Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0F03421g8.831ON81781741260.0
TDEL0B006608.831ON9598438661e-102
Suva_13.358.831ON9827806986e-78
Skud_13.4458.831ON8986135556e-59
Smik_13.4868.831ON9236065159e-54
YMR273C (ZDS1)8.831ON9156165132e-53
Suva_13.4618.831ON9316165016e-52
KAFR0A027708.831ON8844524662e-47
NDAI0E003508.831ON11631154583e-46
NCAS0B011108.831ON9931794573e-46
KNAG0G033708.831ON1076974556e-46
KLLA0D01683g8.831ON944974511e-45
ZYRO0G13992g8.831ON12114204494e-45
Kpol_541.108.831ON1056964451e-44
Kpol_1069.28.831ON10011644422e-44
SAKL0D01716g8.831ON9424554342e-43
TPHA0I002008.831ON10491684262e-42
AAL185W8.831ON1018954236e-42
KAFR0B038608.831ON843984208e-42
KLTH0C04048g8.831ON9351364201e-41
Smik_13.258.831ON9491004182e-41
Kwal_27.103188.831ON9253054074e-40
CAGL0J06688g8.831ON828934039e-40
Skud_13.328.831ON948934031e-39
TBLA0B032008.831ON1086984041e-39
TPHA0C047208.831ON10721223924e-38
YML109W (ZDS2)8.831ON9425023852e-37
TBLA0D031908.831ON1682913792e-36
Ecym_27108.831ON8962723541e-33
Skud_14.8singletonON7486890.003
Kwal_56.226373.102ON59585717.5
Suva_13.1922.574ON37856709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F03421g
         (817 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {...  1593   0.0  
TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...   338   e-102
Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W (...   273   6e-78
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...   218   6e-59
Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {...   202   9e-54
YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...   202   2e-53
Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {...   197   6e-52
KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {O...   184   2e-47
NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.83...   181   3e-46
NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {O...   180   3e-46
KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {...   179   6e-46
KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {...   178   1e-45
ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa...   177   4e-45
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...   176   1e-44
Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..45...   174   2e-44
SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...   171   2e-43
TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON...   168   2e-42
AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homo...   167   6e-42
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...   166   8e-42
KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} simila...   166   1e-41
Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W (...   165   2e-41
Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273...   161   4e-40
CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] ...   159   9e-40
Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W (...   159   1e-39
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...   160   1e-39
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...   155   4e-38
YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein...   152   2e-37
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...   150   2e-36
Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar...   140   1e-33
Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [2...    39   0.003
Kwal_56.22637 s56 (213527..215314) [1788 bp, 595 aa] {ON} YDR484...    32   7.5  
Suva_13.192 Chr13 (312330..313466) [1137 bp, 378 aa] {ON} YMR024...    32   9.8  

>CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {ON}
           similar to uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 817

 Score = 1593 bits (4126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 783/817 (95%), Positives = 783/817 (95%)

Query: 1   MGNQNSEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYNNGYRNSWSTQLEQ 60
           MGNQNSEVYIAAQSLDKELRSVKNLKRLSIGS             YNNGYRNSWSTQLEQ
Sbjct: 1   MGNQNSEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDMLPYNNGYRNSWSTQLEQ 60

Query: 61  GDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTRRG 120
           GDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTRRG
Sbjct: 61  GDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTRRG 120

Query: 121 AVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDALHN 180
           AVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDALHN
Sbjct: 121 AVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDALHN 180

Query: 181 IQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIK 240
           IQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIK
Sbjct: 181 IQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIK 240

Query: 241 EQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETD 300
           EQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETD
Sbjct: 241 EQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETD 300

Query: 301 DLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKYTYHIRTQEDKDPT 360
           DLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKYTYHIRTQEDKDPT
Sbjct: 301 DLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKYTYHIRTQEDKDPT 360

Query: 361 IPVSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKI 420
           IPVSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKI
Sbjct: 361 IPVSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKI 420

Query: 421 VQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTSDKHENEDIV 480
           VQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTSDKHENEDIV
Sbjct: 421 VQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTSDKHENEDIV 480

Query: 481 PESRFNHSKNRHEPLYNHKIEIANTLGTLPEKKNAIDKKISNIFRRKHHTRRANQENSLA 540
           PESRFNHSKNRHEPLYNHKIEIANTLGTLPEKKNAIDKKISNIFRRKHHTRRANQENSLA
Sbjct: 481 PESRFNHSKNRHEPLYNHKIEIANTLGTLPEKKNAIDKKISNIFRRKHHTRRANQENSLA 540

Query: 541 GLKISQLQWRNNDHKEKAVEAXXXXXXXXGSEKVLAEAVEVRTHSSYTPQGNVHVKNEYQ 600
           GLKISQLQWRNNDHKEKAVEA        GSEKVLAEAVEVRTHSSYTPQGNVHVKNEYQ
Sbjct: 541 GLKISQLQWRNNDHKEKAVEATNNTEENNGSEKVLAEAVEVRTHSSYTPQGNVHVKNEYQ 600

Query: 601 TNNVENTNVREIPTANNGIEKEIIPEVSKHQNHQQQKSTARPAHSSKFRITEKXXXXXXX 660
           TNNVENTNVREIPTANNGIEKEIIPEVSKHQNHQQQKSTARPAHSSKFRITEK       
Sbjct: 601 TNNVENTNVREIPTANNGIEKEIIPEVSKHQNHQQQKSTARPAHSSKFRITEKQTQGQDQ 660

Query: 661 XXXXXXAHGSDIGGVSLQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPL 720
                 AHGSDIGGVSLQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPL
Sbjct: 661 GQDQGQAHGSDIGGVSLQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPL 720

Query: 721 YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSH 780
           YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSH
Sbjct: 721 YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSH 780

Query: 781 LKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQKS 817
           LKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQKS
Sbjct: 781 LKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQKS 817

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
           YMR273C
          Length = 959

 Score =  338 bits (866), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 281/843 (33%), Positives = 405/843 (48%), Gaps = 225/843 (26%)

Query: 118 RRGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDA 177
           RRG VN  +R+    S+ S N S+ + +    + + LLWV A QHP+VKPEN++ELVQD 
Sbjct: 164 RRGGVNIPTRK---LSSASDNGSE-DGSNSSSITKQLLWVPAAQHPSVKPENFLELVQDT 219

Query: 178 LHNIQIDK--------TEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYT 229
           LHNIQ+D+         +E +KEN+   D++    +   KR      LVRRPS LRKSYT
Sbjct: 220 LHNIQLDEKKETTDNDNDESNKENAKAYDRLP--IDITRKRD----SLVRRPSRLRKSYT 273

Query: 230 EFDEVKDSDIKEQS-------------STNNNVDSTPHNKKFTLKDITEELTRISNKAGL 276
           EF+E  +++  E S             S+     S   ++  +LKDITEEL +ISN AGL
Sbjct: 274 EFEEYDETESLEGSVAVGKESRNSFERSSIAPCSSGRSSRTVSLKDITEELNKISNNAGL 333

Query: 277 TNNDAVTLARTLSMA---SVAEEDETDDLQER----PEAEDDYARQSRNNDDNYASTMLL 329
           T++DA+TLARTLSMA   + +E +E  D  +R     +A+D     ++ +D+ +AS ML+
Sbjct: 334 TSSDAITLARTLSMAGSFASSEVNEDYDTSKRNGIHLDADDVQNEYNKEDDNEFASNMLM 393

Query: 330 PTDSLIKSEHSTLKRSKY-TYHIRTQEDKDPT-------------------IPVSTESQH 369
               +I +  S+L+RSK+ TY +R+                          +   + +  
Sbjct: 394 KHGVVIPA-RSSLRRSKFNTYRVRSSGSTSSLDDEHHESETKRKLSSGLENVTAESSASQ 452

Query: 370 QDV-----------IEASPGSIN---DIYDHYREPSGDWSSLIQVAPENENK-KRTDTDI 414
           QD+           I +SP SIN   DIYDHYR+PS DW   ++   E+++  K    D 
Sbjct: 453 QDIYHSPSIKGNGSIMSSPSSINDFQDIYDHYRQPSVDWEKELKKGTESDDSNKGNQLDF 512

Query: 415 DSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPA----HRKKRNGWLW-----SSKTSE 465
           +++ +I       +  G+   S+ +  D+ +         + KR+GW W     S +T+ 
Sbjct: 513 ETSKEIASSKLSDLSQGN-AKSSIEAQDMEQASSTVVREMKGKRSGWSWLNGMGSKETNT 571

Query: 466 KVNVT-------------SDKHENEDIVPES--------RFNHSKNRHEPLY-------- 496
           + NV              SD H +ED    S        R NHSKNRH P++        
Sbjct: 572 EKNVKDTARQEVPLHREPSDSHIDEDFEKTSTPVTTEIQRSNHSKNRHLPIFPANESSKR 631

Query: 497 ---NHKIEIANTLGTLPEK------KNAIDKKISNIFRRKHHTRRANQENSLAGLKISQL 547
                +  ++  +G           +   +KKI+N+FRRK   +  +   S         
Sbjct: 632 KDTTEEPAVSTKMGRSSSSDSSNLTRQMFEKKIANLFRRKGKKKLPDYGTS--------- 682

Query: 548 QWRNNDHKEKAVEAXXXXXXXXGSEKVLAEAVEVRTHSSYTPQGNVHVKNEYQTNNVENT 607
                DH    +++           K     V++R+ S        H++N    + V +T
Sbjct: 683 ----RDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEE----HLRNSVSKDVVPDT 734

Query: 608 NVREIPTANNGIEKEIIPEVSKHQNHQQQKSTARPAHSSKFRITEKXXXXXXXXXXXXXA 667
            +         +  E+IP  SK ++         PA                        
Sbjct: 735 AI---------VAGEVIPSKSKAED--------LPA------------------------ 753

Query: 668 HGSDIGGVSLQPAVNVTSTKN------QEIVIQNV----------------------TVT 699
                    LQPAV+VTSTK+        +VI++V                        T
Sbjct: 754 ---------LQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQDVSMDQNAQTSIDIST 804

Query: 700 ATPSQREEATDSSKTASKKPL-------YPPRKLTFADVKKKDKANAPIEFTDSAFGFPL 752
            T S +E+ T   +T  K+P         PPRKLTF DVK+ +++NAP++FTDSAFGFPL
Sbjct: 805 ETLSMKEQ-TSEVQTDVKQPADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPL 863

Query: 753 PELTYSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLY 812
           P LT STVIMFDHRLPI+VERAIYRLSHLKLS+ KR LR+QV+LSNFMY+YLNLVNHTLY
Sbjct: 864 PMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLY 923

Query: 813 MEQ 815
           MEQ
Sbjct: 924 MEQ 926

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 25/27 (92%)

Query: 6  SEVYIAAQSLDKELRSVKNLKRLSIGS 32
          SEV IAAQS+D E+++VK+LKR+SIGS
Sbjct: 34 SEVLIAAQSIDNEVQNVKSLKRISIGS 60

>Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W
           (REAL)
          Length = 982

 Score =  273 bits (698), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 246/780 (31%), Positives = 357/780 (45%), Gaps = 187/780 (23%)

Query: 150 VAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNK 209
           + QNLLWV A QHPNVKPENY+ELVQD L NIQI   ++ D++NSD     + +  SN +
Sbjct: 245 LTQNLLWVPASQHPNVKPENYLELVQDTLQNIQITTDQDPDEKNSDL---SNNHVFSNRQ 301

Query: 210 RSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVD------STPHNKKFTLKDI 263
           RS     +VRRPS L+ SYT+FD+ + S +  Q   +   +       T   +  +LK+I
Sbjct: 302 RS---GSIVRRPSHLKTSYTKFDD-EPSSVDRQRQGHGQAEKRISSLETKSIRCVSLKEI 357

