Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0F03399g8.829ON38038018700.0
NCAS0C004708.829ON42638213610.0
Suva_13.4608.829ON38438413021e-180
SAKL0D01760g8.829ON38138312971e-179
Smik_13.4858.829ON38438412911e-178
NDAI0K004708.829ON38638612911e-178
YMR272C (SCS7)8.829ON38438412821e-177
KLLA0D01639g8.829ON38138312801e-176
Skud_13.4448.829ON38438412791e-176
KNAG0J003208.829ON37337612491e-172
Kpol_541.98.829ON37437912471e-171
TDEL0B006808.829ON38338712071e-165
KLTH0C04114g8.829ON37838011951e-163
ZYRO0G13948g8.829ON38438411941e-163
KAFR0B038508.829ON37738211921e-163
Ecym_27128.829ON38138511711e-160
Kwal_27.103328.829ON37838311681e-159
TPHA0C047108.829ON37737511101e-150
AAL183W8.829ON37737911091e-150
TBLA0D031808.829ON40038910971e-148
Kpol_1069.48.829ON2772567961e-104
Kpol_1014.54.304ON596931232e-06
Kwal_47.18167na 1ON227601068e-05
NDAI0F027302.166ON121371001e-04
NCAS0G025702.166ON12167973e-04
KLTH0A04026gna 1ON23346997e-04
ZYRO0B09812g2.166ON18382950.001
KLTH0D06930g2.536ON20462930.003
NCAS0F008702.536ON18960920.003
Suva_14.2282.166ON12047860.009
CAGL0L03828g2.166ON12166850.011
KNAG0I020402.166ON11970850.011
NDAI0H013702.536ON22453880.012
TDEL0F012102.166ON12630850.013
KAFR0B045502.166ON12663850.014
Kpol_505.142.166ON12347830.023
Skud_14.2212.166ON12047820.028
KLLA0F27577gna 1ON17244840.028
Kwal_26.80462.536ON19851850.028
Suva_13.1054.304ON59136860.041
YML054C (CYB2)4.304ON59154860.044
KNAG0E038604.304ON60474850.054
Skud_13.924.304ON59154850.061
SAKL0F08316gna 1ON17844810.070
ZYRO0B02090g2.536ON19451820.077
Smik_13.924.304ON59137840.077
NCAS0A029704.14ON310597850.080
KAFR0I005204.304ON58668840.083
KLTH0C11770gsingletonON61866840.088
ADL085Cna 1ON27330820.095
TDEL0A031102.536ON20051810.098
NDAI0D047104.304ON61648830.11
CAGL0K03069g2.536ON19446800.12
SAKL0E10626g2.166ON12337770.16
TBLA0B013102.166ON12353760.17
TPHA0B018204.304ON57657810.19
Ecym_4346na 1ON20940790.20
Kwal_26.84612.166ON12337750.27
AFL223W2.166ON16554760.30
NCAS0A02770na 2ON60937790.35
Kwal_14.807singletonON57883780.41
Smik_14.2162.166ON12047730.41
KLLA0B14795gna 3ON55627780.42
TDEL0H02180na 1ON20330750.52
TBLA0I015302.536ON22133750.56
TDEL0D00190singletonON55232760.67
Ecym_54202.166ON14551730.72
TDEL0D011404.304ON58461760.78
TDEL0B048902.125ON156848760.79
KLTH0D09284g2.166ON12337710.90
TPHA0F017902.166ON18237730.99
YNL111C (CYB5)2.166ON12047701.1
KLTH0C11858gsingletonON55542741.1
NDAI0D04700na 2ON62530741.2
NCAS0A027804.304ON60250741.4
ZYRO0B13728g4.304ON59830731.5
SAKL0G16852g4.304ON58043731.5
Kpol_348.122.536ON21736721.6
CAGL0K10736g4.304ON59361731.7
KLTH0D08624g2.593ON432117731.7
SAKL0F16610gsingletonON56430712.8
NDAI0H002304.10ON722131713.1
Kwal_26.83312.593ON432126703.5
Kwal_23.2823na 3ON56035694.5
Kpol_1045.503.172ON32782685.4
TPHA0G035502.536ON21833668.1
ZYRO0C18524gsingletonON55430678.2
KLLA0F23672g2.166ON12346648.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F03399g
         (380 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   724   0.0  
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      528   0.0  
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   506   e-180
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   504   e-179
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   501   e-178
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   501   e-178
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   498   e-177
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   497   e-176
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   497   e-176
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   485   e-172
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   484   e-171
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   469   e-165
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   464   e-163
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   464   e-163
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   463   e-163
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   455   e-160
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   454   e-159
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   432   e-150
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   431   e-150
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   427   e-148
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   311   e-104
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    52   2e-06
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    45   8e-05
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      43   1e-04
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    42   3e-04
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    43   7e-04
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    41   0.001
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    40   0.003
NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.53...    40   0.003
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    38   0.009
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    37   0.011
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    37   0.011
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      39   0.012
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    37   0.013
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    37   0.014
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    37   0.023
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    36   0.028
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    37   0.028
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    37   0.028
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    38   0.041
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    38   0.044
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    37   0.054
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    37   0.061
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    36   0.070
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    36   0.077
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    37   0.077
NCAS0A02970 Chr1 (576222..585539) [9318 bp, 3105 aa] {ON} Anc_4....    37   0.080
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    37   0.083
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    37   0.088
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    36   0.095
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    36   0.098
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    37   0.11 
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    35   0.12 
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    34   0.16 
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    34   0.17 
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    36   0.19 
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    35   0.20 
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    33   0.27 
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    34   0.30 
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               35   0.35 
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    35   0.41 
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    33   0.41 
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    35   0.42 
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                33   0.52 
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    33   0.56 
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 34   0.67 
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    33   0.72 
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    34   0.78 
TDEL0B04890 Chr2 complement(857124..861830) [4707 bp, 1568 aa] {...    34   0.79 
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    32   0.90 
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    33   0.99 
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    32   1.1  
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    33   1.1  
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             33   1.2  
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     33   1.4  
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    33   1.5  
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    33   1.5  
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    32   1.6  
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    33   1.7  
KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} simila...    33   1.7  
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    32   2.8  
NDAI0H00230 Chr8 (34281..36449) [2169 bp, 722 aa] {ON} Anc_4.10        32   3.1  
Kwal_26.8331 s26 (741843..743141) [1299 bp, 432 aa] {ON} YMR033W...    32   3.5  
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    31   4.5  
Kpol_1045.50 s1045 (118821..119804) [984 bp, 327 aa] {ON} (11882...    31   5.4  
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    30   8.1  
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    30   8.2  
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    29   8.4  

