYMEPNENNLVNFRVDDYILLTKRLNQDWYLGEVYNAGGIEDRYRCGLVPAN 627

Query: 103 YV 104
           Y+
Sbjct: 628 YI 629

>KAFR0A02290 Chr1 (477162..479234) [2073 bp, 690 aa] {ON} Anc_2.591
           YMR032W
          Length = 690

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 21/86 (24%)

Query: 37  KLPSNGASPVPPPMS------LEYVEALYDFQPQQDGDLAIRA----GDKIQVLEKPSAE 86
           ++  NG     P +S      + Y +ALY   P  D D    A     D I + E  + +
Sbjct: 604 RVKDNGVVVTLPIVSKGGDKVIHYAKALY---PLLDNDAPTLAHFDKNDYILITEVINDD 660

Query: 87  WYRGTVNG--------REGMFPSNYV 104
           WYRG V G        R+G+ P N++
Sbjct: 661 WYRGEVYGNDMISPEYRDGLIPYNFI 686

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 12/59 (20%)

Query: 56  EALYDFQPQQDGDLAIRAGDKIQVLEKPSA-EWYRGTVNGR---------EGMFPSNYV 104
           +A+Y ++PQ   +LA++  D + +LEK    +W+  TV  R          G+ PSNY+
Sbjct: 9   KAIYSYEPQTPEELALQEDDFLYLLEKSEVDDWW--TVKKRVIGSDAEEPSGLVPSNYI 65

>TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 aa]
           {ON} Anc_8.539 YBR200W
          Length = 541

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 50  MSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREG 97
           M   Y   LYDFQ ++  +L   AG+ + +    + EW+     GR G
Sbjct: 148 MGTLYAIVLYDFQAEKSDELTAYAGENLFICAHHNYEWFIAKPIGRLG 195

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV--NGREGMFPSNYVR 105
           V ALY +  +Q  DL     D I+V  K   +W  G +  N + G FP  YV+
Sbjct: 12  VRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQ 63

>Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON}
           (120171..121835) [1665 nt, 555 aa]
          Length = 554

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR---EGMFPSNYV 104
           Y   LYDFQ ++  +L +  G+ + +    + EW+     GR    G+ P ++V
Sbjct: 156 YAIVLYDFQAEKSDELTVYVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV 209

>TDEL0B06840 Chr2 (1211695..1213485) [1791 bp, 596 aa] {ON}
           Anc_2.591 YMR032W
          Length = 596

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 15/84 (17%)

Query: 37  KLPSNGASPVPPPMSLE------YVEALYDFQPQQDGDLA-IRAGDKIQVLEKPSAEWYR 89
           ++  NG +   P M+ E      Y +A+Y        +LA  + GD + +    + EW+R
Sbjct: 510 RVRDNGITVTLPIMTSEGEPVIRYAKAVYPLLDNDAAELAHFQKGDYLLITLMVNEEWFR 569

Query: 90  GTVNG--------REGMFPSNYVR 105
           G V G        R G+ P N+++
Sbjct: 570 GEVYGNDMIESTHRNGLIPYNFIQ 593

>NCAS0E02790 Chr5 (551328..552467) [1140 bp, 379 aa] {ON} Anc_7.365
           YLR191W
          Length = 379

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 7/79 (8%)

Query: 33  EIMMKLPSNGASPVPPPMSLEYVEALYDFQPQQ-DGDLAIRAGDKIQVLE------KPSA 85
           E   K   N    +  P  +E+  ALYDF P+    +  ++ G+ + ++       + S 
Sbjct: 285 ENQQKFLKNNNKEIIDPNKIEFARALYDFVPENPQIEAELKKGELMAIISQRDPVGRESN 344

Query: 86  EWYRGTVNGREGMFPSNYV 104
            W   T +G  G  P NY+
Sbjct: 345 WWKVRTKDGSMGYVPYNYI 363

>Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar to
           Ashbya gossypii AGR306C
          Length = 1024

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 5/55 (9%)