Query: 264 TEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNY 323
           TEELT+IS+ AGLT++DA+TLAR+LSM+     +       + ++++++A    N     
Sbjct: 358 TEELTKISDNAGLTDSDAITLARSLSMSGSFTNESLHLSSNKTDSDNEFASNMFN----- 412

Query: 324 ASTMLLPTDSLIKSEHSTLK------------RSKYTYHIRTQED-KDPTIPVSTESQHQ 370
            S + +P  SL +S+ +T K            R     +++T +D +  + P S     Q
Sbjct: 413 KSGLTIPERSLRRSKFNTYKIRLENNDLLPTGRPNSLMNVQTNDDRRRASSPASYTQPPQ 472

Query: 371 DVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTD-TDIDSNTKIVQHSTEHVD 429
           D  +       +I++HYR  S DW +        EN K  D T+  S+ + + H++   D
Sbjct: 473 D--QTPLNDFQEIFEHYRRTSTDWGT--------ENTKYVDNTNYYSDEEDLTHASISQD 522

Query: 430 LGSTGHSTSDKS--------------------------DINKKEPAHRKKRNGWLWSSKT 463
                  +S+ S                          DI+  EP H     GW W +  
Sbjct: 523 SSFLSTDSSNNSVLVKPHNAGSMISERLDQDIASNENEDIDINEPNH-----GWSWLNSA 577

Query: 464 SEKVN--------VTSDKHENEDIVPE---------------------SRFNHSKNRHEP 494
           +E +         V  D+ +  D V +                      R NHSKNRH P
Sbjct: 578 NENLTNYDGAYEQVIDDEEDIGDCVEDEKADFVNLSVSRRAKSTKRASERINHSKNRHSP 637

Query: 495 LYNHKIEIA----------------NTLGTLPE-----------------KKNAIDKKIS 521
           ++  + + +                +T    P                  KK++++K+++
Sbjct: 638 IFQMQSDESKSVVVTSSVTSLSPSQSTESAAPAVVEKEQGSPNDNKPPAHKKHSLEKRLA 697

Query: 522 NIFRRKHHTRRANQENSLAGLKISQLQWRNNDHKEKAVEAXXXXXXXXGSEKVLAEAVEV 581
            +F+RK H   +  +  +    + Q   +   H   +            S K  ++ VEV
Sbjct: 698 RLFKRKQHNNNSKSDAKVIKKNVKQELKKKTSHSSLS--------KFRKSPKKKSQQVEV 749

Query: 582 RTHSSYTPQGNVHVKNEYQTNNVENTNVREIPTANNGIEKEIIPEVSKHQNHQQQKSTAR 641
               S +P              VE  + R + T    IE E I E               
Sbjct: 750 VQDRSSSP--------------VETVSTRILDTP---IEIEPIVE--------------N 778

Query: 642 PAHSSKFRITEKXXXXXXXXXXXXXAHGSD---IGGVSLQPAVNVTSTKNQEIVIQNVTV 698
           P +S+ F                    G D   I G  +   V VT+  + +        
Sbjct: 779 PTNSNIFSGGNTNHSSELVVETINELDGDDSFDISGGDINYNVEVTANMDTD-------T 831

Query: 699 TATPSQR--EEATDSSKTASKK-PLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPEL 755
           TA P++R  EE  D+  T + +  +  P+KLTF DV   +  NAPI+FTDSAFGFPLP +
Sbjct: 832 TAEPNERVGEEDEDTVPTLTPQLSILLPKKLTFEDVITPEYPNAPIKFTDSAFGFPLPMI 891

Query: 756 TYSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           T STVIMFDHRL I+VERAIYRLSHLKLS+  R LR+QVLLSNFMYSYLNLVNHTLYMEQ
Sbjct: 892 TNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 951

>Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {ON}
           YMR273C (REAL)
          Length = 898

 Score =  218 bits (555), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 212/613 (34%), Positives = 294/613 (47%), Gaps = 140/613 (22%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYN--NGYRNSWS------TQ 57
           SEV IAAQSLD E+RSVKNLKRLSIGS                 NG R SWS      T 
Sbjct: 28  SEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFCGESNG-RRSWSGTTSKPTS 86

Query: 58  LEQGDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLT 117
              G   + +TRYSDPT            P +    ++S   +T  +N +   GS  S  
Sbjct: 87  APNGTTGMNNTRYSDPT------------PLENLHERRSSGIETCAKNKQ---GS--STG 129

Query: 118 RRGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDA 177
            +  V+  SR+                   + + +NLLWV A+QHPNVKP+NY+ELVQD 
Sbjct: 130 HKRGVHSPSRK----------------LTANALKKNLLWVPANQHPNVKPDNYLELVQDT 173

Query: 178 LHNIQI-------------------DKTEEH-DKENSDTLDKVSRYYNSNNKRSPNNTGL 217
           L NI++                   ++TE H +KEN +T+D      N    R   N  L
Sbjct: 174 LQNIRLGDNDDNDDENDKNENNRVTEETESHGNKENMNTVD-----LNRGMLRH-GNASL 227

Query: 218 VRRPSLLRKSYTEFDEVKDSDIK--EQSSTNNNVD---STPHNKKFTLKDITEELTRISN 272
           +RRPS LR+SYTEFD+++D + +  E S T N V+   S    +  +L+DITEELT+ISN
Sbjct: 228 IRRPSTLRRSYTEFDDIEDDNGQRNEASKTVNRVEERTSRIKERPVSLRDITEELTKISN 287

Query: 273 KAGLTNNDAVTLARTLSMASV----AEEDETDDLQERPEAEDDYARQSR---NNDDNYAS 325
            AGLTNND +TLARTLSMA        E    DL++  E E      S+   ++D  YAS
Sbjct: 288 SAGLTNNDTITLARTLSMAGSYSDGGNEAGPKDLKDDYEGESIGVASSQRKASDDGEYAS 347

Query: 326 TMLLPTDS-LIKSEHSTLKRSKY-TYHIRTQEDK---------------------DPTIP 362
            M  PT++ +   E S+LKRS++ TY IR+QE +                     D T+ 
Sbjct: 348 NM--PTNNDMTGPERSSLKRSRFNTYRIRSQEQEKEEEQNVEETKNEEAGRLHLTDKTLK 405

Query: 363 VSTES------QHQDVIE--ASPGSIN---DIYDHYREPSGDWSSLIQVAPENENKKRTD 411
              ES      Q  D  E  +SPGS+    DIYDHYR+ SGDW     +    + ++ T 
Sbjct: 406 TEIESPKSPFGQEDDESEYASSPGSVGDFQDIYDHYRQFSGDWEQEEGIE---KEEEPTA 462

Query: 412 TDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTS 471
             +  +T       + ++LG      +  +D +K+   HR +RNGW W +    K N   
Sbjct: 463 AMLPDDT-----VEQQLELGEESAGMNKSTDDSKETKRHR-RRNGWTWLNSKMNKENDNE 516

Query: 472 DKH---ENEDIVPESRF--NHSKNRHEPLYNH----------KIEIANTLGTLPEKKNAI 516
           +     ENE+ V   +    +SK  H  L+N           ++  AN   T  + +  I
Sbjct: 517 ENQGDDENEESVESQKMERENSKKHHISLFNGGEKNEPSSKDEVNSANVPTTTSQTRQKI 576

Query: 517 DKKISNIFRRKHH 529
           +K  +N+FRRK H
Sbjct: 577 EKTFANLFRRKPH 589

 Score =  187 bits (475), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/179 (54%), Positives = 117/179 (65%), Gaps = 34/179 (18%)

Query: 673 GGVSLQPAVNVTSTKNQE-------------------IVIQNVTVTATPSQREEATDSSK 713
           G + LQPAVNV+STK+                     I + N  +T    + +     ++
Sbjct: 703 GLLQLQPAVNVSSTKSNRRDTEEAETRKQNKKKRGDTIDLPNERLTKDVQKEKAHERKAQ 762

Query: 714 TASKKP---------------LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYS 758
             ++ P               + PPRKLTFADVKK +K NAP++F+DSAFGFPLP LT S
Sbjct: 763 VQTEAPVQVQAPVAPPLRHTSVLPPRKLTFADVKKPEKPNAPVQFSDSAFGFPLPLLTVS 822

Query: 759 TVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQKS 817
           TVIMFDHRLPI+VERAIYRLSHLKLSNSKR LREQVLLSNFMY+YLNLVNHTLYMEQ +
Sbjct: 823 TVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQAA 881

>Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {ON}
           YMR273C (REAL)
          Length = 923

 Score =  202 bits (515), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 212/606 (34%), Positives = 302/606 (49%), Gaps = 131/606 (21%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXX--XXXXXXXXXXXYNNGYRNSW------STQ 57
           SEV IAAQSLD E+RSVKNLKRLSIGS                +NG R SW      S  
Sbjct: 28  SEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNG-RRSWSGTAYNSAS 86

Query: 58  LEQGDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLT 117
              G   + +TRYSDPT            P  +N  ++ D    ++E++ K   S  + +
Sbjct: 87  TPGGTTRMNNTRYSDPT------------PL-ENLHERGD---LKLESSDKGRQSNYAGS 130

Query: 118 RRGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDA 177
           ++G              HS  S K+N    + + +NLLWV A+QHPNVKP+NY+ELVQD 
Sbjct: 131 KKGV-------------HS-TSRKLN---ANALKKNLLWVPANQHPNVKPDNYLELVQDT 173

Query: 178 LHNIQIDKTEEHDKENSDTLDKV-SRYY--------NSNNKRSPNNTG-LVRRPSLLRKS 227
           L NIQ++ +E+++ + ++      S+ Y        N N   S + T  L+RRPS LR+S
Sbjct: 174 LQNIQLNGSEDNNDDQNNGNKNSGSKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRS 233

Query: 228 YTEFDEVKDSDIKEQSSTNNNVD---STPHNKKFTLKDITEELTRISNKAGLTNNDAVTL 284
           YTEFD+ +D +    S T N V+   S    +  +L+DITEELT+ISN AGLT+NDA+TL
Sbjct: 234 YTEFDDSEDDN--GDSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITL 291

Query: 285 ARTLSMASVAEEDETDDL----QERPEAEDD---YARQSRNNDDN-YASTMLLPTDSLIK 336
           ARTLSMA  +  D+ D+     QE    E+D      Q+  +DD  YAS M +  +++  
Sbjct: 292 ARTLSMAG-SYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPI-NNNMTW 349

Query: 337 SEHSTLKRSKY-TYHIRTQEDK------------------------------DP-TIPVS 364
            E S+L+RS++ TY IR QE +                              DP   P  
Sbjct: 350 PERSSLRRSRFNTYRIRQQEQEKEVEEDKEKIKDYETEHHLPLANNTSKTAIDPHKSPFR 409

Query: 365 TESQHQDVIEASPGSIN---DIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKIV 421
            +++  + + +SPGSI    DIYDHYR+ SG+W   + +  E E    T  +IDS  + +
Sbjct: 410 QQAEEPESM-SSPGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVA-TKFEIDSLEQDL 467

Query: 422 QHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTSDKH------E 475
           +   E V     G   S  ++ NK+   HR +RNGW W    + K+N   D        E
Sbjct: 468 ELREEPV-----GVIKSSSTEENKETKRHR-RRNGWTW---LNNKMNRDDDNEGNQRDDE 518

Query: 476 NEDIVPESRF--NHSKNRHEPLYN--HKIEIAN--------TLGTLPEKKNAIDKKISNI 523
           NE+ +   R    +SK  H  L+N   K E +N           T  + +  I+K  +N+
Sbjct: 519 NEENMDSQRMERENSKRHHISLFNGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANL 578

Query: 524 FRRKHH 529
           FRRK H
Sbjct: 579 FRRKPH 584

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score =  202 bits (513), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 214/616 (34%), Positives = 305/616 (49%), Gaps = 144/616 (23%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYN-NGYRNSWS-TQLEQGDK 63
           SEV IAAQSLD E+RSVKNLKRLSIGS                +  R SWS T       
Sbjct: 28  SEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESSGRRSWSGTTSSSASM 87

Query: 64  P-----LKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTR 118
           P     + +TRYSDPT         E L  + N         + +E++ K        T+
Sbjct: 88  PSDTTTVNNTRYSDPTPL-------ENLHGRGN---------SGIESSNK--------TK 123

Query: 119 RGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDAL 178
           +G  N+     + +  HS  S K+N  +   + +NLLWV A+QHPNVKP+N++ELVQD L
Sbjct: 124 QG--NYLG---IKKGVHSP-SRKLNANV---LKKNLLWVPANQHPNVKPDNFLELVQDTL 174

Query: 179 HNIQI-DKTEEHDK---ENSDT----LDKVSRYYNSNNKRSPN---------NTGLVRRP 221
            NIQ+ D  E++D    EN+D      DK S+ Y +    + N         N  L+RRP
Sbjct: 175 QNIQLSDNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGLSRHGNASLIRRP 234

Query: 222 SLLRKSYTEFDEVKDSDIKEQSS--TNNNVD---STPHNKKFTLKDITEELTRISNKAGL 276
           S LR+SYTEFD+ +D D K  S+  T N V+   S    +  +L+DITEELT+ISN AGL
Sbjct: 235 STLRRSYTEFDDNEDDDNKGDSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGL 294

Query: 277 TNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDY--------ARQSRNNDDN-YASTM 327
           T+NDA+TLARTLSMA         D +++P+ E  Y          Q+   DD  +AS M
Sbjct: 295 TDNDAITLARTLSMAG-----SYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNM 349

Query: 328 LLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDPTIPVSTESQHQDVIE------------ 374
            +  +++   E S+L+RS++ TY IR+QE ++  +  S +    D  E            
Sbjct: 350 PI-NNTMTWPERSSLRRSRFNTYRIRSQE-QEKEVEQSVDEMKNDDEERLKLTKNTIKVE 407

Query: 375 ------------------ASPGSIN---DIYDHYREPSGDWSSLIQVAPENEN---KKRT 410
                             +SPGSI    DIY+HYR+ SG+W   + +  E E    K R 
Sbjct: 408 IDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRN 467

Query: 411 DTDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLW-----SSKTSE 465
           DT ++ + ++ + +T+ V   +T        D NK+   HR +RNGW W     S +   
Sbjct: 468 DT-VEQDLELREGTTDMVKPSAT--------DDNKETKRHR-RRNGWTWLNNKMSREDDN 517

Query: 466 KVNVTSDKHENEDIVPESR--FNHSKNRHEPLYN--HKIEIAN--------TLGTLPEKK 513
           + N   D  ENE+ V   R   ++SK  +  L+N   K E++N        T     + +
Sbjct: 518 EENQGDD--ENEENVDSQRMELDNSKKHYISLFNGGEKTEVSNKEEMNNSSTSTATSQTR 575

Query: 514 NAIDKKISNIFRRKHH 529
             I+K  +N+FRRK H
Sbjct: 576 QKIEKTFANLFRRKPH 591

 Score =  190 bits (482), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 97/114 (85%), Gaps = 5/114 (4%)

Query: 707 EATDSSKTASKKPL-----YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVI 761
           EA+  ++  +  PL      PPRKLTFADVKK DK N+P++FTDSAFGFPLP LT STVI
Sbjct: 787 EASAQTQAPAAPPLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVI 846

Query: 762 MFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           MFDHRLPI+VERAIYRLSHLKLSNSKR LREQVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 847 MFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900

>Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {ON}
           YMR273C (REAL)
          Length = 931

 Score =  197 bits (501), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 202/616 (32%), Positives = 280/616 (45%), Gaps = 145/616 (23%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXXXXX--XXXXXXXXYNNGYRNSWSTQLEQGDK 63
           SEV IAAQSLD E+RSVKNLKRLSIGS                +NG R+           
Sbjct: 28  SEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESNGRRSWSGATSSSTSA 87

Query: 64  P-----LKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTR 118
           P     + +TRYSDPT            P ++   Q S    T+ E+ ++         R
Sbjct: 88  PNVTRSMNNTRYSDPT------------PLEKLHVQSS----TETESYER--------CR 123

Query: 119 RGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDAL 178
           +G  N++  + V  S     S K+N    + +  NLLWV A+QHPNVKP+NY+ELVQD L
Sbjct: 124 QG--NYTGHKKVVHSP----SRKLN---ANALKNNLLWVPANQHPNVKPDNYLELVQDTL 174

Query: 179 HNIQIDKTEEHDKENSDTL----DKVSRYYNSNNKRSPN---------NTGLVRRPSLLR 225
            NI++   ++ +  N +       +   Y N  N    N         N  L+RRPS LR
Sbjct: 175 QNIRLGDNDDDNDNNDNEGDEAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLR 234

Query: 226 KSYTEFDEVKDSDIKEQSSTNNNVD------STPHNKKFTLKDITEELTRISNKAGLTNN 279
           +SYTEFD+  + DI +    +  V+      S    +  +L+DITEELT+ISN AGLT++
Sbjct: 235 RSYTEFDD-SEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDD 293

Query: 280 DAVTLARTLSMASVAEEDETDDLQERPEAEDD-----------YARQSRNNDD-NYASTM 327
           DA+TLARTL+MA         D  + P +ED               Q+   DD  YAS M
Sbjct: 294 DAITLARTLNMAG-----SYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNM 348

Query: 328 LLPTDSLIKSEHSTLKRSKY-TYHIRT---------------QED--------------- 356
            +  DS    E S+LKRS++ TY IR+               +ED               
Sbjct: 349 PINNDS-TGPERSSLKRSRFNTYRIRSHTEEQEEEQVLEETKKEDVSRLHLAENTIEIGI 407

Query: 357 KDPTIPVSTESQHQDVIEASPGSIND---IYDHYREPSGDWSSLIQVAPEN--ENKKRTD 411
             P  P   E    D + +SPGSI D   IYDHY + SGDW   + +      E  K  D
Sbjct: 408 NSPKSPFRQEDDESDPV-SSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVED 466

Query: 412 TDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTS 471
             ++   +  + ST  V  G+T  S         KE    ++RNGW W    + K+N   
Sbjct: 467 NAVEQELEPQEESTGTVVSGTTDDS---------KETKRHRRRNGWTW---LNNKMNKEE 514

Query: 472 DKHENE------DIVPESRF--NHSKNRHEPLYN--HKIEI--------ANTLGTLPEKK 513
           D  EN+      + V   R   ++SK  H  ++N   K E         AN   +  + +
Sbjct: 515 DNGENQGDDEGDEDVESQRMERDNSKKHHISIFNGAEKTEASSKEEANNANASTSTSQTR 574

Query: 514 NAIDKKISNIFRRKHH 529
             I+K  +N+FRRK H
Sbjct: 575 QKIEKTFANLFRRKPH 590

 Score =  187 bits (476), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (93%)

Query: 720 LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLS 779
           + PPRKLTFADVKK +K NAP++FTDSAFGFPLP LT STV+MFDHRLPI+VERAIYRLS
Sbjct: 820 VLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLS 879

Query: 780 HLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           HLKLSNSKR LREQVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 880 HLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQ 915

>KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {ON}
           Anc_8.831 YMR273C
          Length = 884

 Score =  184 bits (466), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 163/452 (36%), Positives = 236/452 (52%), Gaps = 81/452 (17%)

Query: 148 DEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSN 207
           D++  NLLWV A +HPNVKP+NYIELVQD L +I ID ++ +D +N   ++K       N
Sbjct: 186 DKLKNNLLWVPASKHPNVKPQNYIELVQDTLQHIHIDDSKSNDNDN---INK------EN 236

Query: 208 NKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNN-------NVDSTPHNKKFTL 260
           +  S  N  LVRRPS LRKSYTE++E    D   ++++N+       N  S+   +  +L
Sbjct: 237 DAHSSKNGSLVRRPSRLRKSYTEYEEENYQDDYNRNNSNDEENPNIGNFRSSNKGRSVSL 296

Query: 261 KDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRN-- 318
           KDITEELT+ISNKAGLT++DA+TLARTLSM   +  + TDD+    E   +Y+ Q  N  
Sbjct: 297 KDITEELTKISNKAGLTDSDAITLARTLSMTG-SFSNGTDDM----ELLSNYSDQQDNNF 351

Query: 319 --------NDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQED------------- 356
                   NDD +AS ML+  + L   + S+L+RSK+ TY +R+                
Sbjct: 352 NNDEHYNKNDDEFASNMLM-KNGLTIPQRSSLRRSKFNTYRVRSSSAPSNIHSKPINSNI 410

Query: 357 KDPTI--------------PVSTESQHQDVIEASPGSINDIYDHYREPSGD-WSSLIQVA 401
           K+P                PV+  + + + +  SPGSI+D+YDHY   S D  +S     
Sbjct: 411 KEPKTFKYPYNSKTSIKKSPVNRSNNYTEPVTESPGSISDLYDHYAYSSVDEETSNATNL 470

Query: 402 PENENKKRTDTDIDSNTKIV---QHST----EHVDLGSTGHSTSDKSDINKKEPAH---R 451
            E  N    D++  SN  ++    HS     E+ D  ++   T   S++N  E AH   R
Sbjct: 471 QETSNDGSIDSNESSNDSVLVKPSHSESMIHENFDALASDTVTDGWSNVN-NENAHFLQR 529

Query: 452 KKRNGWLWSSKTSEKVNVTSDKHENEDIVPESRFNHSKNRHEPLYNH-KIEIANTLGTLP 510
              NG L     S K N  S  H N     ++R NHSKNRH+PL+      +      + 
Sbjct: 530 NNNNGRLNDELVS-KGNQES-THYN-----KTRSNHSKNRHKPLFTSTNTPMTAKTKNVS 582

Query: 511 EKKNAIDKKISNIFRRKHHTR-RANQENSLAG 541
           +KK  +++KI  +F+RK H R  ++ EN + G
Sbjct: 583 KKKQTLEEKIVKLFKRKAHRRTSSSSENQIFG 614

 Score =  175 bits (443), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 113/181 (62%), Gaps = 39/181 (21%)

Query: 676 SLQPAVNVTSTKNQE-------------------IVIQNVTVTATPSQ------------ 704
           SLQPAV+V STK +                     VIQ V +    SQ            
Sbjct: 663 SLQPAVSVVSTKKESNASAPPSSASSSSLSSSSSTVIQTVELEGDESQDVSYEALKGEDF 722

Query: 705 REEATDSSKTASKK--------PLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELT 756
           R     SS+T +++           PPRKLTF DVK+ +K NAPI F+DSAFGFPLP LT
Sbjct: 723 RNPELSSSETTAEQEKELKSAISSLPPRKLTFDDVKRPEKPNAPIHFSDSAFGFPLPMLT 782

Query: 757 YSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQK 816
            STVIMFDHRL I+VERAIYRLSHLKLS+ KR LR+QVLLSNFMY+YLNLVNHTLYMEQ 
Sbjct: 783 TSTVIMFDHRLGINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHTLYMEQA 842

Query: 817 S 817
           +
Sbjct: 843 A 843

>NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.831
            YML109W
          Length = 1163

 Score =  181 bits (458), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 85/115 (73%), Positives = 96/115 (83%), Gaps = 5/115 (4%)

Query: 706  EEATDSSKTASKKPL-----YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTV 760
            E+ T S   ++ +PL      PPRKLTF DVK+ ++ NAP+EFTDSAFGFPLP LT STV
Sbjct: 1005 EDQTQSFNDSATQPLSQQHGLPPRKLTFDDVKRPERPNAPVEFTDSAFGFPLPALTVSTV 1064

Query: 761  IMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
            IMFDHRL I+VERAIYRLSHLKLS+SKR LREQVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 1065 IMFDHRLGINVERAIYRLSHLKLSDSKRELREQVLLSNFMYAYLNLVNHTLYMEQ 1119