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/380 (93%), Positives = 356/380 (93%)

Query: 1   MSVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDG 60
           MSVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDG
Sbjct: 1   MSVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDG 60

Query: 61  KHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVK 120
           KHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVK
Sbjct: 61  KHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVK 120

Query: 121 DLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAP 180
           DLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAP
Sbjct: 121 DLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAP 180

Query: 181 LFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLH 240
           LFGNFLEAFTKTA            LYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLH
Sbjct: 181 LFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLH 240

Query: 241 RFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALP 300
           RFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALP
Sbjct: 241 RFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALP 300

Query: 301 YYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSWFW 360
           YYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMR            NYQLGFGVTSWFW
Sbjct: 301 YYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSWFW 360

Query: 361 DKVFGTYLGPDAPLSKMKYE 380
           DKVFGTYLGPDAPLSKMKYE
Sbjct: 361 DKVFGTYLGPDAPLSKMKYE 380

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/382 (67%), Positives = 298/382 (78%), Gaps = 4/382 (1%)

Query: 2   SVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGK 61
            ++++ SKTLELF +  +AKHN+++DCWV+ ++RKIYDVSK+L DHP+   ++ K   GK
Sbjct: 46  QMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHA-GK 104

Query: 62  HGTDISQMELTTLK--FVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLN-ADNTFDSTTF 118
             T++ + E    +   + D YL+GY+AT  EE+KLLTNK HKVEVKLN + NTFDSTTF
Sbjct: 105 DITELLKDEKIDQQTDLLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTF 164

Query: 119 VKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGS 178
           VKDLPTEDKLSI TDYE+D KKH FLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYG+ S
Sbjct: 165 VKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQES 224

Query: 179 APLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYC 238
           APLFGNFLE FTKTA             Y I  A  N+N   A+ LF +G++VWT IEYC
Sbjct: 225 APLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYC 284