Query: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV-----NGREGMFPSNYV 104
           V A + ++ +   DL    G KI V+     +WY G         REG+FP ++V
Sbjct: 13  VVAQFSYKSEYKHDLHFDKGQKILVISIEDNQWYYGHFVDSEGKQREGIFPKSFV 67

>AGL169C Chr7 complement(381327..382085) [759 bp, 252 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR162C
           (NBP2)
          Length = 252

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWY--RGTVNGREGMFPSNYV 104
           ALYDF P+ D +L ++ G  + +  K    W     +   R G+ P  YV
Sbjct: 115 ALYDFVPENDNELELQEGSIVYISYKHGQGWLVAEDSARTRTGLVPEEYV 164

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 49  PMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV------NGREGMFPSN 102
           PM +  V+  ++   +++  L+++ GD + VL K  + W+ G +          G FP N
Sbjct: 18  PMDVVVVQFEFNAGNKKEKYLSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQN 77

Query: 103 YVR 105
           Y +
Sbjct: 78  YTK 80

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 31.6 bits (70), Expect = 1.3,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWY---RGTVNGREGMFPSNYV 104
           S E  + LY +  Q D ++++  GD I+++   S   +   R    G EG+ P+ Y+
Sbjct: 502 SDEENKVLYAYTQQDDDEISVTPGDVIELVTPDSGSGWTQIRNVTTGAEGLVPTTYI 558

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 52  LEYVEALYDFQPQQDGDLA-IRAGDKIQVLEKPSAEWYRGTV--------NGREGMFPSN 102
           +EY +A+Y     +   LA    GD I + E  + +WY+G V        N R G+ P N
Sbjct: 595 IEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYN 654

Query: 103 YVR 105
           +++
Sbjct: 655 FIQ 657

>Suva_10.58 Chr10 (117228..121007) [3780 bp, 1259 aa] {ON} YLL016W
          (REAL)
          Length = 1259

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 27/56 (48%)

Query: 37 KLPSNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV 92
          K+  N    VP    ++ VE  Y+   +    L++R GD + VL K +  W+ G +
Sbjct: 12 KIKDNEGHEVPCLQPIDVVECTYEHFSESRDKLSLRLGDLVYVLNKGTNGWWDGVL 67

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 56  EALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVN---GREGMFPSNYVR 105
           + LY +  Q   +++I  GDKI ++ + S   +    N   G  G+ P+ YVR
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVR 551

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWY--RGTVNGREGMFPSNYV 104
           ALYDF P+ D +L +  GD I +  K    W   +   N + G+ P  +V
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFV 154

>Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp,
          1252 aa] {ON} ANNOTATED BY YGOB - skipping over
          frameshift in strain S288c
          Length = 1252

 Score = 31.2 bits (69), Expect = 1.8,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 46 VPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV 92
          +P    ++ VE  Y +  +    L++R GD I VL K S  W+ G +
Sbjct: 22 IPCLQPIDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDGVL 68

>Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310C
           (CDC25) - 1:1 [contig 225] FULL
          Length = 1517

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 27/65 (41%), Gaps = 10/65 (15%)

Query: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWY----------RGTVNGREGMFP 100
           +L+ V A  DF   +   L +  GD + VL K  + W+          RG      G FP
Sbjct: 22  ALDVVIASCDFVATKKSQLRLNVGDVVYVLGKNESGWWDGVVVSPGGVRGAHRCVRGWFP 81

Query: 101 SNYVR 105
            N+ R
Sbjct: 82  QNHTR 86

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
           YER114C
          Length = 1555

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 58  LYDFQPQQDGDLAIRAGDKIQVL---EKPSAEWYRGT--VNGREGMFP 100
           + ++  + D +L ++ GDKIQV+   E+ +  WY G     G EG++P
Sbjct: 55  INEYTKRMDDELDMKPGDKIQVITDDEEYNDGWYFGKNLRTGEEGLYP 102

>Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016W
          (REAL)
          Length = 1254

 Score = 31.2 bits (69), Expect = 1.9,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 46 VPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTV 92
          VP    ++ VE +Y+   +    L++R GD + VL K S  W+ G +
Sbjct: 22 VPCLQPIDVVECIYEHFTESRDKLSLRIGDMVYVLNKGSNGWWDGVL 68

>CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032w HOF1
           involved in cytokinesis
          Length = 712

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 9/63 (14%)

Query: 52  LEYVEALYDFQPQQDGDLA-IRAGDKIQVLEKPSAEWYRGTVNGRE--------GMFPSN 102
           +++ +ALY     +  +LA    GD + + E  + +WYRG V G          G+ PSN
Sbjct: 644 IKFAKALYPLINSEAQELANFEKGDYLLLTEVVNEDWYRGEVYGNSNTTTTHGNGLIPSN 703

Query: 103 YVR 105
           +++
Sbjct: 704 FIQ 706

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR--EGMFPSNYV 104
           ALYDF+P+ D +L +  GD + +  +    W       R   G+ P  +V
Sbjct: 117 ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQPRTKTGLVPEEFV 166

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 55  VEALYDFQPQQDGD---LAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYV 104
           V+ALY +Q   D D   ++   G+ ++V +     W     NG+ G+ PSNYV
Sbjct: 311 VKALYSYQAD-DADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYV 362

>TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON}
           Anc_7.413 YER114C
          Length = 1011

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVL---EKPSAEWY--RGTVNGREGMFPSNYVR 105
           A+ ++  + + +L  R GDKIQVL   E+ +  WY  R      EG++P+ + +
Sbjct: 80  AINEYSKRMEDELDFRPGDKIQVLLDDEEYNDGWYFGRNLRTQEEGLYPAVFTQ 133

>SAKL0C00924g Chr3 (81919..84351) [2433 bp, 810 aa] {ON} some
           similarities with uniprot|Q04412 Saccharomyces
           cerevisiae YDR524C AGE1 ADP-ribosylation factor (ARF)
           GTPase activating protein (GAP) effector, involved in
           the secretory and endocytic pathways
          Length = 810

 Score = 30.8 bits (68), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query: 28  EGCFKEI------MMKLPSNGASPVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLE 81
           EG FKE+      +   P + A+P  PP  L  V++L D   +Q  + A +A     +L 
Sbjct: 192 EGSFKELQQLATQITGKPGSTAAPASPPPFLATVQSLGDLFRRQSSEYASQAKSTADLLF 251

Query: 82  KPSAEWYRGTVNGR 95
           +P   +    ++ R
Sbjct: 252 QPLQAYVSSALDSR 265

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGR--EGMFPSNYV 104
           ALYDF+P+ D +L ++ GD + +  +    W       R   G+ P  +V
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFV 182

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGRE--GMFPSNYVR 105
           A+Y F P+ D +L ++ GD + +  K    W     + R   G+ P  YV+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQ 117

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWY--RGTVNGREGMFPSNYV 104
           ALYDF+P+ D +L +  GD + +  K    W         + G+ P  +V
Sbjct: 117 ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFV 166

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 14/88 (15%)

Query: 32  KEIMMKLPSNGASPVPPPMSL-----------EYV-EALYDFQPQQDG--DLAIRAGDKI 77
           ++  + +PSNG +      +L            YV +ALY +Q  +    +++   G+ +
Sbjct: 237 EDTFLSMPSNGNTESTMGDTLGLYSDIADDNFAYVAKALYSYQADESDQYEISFEQGEIL 296

Query: 78  QVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           +V +     W     NG  G+ PSNYV+
Sbjct: 297 RVSDIEGRWWKAKRENGETGIIPSNYVQ 324

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 56  EALYDFQPQQ-DG-DLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105
           +ALY +Q    DG +++   G+ ++V +     W     NG+ G+ PSNYV+
Sbjct: 300 KALYSYQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,064,003
Number of extensions: 590780
Number of successful extensions: 1669
Number of sequences better than 10.0: 285
Number of HSP's gapped: 1552
Number of HSP's successfully gapped: 330
Length of query: 202
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 98
Effective length of database: 41,556,135
Effective search space: 4072501230
Effective search space used: 4072501230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)