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 116/331 (35%), Positives = 162/331 (48%), Gaps = 95/331 (28%)

Query: 152 QNLLWVRADQHPNVKPENYIELVQDALHNIQI---------------------DKTEEHD 190
           QNLLWV A+QHPN+KPE+Y+ELVQD LHNI +                     D T+E +
Sbjct: 266 QNLLWVPANQHPNIKPESYLELVQDTLHNIHLDDDNHNNDDAKVSTDDDLYSMDGTDETN 325

Query: 191 KENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEF---------DEVKDSDIKE 241
           KEN + +D +++   S  +R   N  LVRRPS LRKSYTEF         DE  D + ++
Sbjct: 326 KENLN-IDYLTKPSTSELRRK--NKSLVRRPSGLRKSYTEFEEFNTSDEEDETSDCEEEQ 382

Query: 242 QSSTNNNVDSTPHNKKF----------------------TLKDITEELTRISNKAGLTNN 279
           Q ST+N+ ++  H++                        +LKDITEELT+ISN AGLT++
Sbjct: 383 QLSTDNSTNNANHHQDIIINNKTPEIIIPKGNTRSSRFVSLKDITEELTKISNNAGLTDS 442

Query: 280 DAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEH 339
           DA+TLARTLSMA   +++  ++       E+         DD YAS M +  + L     
Sbjct: 443 DAITLARTLSMAGSFQDNSNNNHNSDNFNEEQNGNTPE--DDEYASNMFM-KNGLTIPTR 499

Query: 340 STLKRSKY-TYHIR----------------------TQEDKDPTIPV---------STES 367
           S+L+RS++ TY IR                      T  +K  T P          +T +
Sbjct: 500 SSLRRSRFNTYRIRSGSSSTSAQSSSSSRTTSGSQMTNNNKTVTEPGRGNQPEDHNNTPA 559

Query: 368 QHQD-----VIEASPGSINDIYDHYREPSGD 393
            H       +   SPGSI+D+YDHY+    D
Sbjct: 560 SHYTARLSYMSTTSPGSISDLYDHYQNSDSD 590

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 26/27 (96%)

Query: 6  SEVYIAAQSLDKELRSVKNLKRLSIGS 32
          S+++IAA+SLD EL+SV+NLKRLSIGS
Sbjct: 40 SDMFIAAKSLDNELQSVQNLKRLSIGS 66

>NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {ON}
           Anc_8.831 YML109W
          Length = 993

 Score =  180 bits (457), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 98/179 (54%), Positives = 111/179 (62%), Gaps = 44/179 (24%)

Query: 676 SLQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPL--------------- 720
           SLQPAV+VTSTKN  +     + +   + RE   D S+  S   L               
Sbjct: 771 SLQPAVSVTSTKNVHL-----SASIVETVRELGEDDSQDISGGDLSTEVDNSMLAERNVM 825

Query: 721 ------------------------YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELT 756
                                    P RKLTFADVK+ D+ NAPI+FTDSAFGFPLP LT
Sbjct: 826 NSSDLQSIENSSDDINTGNTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLT 885

Query: 757 YSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
            STVIMFDHRL I+VERAIYRLSHLKLS+SKR LR+QVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 886 VSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQ 944

 Score =  150 bits (380), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 159/489 (32%), Positives = 230/489 (47%), Gaps = 122/489 (24%)

Query: 147 PDEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDK---TEEH-------------- 189
           PD++ +NLLWV A+QHPNVKPENY+ELVQD L NI +++   + +H              
Sbjct: 193 PDDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDI 252

Query: 190 DKENSDTLDKVSRYYNSNNKR----SPNNTGLVRRPSLLRKSYTEFDEVKDSDIKE-QSS 244
            K N    + + R+  S +K     +  N  LVRRPS LR SYTEF+E   S+ +E ++ 
Sbjct: 253 SKSNMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEESEAK 312

Query: 245 TNNNVDSTPHNKKF-------------------TLKDITEELTRISNKAGLTNNDAVTLA 285
           TN +  S+   K F                   +LKDITEELT ISNKAGLT++DA+TLA
Sbjct: 313 TNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLA 372

Query: 286 RTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRS 345
           RTLSMAS   +   +  + + + E        N +  +AS M +  + L   E S+L+RS
Sbjct: 373 RTLSMASSFSDGNVNLGKSKLQNES-------NEESEFASNMFM-KNGLTIPERSSLRRS 424

Query: 346 KY-TYHIR-------TQEDKDPTI------------------PVSTESQ--HQDVIEASP 377
           K+ TY IR       T+E   P +                  PVS  ++  +     +SP
Sbjct: 425 KFNTYRIRSTSSSTSTREKTSPLLQSSSFARQEADTDDLQRSPVSFTNRDSYLATTTSSP 484

Query: 378 GSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKIVQHSTEHVD-------- 429
           GSI+D+YDHY++ +       +   +N+N+ R   D+ S+  I Q S+   +        
Sbjct: 485 GSISDLYDHYQDNAES-----KQGNDNDNEAR-QGDL-SHASISQESSFLSNESSNDSIL 537

Query: 430 ---LGSTG--HSTSDKS-DINKKEPAHRK----------------KRNGWLWSS--KTSE 465
              LGS    H   D   D +  +PA++K                KRNGW WS     SE
Sbjct: 538 VKPLGSKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWSWSGNRANSE 597

Query: 466 KVNVTSDKHENEDIVPESRFNHSKNRHEPLYNH-----KIEIANTLGTLPEKKNAIDKKI 520
           +        ++ED    +    SK+RH P+        KI     L     K+  I+K+ 
Sbjct: 598 EDATVLVNSQDEDQTGYTD-QKSKSRHRPILARSRDHLKINKEAELPKESHKRETIEKRF 656

Query: 521 SNIFRRKHH 529
             +FRRK H
Sbjct: 657 VKLFRRKGH 665

>KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1076

 Score =  179 bits (455), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 81/97 (83%), Positives = 89/97 (91%)

Query: 721  YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSH 780
             PPRKLT+ADVK+ +K NAPI+FTDSAFGFPLP LT STVIMFDHRL I+VERAIYRLSH
Sbjct: 930  LPPRKLTYADVKRPEKPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLSH 989

Query: 781  LKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQKS 817
            LKLS+SKR LR+QVLLSNFMY+YLNLVNHTLYMEQ S
Sbjct: 990  LKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVS 1026

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 113/318 (35%), Positives = 156/318 (49%), Gaps = 88/318 (27%)

Query: 149 EVAQNLLWVRADQHPNVKPENYIELVQDALHNI---------------------QIDKTE 187
           ++  NLLWV A+QHPNVKPENY+ELV D L  I                       D  +
Sbjct: 230 DLKSNLLWVPANQHPNVKPENYLELVHDTLQTINGEGDGDGDGHTIDTSADTGTAADSVD 289

Query: 188 EHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDS--------DI 239
           E DKEN++T  +V RY N         + LVRRPS LR+SY E DE +DS        DI
Sbjct: 290 ESDKENNNTRLRV-RYRNG------KASSLVRRPSRLRRSYIETDEDEDSNTSNAKIDDI 342

Query: 240 KEQSSTNNNVDSTPHN---KKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEE 296
           +E   + +    T  N   K  +L+DITEELT++SN  GLT++DAVTLARTL+M     +
Sbjct: 343 EEGGRSLDERKPTRTNGDRKSVSLRDITEELTKMSNSVGLTDDDAVTLARTLNMTCTYTD 402

Query: 297 DETDDLQE-RPEAEDDY-ARQSRN-----------NDDNYASTMLLPTDSLIKSEHSTLK 343
            +++ L   R ++++   A +S N           +++ +AS M +  + L     S+L+
Sbjct: 403 TDSEGLDNLRTDSKEQLRAEESENPPGTTHAKILPDENQFASNMFM-KNGLSIPTRSSLR 461

Query: 344 RSKY-TYHIRTQEDKDPTI--PVSTESQH------------------------------- 369
           RSK+ TY IRT     P +  P    S+H                               
Sbjct: 462 RSKFNTYRIRTTSAPTPLVEKPKRNNSRHARLSFVHLDDEEFASHESPAALQSPTVNNDE 521

Query: 370 QDVIEASPGSINDIYDHY 387
             VIE SPGSI+D+YDHY
Sbjct: 522 AGVIE-SPGSISDLYDHY 538

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/27 (77%), Positives = 25/27 (92%)

Query: 6  SEVYIAAQSLDKELRSVKNLKRLSIGS 32
          SEV IAAQSLD E+++VK+LKRLSIGS
Sbjct: 29 SEVLIAAQSLDVEVQNVKHLKRLSIGS 55

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 35/87 (40%), Gaps = 27/87 (31%)

Query: 467 VNVTSDKHENEDIVPESRFNHSKNRHEPLYNHKIEIANTLGTLPE--------------- 511
           VN    KH      P  R NHSKNRH P++       N   T P+               
Sbjct: 675 VNAAPSKH------PIDRGNHSKNRHMPIFTLNSASTNQDDT-PQMEQKEKKEPYVSKKE 727

Query: 512 -----KKNAIDKKISNIFRRKHHTRRA 533
                KK  +++K   +F+RKHH+  A
Sbjct: 728 PSAGPKKKTLEEKFVKLFKRKHHSANA 754

>KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {ON}
           some similarities with uniprot|P54786 Saccharomyces
           cerevisiae YML109W ZDS2 Protein that interacts with
           silencing proteins at the telomere involved in
           transcriptional silencing paralog of Zds1p and with
           YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
           ZDS1 Protein that interacts with silencing proteins at
           the telomere, involved in transcriptional silencing;
           also has a role in localization of Bcy1p, which is a
           regulatory subunit of protein kinase A; paralog of Zds2p
          Length = 944

 Score =  178 bits (451), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 89/97 (91%), Gaps = 1/97 (1%)

Query: 719 PLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRL 778
           PL PPRKLTFADV K D+ N+P++FTDSAFGFPLP LT STVIMFDHRLPIHVERAIYRL
Sbjct: 823 PL-PPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRL 881

Query: 779 SHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           SHLKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q
Sbjct: 882 SHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQ 918

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 121/360 (33%), Positives = 179/360 (49%), Gaps = 58/360 (16%)

Query: 150 VAQNLLWVRADQHPNVKPENYIELVQDALHNIQI-------DKTEEHDKENSDTLDKVSR 202
           + QNLLWVRADQHPNVKPENY+ELVQ+ L N+ +       ++T+        TL K  R
Sbjct: 188 LGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLKTLRK--R 245

Query: 203 YYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKD 262
              S N        L RRPS LR SYTE  E  +              +    +  +LKD
Sbjct: 246 SMQSGN-------SLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSSRRTVSLKD 298

Query: 263 ITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDN 322
           ITEELT++SN+AGLT+ DAVTLARTL    VA+E  TD   +        +    + ++ 
Sbjct: 299 ITEELTKLSNQAGLTDTDAVTLARTL---WVADESTTDSTGQ------GLSNNLADEEEE 349

Query: 323 YASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDPTIPVSTESQHQDVIEASPGSIN 381
           +ASTM   +   + + HS L+RSK+ TY I++   K+  I    E++       SP SI 
Sbjct: 350 FASTMFTKSGFTVPARHS-LRRSKFNTYRIQSSSSKEERI---IETRSPSGSNNSPNSII 405

Query: 382 DIYDHYREPSGDWSSLIQ----VAPENENKKRTDTDIDSNTKIVQHSTEHVDLGSTGHST 437
            +Y+   EP  +   ++Q      P ++     D + +S+T+  + S +  +  S+   T
Sbjct: 406 GLYND--EPFNEKKPIVQEFFSTLPASD-----DFESESSTEDAESSADFSNEVSSELET 458

Query: 438 SDKSDINKKEPAHRKKRNGWLWSSKTSEKVNVTSDKHENEDIVPES-----RFNHSKNRH 492
           +DK  IN+   +       W WS   +     TS+ ++    VP+      + NHS+NRH
Sbjct: 459 TDKQRINETSKS-------WRWSQSPT-----TSNDYQQAQYVPKENIAPLKINHSRNRH 506