Query: 239 LHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAA 298
           +HRFLFHFDE LPEH+  +MIHFLLHGCHHYLPMD YRLVVPP LF+ LCAP YKLVFA 
Sbjct: 285 MHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFAL 344

Query: 299 LPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSW 358
           LPYYWACAGFAGGM GYICYDLCHYFLHHSK+PPFMR            NYQLG+GVTSW
Sbjct: 345 LPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSW 404

Query: 359 FWDKVFGTYLGPDAPLSKMKYE 380
           +WDK FGTYL PD+PLSKMKY+
Sbjct: 405 YWDKKFGTYLSPDSPLSKMKYQ 426

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  506 bits (1302), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 245/384 (63%), Positives = 291/384 (75%), Gaps = 6/384 (1%)

Query: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAV-----HKA 57
           ++ ++SKTLELF +  + +HN+  DCWV+   RKIYDV+K+L +HP   +++        
Sbjct: 1   MSTNTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDI 60

Query: 58  LDGKHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNT-FDST 116
            +    +D+ +   +  + + D+YLVGYLAT +E  +LLTNK+HKVEV+L+AD T FDST
Sbjct: 61  TEVMKDSDVHEHSESAYEILEDEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDST 120

Query: 117 TFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176
           TFVKDLPTE+KLSI TDY  DYKKHKFLDLNKPLL QIL  +FT+DFY+DQIHRPRHYGK
Sbjct: 121 TFVKDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGK 180

Query: 177 GSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIE 236
           GSAPLFGNFLE  TKTA            +Y +  AL NMN   A FLFG+G+FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIE 240

Query: 237 YCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVF 296
           Y LHRFLFHFD+WLPE ++ F  HFLLHGCHHYLPMD YRLV+PP+LFV+LCAP YKLVF
Sbjct: 241 YSLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVF 300

Query: 297 AALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVT 356
           A LP YWA AGFAGG+ GY+CYD CHYF+HHSK+PPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 357 SWFWDKVFGTYLGPDAPLSKMKYE 380
           SWFWD VFGTYLGPDAPLSKMKYE
Sbjct: 361 SWFWDDVFGTYLGPDAPLSKMKYE 384

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  504 bits (1297), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 246/383 (64%), Positives = 288/383 (75%), Gaps = 11/383 (2%)

Query: 6   DSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALD--GKHG 63
             SKTL L  ++ L++HN+K+DCWVS + RK+Y+V+ +L++HP     +   LD  G+  
Sbjct: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYI---LDHAGEDI 58

Query: 64  TDISQMEL------TTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117
           T+I + +L      +  + + D YLVGYLA  +EEKKLLTN+ H VEVKLN    FDSTT
Sbjct: 59  TEIMKDKLVHEHSESAYEIMNDMYLVGYLANEEEEKKLLTNEDHTVEVKLNESTQFDSTT 118

Query: 118 FVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177
           FVK+LPTEDKLSI TDY  DYKKHKFLDL+KPLL Q++FGNFTKDFYLDQ+HRPRHYGKG
Sbjct: 119 FVKELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKG 178

Query: 178 SAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEY 237
           SAPLFGNFLE  +KT              Y +  AL NMN P ALFLF LG+FVWTLIEY
Sbjct: 179 SAPLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEY 238

Query: 238 CLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFA 297
           CLHRFLFH D++LPE  + F +HFLLHG HHYLPMD YRLV+PP LFV+LC P YKLVF+
Sbjct: 239 CLHRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFS 298

Query: 298 ALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTS 357
            LPYYWACAGFAGGMLGY CYDL HYFLHH+K+PP+MR            NY+LGFGVTS
Sbjct: 299 LLPYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTS 358

Query: 358 WFWDKVFGTYLGPDAPLSKMKYE 380
           WFWDKVFGTYLG DAPLSKMKYE
Sbjct: 359 WFWDKVFGTYLGSDAPLSKMKYE 381

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  501 bits (1291), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/384 (63%), Positives = 289/384 (75%), Gaps = 6/384 (1%)

Query: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAV-----HKA 57
           ++A++SKTLELF +  + KHN+  DCWV+   RKIYDV+K+L +HP   +++        
Sbjct: 1   MSANTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDI 60

Query: 58  LDGKHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNT-FDST 116
            +    TD+ +   +  + + D+YL+GYLAT +E  +LLTNK+HKVEV+L++D T FDST
Sbjct: 61  TEVMKDTDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDST 120