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (92%)

Query: 6  SEVYIAAQSLDKELRSVKNLKRLSIGS 32
          SEV IAAQSLD+E++ VKNLKRLSIGS
Sbjct: 11 SEVLIAAQSLDQEVKHVKNLKRLSIGS 37

>ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109W ZDS2 Protein that interacts with silencing
           proteins at the telomere involved in transcriptional
           silencing paralog of Zds1p
          Length = 1211

 Score =  177 bits (449), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 155/420 (36%), Positives = 220/420 (52%), Gaps = 78/420 (18%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYNNGY----RNSWSTQLEQG 61
           SEV IAAQSLD E++SVKNLKR+SIGS              +N      R SW++ +   
Sbjct: 60  SEVMIAAQSLDNEVQSVKNLKRISIGSMDMLLDPELEYRVSSNAGKQENRKSWTSGVPA- 118

Query: 62  DKPLK---------STRYSDPTH---------YNSK-------IVRQERL----PFKQNQ 92
            +P +         + RY+ P+          + S+       +   E L    P   + 
Sbjct: 119 -RPAEEVENMQNRATVRYTYPSRAVEGEPDESFESELSEISFDVTNSEYLEGLDPNDDSS 177

Query: 93  PQKSDKEQTQVENTKKQ--PGSPKSLT-----RRGAVNFSSRRPVDRSNHSKNSSKINDT 145
            QKS+ + T +  ++K     S +S++     +RGA N   R+    S  S  SS  N +
Sbjct: 178 IQKSENDTTDLRGSQKSQVSSSGRSISGVGTLKRGASNIPLRK---TSTSSDASSGSNGS 234

Query: 146 LPDEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKEN--SDTLDKVSRY 203
           L     +NLLWV A+QHPNVKPENY+ELVQD LHNI+++  E+    N  + T  KV   
Sbjct: 235 L----TKNLLWVPANQHPNVKPENYLELVQDTLHNIRLEGNEDEQTGNDMNTTTAKVEHG 290

Query: 204 YNSNNKRSP----NNTGLVRRPSLLRKSYTEFDEVKDSDI------KEQSS------TNN 247
            N  N+        N  LVR+PS LRKSYTEFDE  D  +      K++SS      +N 
Sbjct: 291 TNKENEDKGYLPRKNNSLVRKPSRLRKSYTEFDEENDDYLDTSGFSKKRSSEDVEDASNL 350

Query: 248 NVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQE--R 305
            + ST  ++  +L+DIT+ELT+ISN AGLT++DA+TLARTLSMA     DE DD+ E  R
Sbjct: 351 TISSTNSSRAVSLRDITDELTKISNNAGLTDSDAITLARTLSMAGSFTSDEPDDIIENSR 410

Query: 306 PEAEDDY-------ARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDK 357
               DD        A + + +D  +AS M +    +I +  S+L+RSK+ TY +R+  D+
Sbjct: 411 GTQGDDLQYYNEADAMEKKEDDAEFASNMFMKNGFVIPA-RSSLRRSKFNTYRVRSASDE 469

 Score =  176 bits (447), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 78/98 (79%), Positives = 90/98 (91%), Gaps = 1/98 (1%)

Query: 718  KPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYR 777
            +PL P RKLTF+DVK+ D+ NAP++FTDSAFGFPLP LT STV+MFDHRLPI+VERAIYR
Sbjct: 1068 QPL-PARKLTFSDVKRLDRPNAPMQFTDSAFGFPLPMLTVSTVVMFDHRLPINVERAIYR 1126

Query: 778  LSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
            LSHLKLS+ KR LR+QV+LSNFMY+YLNLVNHTLYMEQ
Sbjct: 1127 LSHLKLSDPKRELRQQVMLSNFMYAYLNLVNHTLYMEQ 1164

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
            complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score =  176 bits (445), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 85/96 (88%)

Query: 720  LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLS 779
            + PPRKL FADV K D  N PI+FTDSAFGFPLP LT STVIMFDHRLP++VERAIYRLS
Sbjct: 929  VLPPRKLVFADVHKSDIPNGPIQFTDSAFGFPLPLLTISTVIMFDHRLPVNVERAIYRLS 988

Query: 780  HLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
            HLKLS  KRALR+QVLLSNFMY+YL+LVNHTLYMEQ
Sbjct: 989  HLKLSEPKRALRDQVLLSNFMYAYLHLVNHTLYMEQ 1024

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 110/334 (32%), Positives = 166/334 (49%), Gaps = 99/334 (29%)

Query: 145 TLPDEVA---------QNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDK---- 191
           T+PD +A         +NLLWV AD+HPNV P+NYI+++Q++L+N+ ++  E+ DK    
Sbjct: 149 TIPDSMAYNSKASTTKKNLLWVPADKHPNVMPDNYIQMIQNSLNNLSLESNEDVDKDSKV 208

Query: 192 ---ENSDTL----DKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEF----DEVKDSDIK 240
              EN + +    +++S  Y   N+       LVRRPS LRKSYTEF    DE  ++D  
Sbjct: 209 LPQENKENIYEDRERLSVAYKRRNR------SLVRRPSQLRKSYTEFNNSDDEEDNTDEN 262

Query: 241 EQS---------STNNNVDSTPHNKKF-------TLKDITEELTRISNKAGLTNNDAVTL 284
             S         S N ++DS   +K F       +LKDIT ELT+ISN  GL+++DAV+L
Sbjct: 263 NLSKNNKDTNENSANTSMDSIKTSKSFDNKRYSISLKDITAELTKISNSVGLSDSDAVSL 322

Query: 285 ARTLSMASVAEEDET------DDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSE 338
           AR+LS+     +DET      D + + P  E+         +D + S M+L    +I + 
Sbjct: 323 ARSLSITG-PYQDETESDGAGDIMLDNPSDEESL-------NDEFVSNMVLRNGLMIPT- 373

Query: 339 HSTLKRSKYTYH----------------------------------IRTQEDKDPTIPVS 364
            S+L+RSK+T +                                  I+    K P + + 
Sbjct: 374 RSSLRRSKFTTYRSRTSSSDSLSPKKQNFDDKQETSVSSSKANENEIKNPFGKLPEVNLK 433

Query: 365 TESQHQD--VIEASPGS--INDIYDHYREPSGDW 394
            E  ++D   ++ SP +    DIYDHYR+PS DW
Sbjct: 434 AEESNEDDESLKTSPAASDFQDIYDHYRQPSSDW 467

>Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..4565)
           [3006 nt, 1002 aa]
          Length = 1001

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 110/164 (67%), Gaps = 25/164 (15%)

Query: 677 LQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSS-----------------------K 713
           LQPA+NV  T N   ++++V         ++ ++ S                        
Sbjct: 787 LQPALNVVRTANDNCIVESVNELDDDEDSQDFSNGSIYTESIALQKNTYATKDVTIQNND 846

Query: 714 TASKKP--LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHV 771
            A++ P  + PPRKLTF DV++ D+ N  + FTDSAFGFPLP LT STVIMFDHRLP++V
Sbjct: 847 LANQAPPTILPPRKLTFEDVERLDRPNGSMVFTDSAFGFPLPLLTVSTVIMFDHRLPVNV 906

Query: 772 ERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           ERAIYRLSHLKLS+S+R+LREQVLLSNFMY+YL+LVNH+LYMEQ
Sbjct: 907 ERAIYRLSHLKLSDSRRSLREQVLLSNFMYAYLHLVNHSLYMEQ 950

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 106/292 (36%), Positives = 159/292 (54%), Gaps = 46/292 (15%)

Query: 97  DKEQTQVENTKKQPGSPKSLTRRGAVNFSSRRPVDRSNHSKNSSKINDTLPDE------- 149
           D  +T  EN   QP S ++L+  G +  SSR    +    +N +++   LP         
Sbjct: 143 DSIKTVKENELSQPQSKRNLSGIGGLRRSSRNVTSKP---ENETQV---LPKRKLENKKA 196

Query: 150 VAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKE-----NSDTLDKVSRYY 204
              NLLWV A+QHP+VKP+N++ELV D L N+ +D  + ++ E     + D L+  SR  
Sbjct: 197 FTNNLLWVPANQHPSVKPQNFVELVHDTLQNMSLDDVQTNESESKNEVSKDLLNTFSRDM 256

Query: 205 NSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHN----KKFTL 260
           N  NK       LVRRPS LRKSYTEF+E  + ++K  +S+NN  +S   N    +  +L
Sbjct: 257 NMRNK------SLVRRPSRLRKSYTEFEEETEEEVKPTTSSNNINESNKKNVQGKRAVSL 310

Query: 261 KDITEELTRISNKAGLTNNDAVTLARTLSMA----SVAEEDETDDLQERPEAEDDYARQS 316
           KDI +ELT ISN  GL+N+DA++LAR+LS+A    S +EE+E D +             S
Sbjct: 311 KDIADELTVISNNVGLSNSDAISLARSLSIAGSIGSTSEEEEEDKV---------LNTSS 361

Query: 317 RNNDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHIRT----QEDKDPTIPV 363
               +   ++ +L  + +     S+L+RSK+ TY IRT    Q+D+  T P+
Sbjct: 362 IGQSEEVFASNILAKNGISIPARSSLRRSKFNTYKIRTSGSSQKDELSTAPI 413

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/27 (77%), Positives = 25/27 (92%)

Query: 6  SEVYIAAQSLDKELRSVKNLKRLSIGS 32
          S V IAAQSLD+E+++VKNLKRLSIGS
Sbjct: 25 SAVLIAAQSLDQEVQNVKNLKRLSIGS 51

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score =  171 bits (434), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 160/455 (35%), Positives = 233/455 (51%), Gaps = 96/455 (21%)

Query: 114 KSLTRRGAVNFSSRRPVDRSNHSK-NSSKINDTLPDE-VAQNLLWVRADQHPNVKPENYI 171
           ++L+  G+V    RR    SN S+ +  K+ND   +E + QNLLWV A+QHP+VKPENY+
Sbjct: 165 RALSGTGSV----RRGGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYL 220

Query: 172 ELVQDALHNIQIDKT--EEHDKENSDTLDKVSRYYNSNNKRSPNNTG---LVRRPSLLRK 226
           ELVQD L N+Q++    +E +KEN+    K+    NSN  + P   G   LVRRPS LRK
Sbjct: 221 ELVQDTLQNLQLENGVRDESNKENTV---KLIHGLNSNVSQLPIQQGKNSLVRRPSRLRK 277

Query: 227 SYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLAR 286
           SYTEF++ ++ ++    ++++   S P  +  +L++IT+ELT++SN AGLT++DA+TLAR
Sbjct: 278 SYTEFEDTEEYNLPISGNSSSLPSSVPTPRSVSLREITDELTKVSNNAGLTDSDAITLAR 337

Query: 287 TLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSK 346
           TLSMAS   E    + + +   E       +  +D +AS M L  +SL     S+L+RSK
Sbjct: 338 TLSMASTFYEGSNSEKENQSNTE-------KAEEDEFASNM-LNQNSLAIPARSSLRRSK 389

Query: 347 Y-TYHIR-------------------TQEDKDPTIPVSTESQHQDVIEA----SPGSIN- 381
           + TY IR                   T+E+  P I V+ E     V+E     SP +IN 
Sbjct: 390 FNTYRIRTPSGSSTNEFAQSNLKVSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTIND 449

Query: 382 --DIYDHYREPSGDWSSLIQ-VAPENENKKRTDTDIDS-------NTKIVQHSTEHVDLG 431
             DIYDHY     D SS+ + + P+N N      D D+       +      ST +  L 
Sbjct: 450 MQDIYDHY-----DTSSVEESLPPQNSNYSSAQQDGDNLQDSPDSSDFSTDSSTANAILK 504

Query: 432 STGHSTSDKSDINKKE---PA---------HRKKRNGWLW----SSKTSEKVNV-TSDKH 474
           S       KSD  +KE   P           +KK+ GW W    S K  E+ N+  S++H
Sbjct: 505 SKQSIVQTKSDSIQKEFLSPVTESTTADVKRQKKKGGWSWFNKKSKKEPEEDNLKQSEQH 564

Query: 475 ENEDI-----------------VPESRFNHSKNRH 492
            + D                  +P +R NHS+NRH
Sbjct: 565 THRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRH 599

 Score =  171 bits (433), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 108/173 (62%), Gaps = 33/173 (19%)

Query: 676 SLQPAVNVTSTKNQEIVIQNVTVTATPSQREE------------------------ATDS 711
           +LQPAV+VTSTK  +  I  V    T S+  E                            
Sbjct: 730 TLQPAVSVTSTKQSDGAIPGVLENKTVSKEYEQNQYNHVQQTLDQQQQQQQKQQKQQQQQ 789

Query: 712 SKTASKKP---------LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIM 762
            +  S KP           PPRKL F DVK+ +  NAP++FTDSAFGFPLP LT STVIM
Sbjct: 790 QQQQSLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIM 849

Query: 763 FDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           FDHRLPI+VERAIYRLSHLKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q
Sbjct: 850 FDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQ 902

>TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON}
           Anc_8.831 YMR273C
          Length = 1049

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 109/168 (64%), Gaps = 28/168 (16%)

Query: 676 SLQPAVNVTSTKNQEIVIQ----------------------NVTVTATPSQREEATDSSK 713
           SLQPAV +TS +   +V +                      N  V    +  E + +S++
Sbjct: 812 SLQPAVCITSNRADVVVTETVDELSDGDDSQDITGGEFYTDNTQVNTINTSYETSYNSTR 871

Query: 714 TASKKP------LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRL 767
              ++         P RKLTF DV K ++ N P+EFTDSAFGFPLP+LT STVIMFDHRL
Sbjct: 872 IVEQEANTLPESSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRL 931

Query: 768 PIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           P++VERAIYRLSHLKLS+ KR LREQ+LLSNFMY+YL+LVNH+LY+EQ
Sbjct: 932 PVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQ 979

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 139/241 (57%), Gaps = 38/241 (15%)

Query: 148 DEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQI------DKTEEHDKENSD--TLDK 199
           D++ QNLLWV A++HP VKPENY+EL+QD L NI +      +  E+   + SD   +D+
Sbjct: 202 DQITQNLLWVPANKHPGVKPENYVELLQDTLQNINLNLNETQNNVEDTSNKTSDKMVMDR 261

Query: 200 -VSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTP----- 253
            V R    +   + N++ LVRRP+ LR SY+E  E     ++ ++S N++ +  P     
Sbjct: 262 EVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLSQN 321

Query: 254 ---------HNKK--------FTLKDITEELTRISNKAGLTNNDAVTLARTLSMA-SVAE 295
                     NK          +LKDITEELT+ISNKAGL+N+DA++LAR+LS+A SV++
Sbjct: 322 SISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVSK 381

Query: 296 EDE--TDDLQERPEAEDD-YARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHI 351
            D   +D+LQ   +  DD   R S  ++  YAS +L+     I     +L+RSK+ TY I
Sbjct: 382 TDNSVSDNLQSATQGNDDNKPRSSEVSEAGYASNILVRNG--ITMPTRSLRRSKFNTYKI 439

Query: 352 R 352
           R
Sbjct: 440 R 440

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%)

Query: 6  SEVYIAAQSLDKELRSVKNLKRLSIGS 32
          S V IAAQSLD E+++VK LKRLS+GS
Sbjct: 19 SAVLIAAQSLDLEVQNVKKLKRLSVGS 45

>AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML109W (ZDS2) and YMR273C
           (ZDS1)
          Length = 1018

 Score =  167 bits (423), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 73/95 (76%), Positives = 84/95 (88%)

Query: 721 YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSH 780
            PPRKL F DV + +K N+P++FT SAFGFPLP LT STVIMFDHRLPI+VERAIYRLSH
Sbjct: 896 LPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSH 955

Query: 781 LKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           LKLS+ KR LR+QVLLSNFMYSYLNLVNH+LY++Q
Sbjct: 956 LKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQ 990

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 143/439 (32%), Positives = 210/439 (47%), Gaps = 87/439 (19%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYNNGY--------RNS---- 53
           SEV IAAQSLD EL++VKNLKR+SIGS               NG         RNS    
Sbjct: 75  SEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRM--NGAAVSPSASPRNSLTEE 132

Query: 54  ---W---STQLEQGDK-PL--KSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVE 104
              W   S + EQG + PL  +S         +S   R E L         +       E
Sbjct: 133 SLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELL-------TSASSVVPSEE 185

Query: 105 NTKKQPGSPKSLTRRGAVNFSSRRPVDR----SNHSKNSSKINDTLPDEVAQNLLWVRAD 160
            +   P SP +  ++  +  SSR  + R    + H+K ++       +  + NLLWVRAD
Sbjct: 186 LSCSHPLSPPAAAKKSTL-MSSRSKLGRQHTDTTHTKQATG------EPFSSNLLWVRAD 238

Query: 161 QHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRR 220
           QHPNVKPENY+ELV D L+N++I     H + +S      +   N  +  +   + LVR+
Sbjct: 239 QHPNVKPENYLELVHDTLNNLRIGA--RHGRGDSPVQQSNTPVANGESSTASARS-LVRK 295

Query: 221 PSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNND 280
            S LRKS+TE + +++S   +  S  + +      +  +LK+ITEELTRISN AGLT++D
Sbjct: 296 QSRLRKSFTEVEAIEESQFTD--SIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSD 353

Query: 281 AVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHS 340
           A+TLARTL + S + ++     +  P AE +        ++ YAS++L   + L     S
Sbjct: 354 AITLARTLGIGSQSADEHATFSECVPSAEAE--------ENEYASSILA-KNGLAIPARS 404

Query: 341 TLKRSKY-TYHIRT-----------------------QEDKDPTIPVST--------ESQ 368
           +L+RSK+ TY IR+                       +  + P +  +           +
Sbjct: 405 SLRRSKFTTYRIRSAGSDSSPPENKSTSSSSLAAAYERNSRSPKMQKAAFKGSHPRLSGE 464

Query: 369 HQDVIEASPGSINDIYDHY 387
           +  +   SP SINDIYDHY
Sbjct: 465 NTSLAPQSPNSINDIYDHY 483

>KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {ON}
           Anc_8.831 YMR273C
          Length = 843

 Score =  166 bits (420), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 74/98 (75%), Positives = 84/98 (85%)

Query: 718 KPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYR 777
           K + PPRKLTF DVKK +K N P+++TDSAFGFPLP LT STVIM+D RL  +VERAIYR
Sbjct: 713 KSILPPRKLTFDDVKKPEKVNGPMQYTDSAFGFPLPLLTVSTVIMYDCRLATNVERAIYR 772

Query: 778 LSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           LSHLKL N KR LREQVL+SNFMY+YLNLVNHTL+MEQ
Sbjct: 773 LSHLKLGNRKRPLREQVLVSNFMYAYLNLVNHTLFMEQ 810

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 147/300 (49%), Gaps = 41/300 (13%)

Query: 4   QNSEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYNNGYRNSWSTQLEQGDK 63
           +NS +Y+AAQSL  E+++V +LKRLS+GS             +N   RN  + + ++   
Sbjct: 11  RNSRIYLAAQSLGHEVQNVNHLKRLSVGSIDMLTDTDVEFS-FNKLQRNISAKKTQEILS 69

Query: 64  PLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTRR--GA 121
             +++  ++   YN+ +         +++ +K+ +  +  E   K P  P     R  GA
Sbjct: 70  QKRTSTETESVSYNTLLEGFYGSDDAEDESEKTTRNTSISETRDKSPSVPARARGRKVGA 129

Query: 122 VNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDAL--H 179
           V+ SSR     +N  K           E+++ LLWV AD HPNVKPENYIELVQD L  +
Sbjct: 130 VSRSSRT----ANLGKKGG-----YDKEISKGLLWVSADVHPNVKPENYIELVQDTLEQY 180

Query: 180 NIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDI 239
           N       E   E+   L    R   S++        LVR+PS LRKSY          I
Sbjct: 181 NSSDYSISERLPEDKQVLLSAFRAKKSHS--------LVRKPSKLRKSYI--------SI 224

Query: 240 KEQSSTNNNVDSTPHNKKF-----------TLKDITEELTRISNKAGLTNNDAVTLARTL 288
           +  ++   N D+  H K             +LK+++EEL +IS+ AGLT +DA+TLA TL
Sbjct: 225 ESNNTPAENNDANAHRKPLGSSRDPVVSTISLKELSEELAKISSSAGLTKDDAITLATTL 284

>KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 935

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 77/136 (56%), Positives = 100/136 (73%)

Query: 680 AVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPLYPPRKLTFADVKKKDKANA 739
           A  VT+   +E    +   + T SQ   A +    A+   + PPRKL F+DV K ++ NA
Sbjct: 779 ADTVTAYAPEETAAASADDSFTKSQEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNA 838

Query: 740 PIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNF 799
           P++F+DS+FGFPLP LT STV+M DHRLPI+VERAIYRLSHLKL + KR LR+QV+LSNF
Sbjct: 839 PMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNF 898

Query: 800 MYSYLNLVNHTLYMEQ 815
           MY+YLNLVNH+LY++Q
Sbjct: 899 MYAYLNLVNHSLYLQQ 914

 Score =  157 bits (398), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 144/419 (34%), Positives = 204/419 (48%), Gaps = 90/419 (21%)

Query: 150 VAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKV-------SR 202
           V  NLLWV A+QHPN+KPENY+ELVQD LH ++I+   E   E  +    V       + 
Sbjct: 175 VTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHAPAAASAN 234

Query: 203 YYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNN-----VDSTP---- 253
              SN  RS  N+ LVRRPS LRKS+TE +++   + ++ S  + N      D  P    
Sbjct: 235 LPPSNQLRSGLNS-LVRRPSGLRKSFTELEDLLLQEAQDTSGGDENAELPSADKMPSVRP 293

Query: 254 --HNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDD 311
              ++  +LKDITEELTRISN+AG T+ DAV+LARTLSMAS    DE  +    PE    
Sbjct: 294 RIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPE---- 349

Query: 312 YARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKD--PTIPVSTESQ 368
                +  +  YAS+ML   + L     S+L+RSK+ TY IR        P+   S  ++
Sbjct: 350 -----KKPEKEYASSMLT-KNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAE 403

Query: 369 HQDVIEA------------SPGSIND---IYDHYREPSGDWSSLIQVAPENEN------- 406
           H ++  +            SP S+ND   IYDHYR+ S D SSL     E++N       
Sbjct: 404 HNELDRSPIRVDQKNAQLQSPTSVNDFNEIYDHYRQSSFD-SSLGAYPHEHQNAHTSNFH 462

Query: 407 -----KKRTDTDIDSNTKIVQHSTEHVDLGST----------GH---STSDKSDINKKEP 448
                + + DT +DS + +  H      L             GH   + +D+ D +K   
Sbjct: 463 SIASKRPKDDTLLDSESSL--HDLHKGSLNKALDDEQQASFRGHVEATNNDEKDDHKHAS 520

Query: 449 AHR-KKRNGWLWSSKTSEKVNVTSDKHE---NEDI-----------VPESRFNHSKNRH 492
           +   +K++GW W  K S K   +S +H    + D            VP  + NHS++RH
Sbjct: 521 SQAPRKKSGWSWFGKKSSKDQESSPEHTQRVSSDFLGVSSSAKPTNVPTEKINHSRHRH 579

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (88%)

Query: 6  SEVYIAAQSLDKELRSVKNLKRLSIGS 32
          SEV IAAQSLD EL+ VKNLKR+SIGS
Sbjct: 38 SEVLIAAQSLDSELQHVKNLKRISIGS 64

>Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W
           (REAL)
          Length = 949