Query: 117 TFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176
           TFVKDLP E+KLSI TDY  DYKKHKFLDLN+PLL QIL  +F KDFY+DQIHRPRHYGK
Sbjct: 121 TFVKDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGK 180

Query: 177 GSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIE 236
           GSAPLFGNFLE  TKTA            +Y +  AL NMN   A FLF +G+FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 237 YCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVF 296
           Y LHRFLFHFD+WLPE ++ F  HFLLHGCHHYLPMD YRLV+PP LFV+LCAP YKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 297 AALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVT 356
           A LP YWA AGFAGG+ GY+CYD CH+FLHHSK+PPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 357 SWFWDKVFGTYLGPDAPLSKMKYE 380
           SWFWD+VFGTYLGPDAPLSKMKYE
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  501 bits (1291), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 246/386 (63%), Positives = 292/386 (75%), Gaps = 8/386 (2%)

Query: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADA-VHKALDGK 61
           ++ ++SKTLELF +  +A HN+ DDCW++  +RKIYDV+K+L D+P +A+  +     GK
Sbjct: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60

Query: 62  HGTDISQMELTTLK------FVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLN-ADNTFD 114
             TD  + ++ ++K        TD YL+GYLAT  EEK LLTNK HKVEV+LN A N FD
Sbjct: 61  DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFD 120

Query: 115 STTFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHY 174
           STTFVKDLPTEDKLSI TD ++D +KHKFLDL+KPLLKQILFGNFTKDFYLDQIHRPRHY
Sbjct: 121 STTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHY 180

Query: 175 GKGSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTL 234
           G  SAPLFGN LE  TKT+             Y I  AL NMN   A+ LF +GI+VWTL
Sbjct: 181 GDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTL 240

Query: 235 IEYCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKL 294
           IEYC+HRFLFHFDE LPEH++F++IHFLLHGCHHYLPMD YRLVVPP LF+ LC P YK+
Sbjct: 241 IEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKV 300

Query: 295 VFAALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFG 354
           VF  LP YWA AGFAGG+ GY+CYDLCHYFLHHSKMPP +R            NYQLG+G
Sbjct: 301 VFKLLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYG 360

Query: 355 VTSWFWDKVFGTYLGPDAPLSKMKYE 380
           VTSW+WDK+FGTYL PD+P+SKMKYE
Sbjct: 361 VTSWYWDKIFGTYLSPDSPMSKMKYE 386

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  498 bits (1282), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 239/384 (62%), Positives = 289/384 (75%), Gaps = 6/384 (1%)

Query: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAV-----HKA 57
           ++ ++SKTLELF +  + +HN+ +DCWV+   RKIYDV+++L +HP   +++        
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60

Query: 58  LDGKHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNT-FDST 116
            +    +D+ +   +  + + D+YL+GYLAT +E  +LLTNK+HKVEV+L+AD T FDST
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120

Query: 117 TFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176
           TFVK+LP E+KLSI TDY  DYKKHKFLDLN+PLL QIL  +F KDFY+DQIHRPRHYGK
Sbjct: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 177 GSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIE 236
           GSAPLFGNFLE  TKTA            +Y +  AL NMN   A FLF +G+FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 237 YCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVF 296
           Y LHRFLFHFD+WLPE ++ F  HFLLHGCHHYLPMD YRLV+PP LFV+LCAP YKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 297 AALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVT 356
           A LP YWA AGFAGG+ GY+CYD CH+FLHHSK+PPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 357 SWFWDKVFGTYLGPDAPLSKMKYE 380
           SWFWD+VFGTYLGPDAPLSKMKYE
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  497 bits (1280), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 246/383 (64%), Positives = 286/383 (74%), Gaps = 13/383 (3%)

Query: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           SS+ L L+ ++ L KHN K+DCWVS ++RKIY+V+++L +HP  A+ +   LD   GTDI
Sbjct: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYI---LDYA-GTDI 58

Query: 67  SQMELTTL---------KFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117
           + +    L         + + + YLVGYLAT +EEKKLLTNK H VEV L  +N FDST 
Sbjct: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTV 118

Query: 118 FVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177
           FVK+LPTEDKLSI TDY+ DYKKHKFLDLNKPLL Q+LFG FTKDFYLDQ+HRPRHYGKG
Sbjct: 119 FVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKG 178