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 84/100 (84%)

Query: 716 SKKPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAI 775
           ++ P   PRKLTF DV K    NAPI+FTDSAFGFPLP +T STVIMFDHRL I+VERAI
Sbjct: 819 TQTPNLIPRKLTFGDVVKPKYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAI 878

Query: 776 YRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           YRLSHLKLS+  R LR+QVLLSNFMYSYLNLVNHTLYMEQ
Sbjct: 879 YRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 918

 Score =  138 bits (348), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 150/272 (55%), Gaps = 42/272 (15%)

Query: 149 EVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNN 208
           +  QNLLWV A+QHPNVKPENY+EL+QD L NIQI  T+E   E+  TL+  + +   N 
Sbjct: 206 DFTQNLLWVPANQHPNVKPENYLELIQDTLQNIQI-STDEDSGES--TLEVGNNHVILNR 262

Query: 209 KRSPNNTGLVRRPSLLRKSYTEF-DEVKDSDIKE--QSSTNNNVDSTPHN--KKFTLKDI 263
           K S     +VRRPS L+ SYT+F DE+  +D  E  Q   N  + S+     +  +LK+I
Sbjct: 263 KSS---GSIVRRPSRLKTSYTKFDDEISVADKPEVGQEQVNKRIPSSEVRTIRSVSLKEI 319

Query: 264 TEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNY 323
           TEELT+ISN AGLT ++AVTLAR+LSM+     +    L +  +AE         ND  +
Sbjct: 320 TEELTKISNNAGLTGSNAVTLARSLSMSGSFTNENL--LLKSNDAE---------NDSEF 368

Query: 324 ASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDPTIP-----VSTESQHQDVIEASP 377
           AS M   +   I  E S+L+RSK+ TY IR +    P        ++  +       +SP
Sbjct: 369 ASNMFNESGRTIP-ERSSLRRSKFNTYKIRLEGSGLPQAANLKNLMNMRTSDDRRSTSSP 427

Query: 378 ----------GSIND---IYDHYREPSGDWSS 396
                     GS+ND   I+DHYR  S DWS+
Sbjct: 428 ACYARLPQEQGSLNDFQEIFDHYRRTSTDWST 459

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 26/27 (96%)

Query: 6  SEVYIAAQSLDKELRSVKNLKRLSIGS 32
          S+V+IAA+SLD E+++VKNLKRLSIGS
Sbjct: 51 SDVFIAAKSLDTEIQNVKNLKRLSIGS 77

>Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273C
           (ZDS1) - peripheral plasma membrane protein [contig 36]
           FULL
          Length = 925

 Score =  161 bits (407), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 161/305 (52%), Gaps = 63/305 (20%)

Query: 130 VDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEH 189
           V R   SK   ++++   D V QNL WV A+QHPNVKPENY+ELVQD LH + ID   E 
Sbjct: 150 VRRGGMSKKPRELSNGGDDNVTQNLFWVPANQHPNVKPENYLELVQDTLHTLSIDS--EV 207

Query: 190 DKENSDTLDKVSRYYNS-NNKRSPNN------TGLVRRPSLLRKSYTEFD-----EVKDS 237
           +     T++  + Y  S N K SP++        LVRRPS LRKSYTE +     E++DS
Sbjct: 208 EPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPSGLRKSYTELEDLLQHEIQDS 267

Query: 238 D---IKEQSSTNNNVDSTPH--NKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMAS 292
           D      QS  NN + + P   +   +LKDITEELTRISNKAG T+ DAV LARTLSMAS
Sbjct: 268 DENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISNKAGFTDGDAVCLARTLSMAS 327

Query: 293 VAEEDETDDLQERPEAEDDYARQSRNN----DDNYASTMLLPTDSLIKSEHSTLKRSKY- 347
                         + E   A QS N     D  YAST+L   + L     S+L+RSK+ 
Sbjct: 328 SY------------DGEQSQANQSANTDHTPDSEYASTILT-KNGLAIPARSSLRRSKFN 374

Query: 348 TYHIRT------------------QEDKDPTIPVSTESQHQDVIEASPGSIND---IYDH 386
           TY IRT                  +E KDP   +    + +     SP S+ND   IYDH
Sbjct: 375 TYRIRTPNGSSVTSSSLRSTSLPNEERKDPEGYIEKSDRLR-----SPTSVNDFNEIYDH 429

Query: 387 YREPS 391
           YR+ S
Sbjct: 430 YRQGS 434

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 84/94 (89%)

Query: 722 PPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHL 781
           PPRKLTF+DV K ++ N+P++F+DS+FGFPLP LT STV+M DHRL I+VERAIYRLSHL
Sbjct: 812 PPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRLSHL 871

Query: 782 KLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           KL + KR LR+QV+LSNFMY+YLNLVNH+LY++Q
Sbjct: 872 KLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQ 905

>CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 828

 Score =  159 bits (403), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%)

Query: 723 PRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHLK 782
           P+KLTF DVKK ++ANAP+EFTDSAFGFPLP LT STVIM DHRL I+VERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 783 LSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           LS + R LR+QVLLSNFMY+YLNLV HTL +E+
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEE 788

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 199/374 (53%), Gaps = 49/374 (13%)

Query: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSXXXXXXXXXXXXXYNNGYRN-SWSTQLEQG--- 61
           SE   AAQSLD+E+++VKNLKRLSIGS                   + S+   L  G   
Sbjct: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSNGSFT 80

Query: 62  --DKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPG-SPKSLTR 118
             D        SD    ++ I R  R+ +            T  +NT++    SPK + R
Sbjct: 81  EEDDTTTEIDGSDADETSASIDRT-RVEY-----------LTSYDNTQESSNESPKGVAR 128

Query: 119 RGAVNF----------SSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPE 168
             ++N           S +    R + S ++ K        V+  L WV A+QHPNVKPE
Sbjct: 129 TRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPANQHPNVKPE 188

Query: 169 NYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTG-----LVRRPSL 223
           NY+ELV++ L+ I+   T+  +K  +++ ++VS      NK + N  G     +VRRPS 
Sbjct: 189 NYLELVKETLNKIRDINTDGKEKSENNSEEEVS------NKENINENGRLRGSIVRRPSK 242

Query: 224 LRKSYTEFDEVKDSDIKEQSSTNNNVDS---TPHNKKFTLKDITEELTRISNKAGLTNND 280
           LRKSYTEF   +D ++ +++ +NN + S   T ++K+ +LK+IT EL + SNKAGLT+++
Sbjct: 243 LRKSYTEFSS-EDLELLDKALSNNRIISTRNTTNSKRLSLKEITNELVKHSNKAGLTDDN 301

Query: 281 AVTLARTLSMA-SVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEH 339
           AVTLARTLS+A SV  ++ET       ++  +  +QS + DD+  +T ++     + S  
Sbjct: 302 AVTLARTLSIASSVTNQNETG---RNDQSNTEQQKQSEDADDDTFATAVVGNSHSLASNT 358

Query: 340 STLKRSKY-TYHIR 352
           S+L+RSK+ TY ++
Sbjct: 359 SSLRRSKFNTYRVK 372

>Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W
           (REAL)
          Length = 948

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 74/93 (79%), Positives = 80/93 (86%)

Query: 723 PRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHLK 782
           PRKL F DV K +  NAPI+FTDSAFGFPLP +  STVIMFDHRL I+VERAIYRLSHLK
Sbjct: 825 PRKLIFEDVIKPEYPNAPIKFTDSAFGFPLPMIANSTVIMFDHRLNINVERAIYRLSHLK 884

Query: 783 LSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
           LS+  R LR+QVLLSNFMYSYLNLVNHTLYMEQ
Sbjct: 885 LSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 917

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 143/496 (28%), Positives = 217/496 (43%), Gaps = 149/496 (30%)

Query: 150 VAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNK 209
             QNLLWV A+QHPNVKPENY+EL+QD L NIQI   +E D+         S+    NN 
Sbjct: 211 FTQNLLWVPANQHPNVKPENYLELIQDTLQNIQISVDQEFDE---------SKLELGNNH 261

Query: 210 RSPN---NTGLVRRPSLLRKSYTEFDE---VKDSDIKEQSSTNNNVDSTPHN--KKFTLK 261
             PN   +  +VR PS L+ SY++FD+   +     +EQ      + S+     +  +LK
Sbjct: 262 AFPNRQRSGSIVRNPSRLKTSYSKFDDEPSLAGQPQQEQEQVERRIPSSEFKSMRSVSLK 321

Query: 262 DITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDD 321
           +ITEELT+ISN AGLT++DAVTLAR+LSM+       + +L          +  +  ND+
Sbjct: 322 EITEELTKISNNAGLTDSDAVTLARSLSMSGSFT---SGNLH--------LSNNNAENDN 370

Query: 322 NYASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQ-----EDKDPTIPVS---TESQHQDV 372
            +AS M       I  E S+L+RSK+ TY IR +     +   P   +S   +E +    
Sbjct: 371 EFASNMFNEIGGGIP-ERSSLRRSKFNTYKIRLEGSGLSQASRPNSLMSIQISEGRRSAS 429

Query: 373 IEAS-------PGSIND---IYDHYREPSGDWSSLIQVAPENENKKRTD-TDIDSNTKIV 421
           + AS        GS+ND   I+DHYR+ S +W +        EN K  D T+  S+ + +
Sbjct: 430 LPASYAQLPQQQGSLNDFQEIFDHYRKTSTEWGT--------ENTKYVDNTNYYSDEEDL 481

Query: 422 QHSTEHVDLGSTGHSTSDKSDINK--------------------------KEPAHRKKRN 455
            H++   D       +S+ S + K                           EP H     
Sbjct: 482 THASISQDSSFLSTDSSNNSVLMKPHNSGSMISERLDQDTISNENENTGISEPNH----- 536

Query: 456 GWLWSSKTSEKVNVTS-------DKHENEDIVP---------------------ESRFNH 487
           GW W +  +E  +          D+ + ED +                        R NH
Sbjct: 537 GWSWLNSGNENSSNNDHIYEPLMDEQDAEDCLENEEANFVNLSVSRRAKSTKRVSERINH 596

Query: 488 SKNRHEPLY------NHKIEIANTL----------GTLPE-----------------KKN 514
           SKNRH P+       +  + I +++           T+P                  KK 
Sbjct: 597 SKNRHSPILQMPSDGSKSVVITSSVPSSPPLQSSEATIPAAAEKEQNCPDDNRPLSHKKQ 656

Query: 515 AIDKKISNIFRRKHHT 530
           +++K+++ +F+RK H 
Sbjct: 657 SLEKRLARLFKRKQHC 672

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 83/98 (84%)

Query: 718  KPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYR 777
            +P   P KL+F+DVK+ DK N  + FTDSAFGFPLP LT STVIMFD+RLPI VERAIYR
Sbjct: 963  QPTDIPHKLSFSDVKRLDKPNGTMIFTDSAFGFPLPLLTNSTVIMFDYRLPISVERAIYR 1022

Query: 778  LSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
            LSHLKLS  KR LR+QVLLSNFMY+YL+LVNHTLYME+
Sbjct: 1023 LSHLKLSEPKRTLRQQVLLSNFMYAYLHLVNHTLYMEK 1060

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 31/47 (65%)

Query: 371 DVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSN 417
           D+I+ SP  I DIY+HYR+PS D   +++     +N++ T  +++++
Sbjct: 497 DIIDTSPIDIQDIYNHYRQPSSDDEEILKYLKSKDNEETTHKEVETD 543

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (84%)

Query: 7  EVYIAAQSLDKELRSVKNLKRLSIGS 32
          E+ IAAQ+LD E++SVK LKR SIGS
Sbjct: 39 ELLIAAQTLDFEVQSVKELKRFSIGS 64

>TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1072

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 4/122 (3%)

Query: 698  VTATPSQ----REEATDSSKTASKKPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLP 753
            V+ TP +    ++ +T+ +  A      P RKLTFADV    +AN P++F DS FGFPLP
Sbjct: 911  VSKTPKRSSRGQQASTNGNGPAPVTSTLPLRKLTFADVPPTGRANGPVQFMDSTFGFPLP 970

Query: 754  ELTYSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYM 813
             LT ST+IMF++RLPI VERAIYRLSHLKL ++K+ LR+QVLLSNFMY+YL+LVNH+LY+
Sbjct: 971  LLTRSTIIMFENRLPISVERAIYRLSHLKLGDTKKELRQQVLLSNFMYAYLHLVNHSLYL 1030

Query: 814  EQ 815
            EQ
Sbjct: 1031 EQ 1032

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 98/353 (27%), Positives = 137/353 (38%), Gaps = 121/353 (34%)

Query: 156 WVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNT 215
           WVRADQHPNV P   +  V   L N+ I+  +   K      D++S  Y  N       +
Sbjct: 150 WVRADQHPNVSPSKQLNEV---LENLHIEDKQVTKK------DRLSITYKKNK------S 194

Query: 216 GLVRRPSLLRKSYTEFDEVKDSDIKEQS----------------STNNNVD--------- 250
            +VRRPS LR S    DE  DSDI++ S                STN+  D         
Sbjct: 195 SIVRRPSKLRHSSN--DESFDSDIEDPSFTKDHDTFSFENESSFSTNDQTDISITRFDSR 252

Query: 251 -----STPHNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQER 305
                +   N + +LK+IT+ELTRISN AGL ++DA+ LA++L + S  + +  D   ++
Sbjct: 253 DTINSNGNSNHRLSLKNITDELTRISNDAGLVDSDAINLAQSLGLTSSYQNNINDFYDDK 312

Query: 306 PEAEDDYARQSRNNDDNY-------------ASTMLLPTDSLIKSEHSTLKRSKY-TYHI 351
             A  D      +N + +             +       + +     S+L+RSK+ TY  
Sbjct: 313 NLAIYDSTINESSNMETFNEQDKILNLNSENSKGGTFAVNGMKVPMRSSLRRSKFNTYRY 372

Query: 352 RTQEDKDPTIPVSTE-------SQH-----QDVIE------------------------- 374
                KD  IP   E       SQH      DV E                         
Sbjct: 373 SRNNQKDSDIPEKKEIENPYMGSQHISEEKSDVTEIQVALSNNQNALVSPERNNDKISFK 432

Query: 375 ----------------------ASPGS-INDIYDHYREPSGDWSSLIQVAPEN 404
                                 +SP S   DIYDHYR+PS +W   I  A +N
Sbjct: 433 DSQKDYLTKPIEEKADADEQSGSSPVSDFQDIYDHYRQPSSEWEDEIFNASKN 485

>YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein
           with a role in regulating Swe1p-dependent polarized
           growth; involved in maintenance of Cdc55p in the
           cytoplasm where it promotes mitotic entry; interacts
           with silencing proteins at the telomere; implicated in
           the mitotic exit network through regulation of Cdc14p
           localization; paralog of Zds1p
          Length = 942

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 151/502 (30%), Positives = 225/502 (44%), Gaps = 161/502 (32%)

Query: 149 EVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNN 208
           ++ QNLLWV ADQHPNVKPENY+EL+QD L NIQI   ++ D+   + L+  + +  SN 
Sbjct: 206 DLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDE---NKLELGNNHVISNR 262

Query: 209 KRSPNNTGLVRRPSLLRKSYTEFDE---VKDSDIKEQSSTNNNVDSTPHN--KKFTLKDI 263
           KR+     +VRRPS L+ SYT+FD+   + D   + +   +  + S+     +  +LK+I
Sbjct: 263 KRT---GSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEI 319

Query: 264 TEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNY 323
           TEELT+ISN AGLT++DAVTLAR+LSM+  +  +E+  L                ND+ +
Sbjct: 320 TEELTKISNNAGLTDSDAVTLARSLSMSG-SFTNESLHLN----------GNHTENDNEF 368

Query: 324 ASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDP--------------------TIP 362
           AS M   T  L   E S+L+RSK+ TY IR +    P                    + P
Sbjct: 369 ASNMFNET-GLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDNRRSASSP 427

Query: 363 VSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTD----------- 411
            S     Q+  +AS    ++I+DHYR  S DWS+        EN+K  D           
Sbjct: 428 ASYTQVPQE--QASLNDFHEIFDHYRRTSTDWST--------ENEKYVDSTNYYSDEEDL 477

Query: 412 -------------TDIDSNTKIVQ-HST---------EHVDLGSTGHSTSDKSDINKKEP 448
                        TD  +N+ +++ H+T         +HV       S+S+KS+ N  E 
Sbjct: 478 THASISQESSLLSTDSSNNSVLIKPHNTGSMISEKLDQHV-------SSSEKSNTNNSEA 530

Query: 449 AHRKKRNGWLWSSKTSEKVNVTSDKH---------------ENEDIVPES---------- 483
            H     GW W + ++  +N     +               E  D V  S          
Sbjct: 531 NH-----GWSWLNSSNGSLNANEQTYQQLTDDEDDEECVDNEKADFVNLSVSRRAKSTKR 585

Query: 484 ---RFNHSKNRHEPLYNHKIEIANTLGTLPE----------------------------- 511
              R NHSKNRH P++    E A ++   P                              
Sbjct: 586 ASERINHSKNRHSPIFQIHSEEAKSVVITPSVVSSSESQPSKPTAPAVVEKKVELPTDTQ 645

Query: 512 ----KKNAIDKKISNIFRRKHH 529
               KKN+++K+++ +F+RK H
Sbjct: 646 ASTHKKNSLEKRLAKLFKRKQH 667

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score =  150 bits (379), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 69/91 (75%), Positives = 80/91 (87%)

Query: 725  KLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHLKLS 784
            KLTFADVK+  + N+ + F +SAFGFPLP LT ST+IM D+RLPI+VERAIYRLSHLKLS
Sbjct: 1430 KLTFADVKRNLQPNSSMIFQESAFGFPLPPLTNSTIIMIDNRLPINVERAIYRLSHLKLS 1489

Query: 785  NSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815
            + KR LREQVLLSNFMYSYL+LVNHTLY+EQ
Sbjct: 1490 DPKRELREQVLLSNFMYSYLHLVNHTLYLEQ 1520

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 88/174 (50%), Gaps = 47/174 (27%)

Query: 154 LLWVRADQHPNVKPENYIELVQDALH---NIQI--------DKTEEHDKENSDTLD--KV 200
           L W   ++  ++KP+NYIELV DA++   N+ +        +K E+ D    +  D  KV
Sbjct: 368 LSWSSVNKRSSLKPDNYIELVNDAINSSNNVSVTTNSTPTANKIEQGDSYYDNIPDSRKV 427

Query: 201 SRYYNSNNKRSPNNTGLVRRPSLLRKSYTEFD--------------------EVKDSDIK 240
               NSN          VRRPS LR SYT+ D                    EV ++D +
Sbjct: 428 KYRRNSN----------VRRPSSLRNSYTDLDFNLADYEDNLNISNVSNSIDEVSNNDHQ 477

Query: 241 EQSSTNNNVDSTPHNKK----FTLKDITEELTRISNKAGLTNNDAVTLARTLSM 290
                + N D+   N       TLKD+T+ELT++SN AGLT++DA+TLA+TLS+
Sbjct: 478 LTPDDSFNFDANVTNNSVASNLTLKDLTDELTKLSNNAGLTDSDAITLAKTLSL 531

 Score = 38.5 bits (88), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 19/29 (65%), Positives = 25/29 (86%)

Query: 4  QNSEVYIAAQSLDKELRSVKNLKRLSIGS 32
          +NS+V IAAQSLD ++++VK LKR SIGS
Sbjct: 35 RNSDVRIAAQSLDLQVQNVKKLKRQSIGS 63

>Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar to
           Ashbya gossypii AAL185W
          Length = 896

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 105/272 (38%), Positives = 144/272 (52%), Gaps = 47/272 (17%)

Query: 150 VAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNK 209
            + NLLWV ADQHPNVK ENY+ELV D LHN+Q+   E+ +K  +           S ++
Sbjct: 125 FSSNLLWVPADQHPNVKLENYLELVTDTLHNLQLVGREQLEKNPNSNYQLSQTNSTSAHE 184

Query: 210 RSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHNKK---FTLKDITEE 266
             P+   LVR+PS LRKS+TE + + D +  E  +T      TP +K+    +LK+ITEE
Sbjct: 185 AIPSKNSLVRKPSRLRKSFTEAENIDDPNSDEDLNTE-----TPISKRKRVSSLKEITEE 239

Query: 267 LTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYAST 326
           LTRISN AGLT++DA+TLARTL + + A  D  +       + D+        D+ YAS 
Sbjct: 240 LTRISNNAGLTDSDAITLARTLGIGTPAATDRRNFTNTDVASNDEI-------DEEYASN 292

Query: 327 MLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKD----------PTIP------------- 362
           +L   + L  S+ S+L+RSK+ TY IR+               P++P             
Sbjct: 293 ILT-KNGLSISQGSSLRRSKFATYRIRSPSGDSLPLLESGSLLPSLPEYAQEQVANHLKD 351

Query: 363 --VSTESQHQDVIEA-----SPGSINDIYDHY 387
             V  E Q     +A     SP SINDIYDHY
Sbjct: 352 AHVFKEGQPPQSWDASITPQSPNSINDIYDHY 383

>Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [222
           bp, 74 aa] {ON} YMR273C (REAL)
          Length = 74

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 41/86 (47%), Gaps = 26/86 (30%)

Query: 219 RRPSLLRKSYTEFDEVKDSD------------IKEQSS--TNNNVDSTPHNKKFTLKDIT 264
           RR S LR SYTEFD+++D +            ++E++S    N    T  NKK       
Sbjct: 1   RRSSTLRSSYTEFDDIEDENGQRNKDSKFVNKVEERTSRIRENECHETLKNKK------- 53

Query: 265 EELTRISNKAGLTNNDAVTLARTLSM 290
                ISN A LT+   + L RTLS+
Sbjct: 54  -----ISNSASLTDIGVIALVRTLSI 74

>Kwal_56.22637 s56 (213527..215314) [1788 bp, 595 aa] {ON} YDR484W
           (SAC2) - involved in localization of actin and chitin
           [contig 184] FULL
          Length = 595

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 10/85 (11%)

Query: 487 HSKNRHEPLYNHKIEIANTLGTL----------PEKKNAIDKKISNIFRRKHHTRRANQE 536
           H   R EPLYN  I I N   T+          PE+  A++        ++++  R  Q 
Sbjct: 501 HIDERSEPLYNSIIRIRNDFETVMTKCSKKTKHPERFLAVNYTYLLDALQQNYISRLRQG 560

Query: 537 NSLAGLKISQLQWRNNDHKEKAVEA 561
           +  +  KIS +     DH E  VEA
Sbjct: 561 HDDSNFKISLIYQETKDHLEAIVEA 585

>Suva_13.192 Chr13 (312330..313466) [1137 bp, 378 aa] {ON} YMR024W
           (REAL)
          Length = 378

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 328 LLPTDSLIKSEHSTLKRSKYTYHIRTQEDKDPTIPVSTESQHQDVIEASPGSINDI 383
            LP   +++ + S+L   +Y YH  +++ +   +P S  +Q++D  +   G+IN+I
Sbjct: 21  CLPGACVLQ-QSSSLPSKRYLYHSTSRQQQQAFLPESELAQYRDYYQGLKGAINEI 75

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,457,961
Number of extensions: 4588030
Number of successful extensions: 24588
Number of sequences better than 10.0: 974
Number of HSP's gapped: 25598
Number of HSP's successfully gapped: 1152
Length of query: 817
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 699
Effective length of database: 39,950,811
Effective search space: 27925616889
Effective search space used: 27925616889
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 70 (31.6 bits)