Query: 178 SAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEY 237
           SAPLFGNFLE  +KT              Y I TALMNMN   A+FLF +G+FVWTLIEY
Sbjct: 179 SAPLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEY 238

Query: 238 CLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFA 297
            LHRFLFH D+ LPE    F +HFLLHG HHYLPMD +RLV+PP LFVVLC P YKLVFA
Sbjct: 239 GLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFA 298

Query: 298 ALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTS 357
            LPYYWACAGFAGGMLGY+CYDL HYFLHHS++PP+MR            NY+LGFGVTS
Sbjct: 299 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTS 358

Query: 358 WFWDKVFGTYLGPDAPLSKMKYE 380
           WFWDKVFGTYLG +APLS MKY+
Sbjct: 359 WFWDKVFGTYLGENAPLSNMKYD 381

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  497 bits (1279), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 241/384 (62%), Positives = 288/384 (75%), Gaps = 6/384 (1%)

Query: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAV-----HKA 57
           ++ ++SKTLELF +  + +HN+  DCWV+   RKIYDV+K+L +HP   +++        
Sbjct: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60

Query: 58  LDGKHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADN-TFDST 116
            +    +D+ +   +  + + D+YL+GYLAT +E  +LLTNKSHKVEV+L+AD   FDST
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120

Query: 117 TFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176
           TFVK+LPTE+KLSI TDY  DYKKHKFLDLN+PLL QIL  +F KDFY+DQIHRPRHYGK
Sbjct: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 177 GSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIE 236
           GSAPLFGNFLE  TKTA            +Y +  AL NMN   A FLF +G+FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 237 YCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVF 296
           Y LHRFLFHFD+WLPE ++ F  HFLLHGCHHYLPMD YRLV+PP LFV+LCAP YKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 297 AALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVT 356
           A LP YWA AGFAGG+ GY+CYD CH+FLHHSK+PPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 357 SWFWDKVFGTYLGPDAPLSKMKYE 380
           SWFWD+VFGTYLGPDAPLSKMKYE
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  485 bits (1249), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 241/376 (64%), Positives = 281/376 (74%), Gaps = 4/376 (1%)

Query: 5   ADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
           + +S+TLEL  +  +A HN K+D WV    RK+ D+S Y+++ PE+ + +  +L GK  T
Sbjct: 2   SSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELL-LSLAGKDIT 60

Query: 65  DISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVKDLPT 124
           D S  E   L    DD+LVGYLAT  EEK+LL+NK HKVEVKL    TFDS+TFVKDLPT
Sbjct: 61  DRSH-EFPGLN--ADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLPT 117

Query: 125 EDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPLFGN 184
           EDKLSI TD +RDY+KH FLDL KPL+ Q+LFG+FTKDFY+DQIHRPRHYGKGSAPLFGN
Sbjct: 118 EDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGN 177

Query: 185 FLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHRFLF 244
           FLE  +KTA            LYF+  +L  ++   AL LF LG FVWTLIEYC+HRFLF
Sbjct: 178 FLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLF 237

Query: 245 HFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPYYWA 304
           HFD+WLPE+++ F IHFLLHG HHYLPMD YRLVVPPALFVVLC P YKLVF  LP+Y A
Sbjct: 238 HFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVA 297

Query: 305 CAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSWFWDKVF 364
           CAGFAGGM GYICYDL HYFLHHSKMP FMR            NYQLGFGV++WFWDKVF
Sbjct: 298 CAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVF 357

Query: 365 GTYLGPDAPLSKMKYE 380
            TYLG DAP+S MKY+
Sbjct: 358 DTYLGKDAPISPMKYD 373

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  484 bits (1247), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 237/379 (62%), Positives = 287/379 (75%), Gaps = 6/379 (1%)

Query: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKH 62
           ++A  SKTLELF +S   +HN++ DCWVS  ER IYDVS YLKD+   ADA    L+   
Sbjct: 1   MSAKDSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDN---ADADSSILEHA- 56

Query: 63  GTDISQMELTT-LKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVKD 121
           G DI+++  T   KF++D+YLVGYLAT +EE +LLTNK HKVEV L  D T+DST FVK+
Sbjct: 57  GKDITKLTKTREFKFISDEYLVGYLATEEEEVRLLTNKDHKVEVNLQ-DGTYDSTVFVKE 115

Query: 122 LPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPL 181
           LP E+K ++ TD  +D++ H FLDLNKP+L Q+LFGNFT+DFY+DQ+HRPRHYGKGSAPL
Sbjct: 116 LPAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAPL 175

Query: 182 FGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHR 241
           FGNFLE  + T             +Y ++ AL NMNN  A FLF LGIFVWTLIEYCLHR
Sbjct: 176 FGNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLHR 235

Query: 242 FLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPY 301
           FLFH D+W+P+H++F+ +HFLLHG HHYLPMD YRLVVPPALF+VLC PIYKLVF  LP 
Sbjct: 236 FLFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLPL 295

Query: 302 YWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 361
           YWA AGFAGG+LGYICYDL HYF+HH K+P FMR            NYQLGFGV+++FWD
Sbjct: 296 YWAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFWD 355

Query: 362 KVFGTYLGPDAPLSKMKYE 380
           KVFGTYLGPD+P S M+Y+
Sbjct: 356 KVFGTYLGPDSPASIMRYK 374

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  469 bits (1207), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 237/387 (61%), Positives = 279/387 (72%), Gaps = 13/387 (3%)

Query: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALD--G 60
           ++ D SKTLELF +  +++HN+ +DCWV+   RKIYDV+K+L +HP     +   LD  G
Sbjct: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYI---LDYAG 57

Query: 61  KHGTD------ISQMELTTLKFVTDD-YLVGYLATSDEEKKLLTNKSHKVEVKLNADNTF 113
           K  T+      I +   +  + + D  YLVGY+AT  EEK+LLTN SHKVEVKL A   F
Sbjct: 58  KDITEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL-ATLDF 116

Query: 114 DSTTFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRH 173
           DSTTFVKDLPTE+KLSI TDY RDYK+H FLDL KPLL Q++FG FTKDFY+DQIHRPRH
Sbjct: 117 DSTTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRH 176

Query: 174 YGKGSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWT 233
           YGKGSAPLFGNFLE  +KT+            LY +  A  NMN    +F F LG FVWT
Sbjct: 177 YGKGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWT 236

Query: 234 LIEYCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYK 293
           LIEY LHRFLFHFD+WLPE ++ F +HFLLHG HHYLPMD YRLV+PP LFV+LC P YK
Sbjct: 237 LIEYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYK 296

Query: 294 LVFAALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGF 353
           LVF  LP Y A AGFAGG+ GY+CYDL HYFLHHSK+P FMR            NYQLGF
Sbjct: 297 LVFGLLPLYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGF 356

Query: 354 GVTSWFWDKVFGTYLGPDAPLSKMKYE 380
           GVTSWFWDKVFGTYL P +P+S+MKY+
Sbjct: 357 GVTSWFWDKVFGTYLSPTSPISQMKYD 383

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  464 bits (1195), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 227/380 (59%), Positives = 279/380 (73%), Gaps = 9/380 (2%)

Query: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
            +KTL L+ QS L +HN++DDCWVS H RKIY+V+ +L +HP  A+ + +   GK  T+I
Sbjct: 2   ETKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELI-EEYAGKDVTEI 60

Query: 67  ------SQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVK 120
                  +      + + ++Y VGYLAT +EEKKLL N  H VEVKL  D  +DST FV 
Sbjct: 61  MKDGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHPVEVKLEED--YDSTVFVP 118

Query: 121 DLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAP 180
           ++P E+KLSI TDY +DY +HKFLDLN+PLL Q+L  +F+K+FYLDQ+HRPRHYG+GSAP
Sbjct: 119 EVPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAP 178

Query: 181 LFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLH 240
           LFGNFLE  +KTA            +Y + TAL NMNN LA+FLF LG+FVWTLIEY LH
Sbjct: 179 LFGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLH 238

Query: 241 RFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALP 300
           RFLFH D +LP + + + +HFLLHG HHYLPMD YRLV+PP LFVVLC P YKLVFA LP
Sbjct: 239 RFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLP 298

Query: 301 YYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSWFW 360
            YWACAGFAGGM GY+CYDL HYFLHH+K+P +MR            NY+LGFGVTSWFW
Sbjct: 299 KYWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFW 358

Query: 361 DKVFGTYLGPDAPLSKMKYE 380
           DKVFGTYLG +APLS+MK++
Sbjct: 359 DKVFGTYLGDNAPLSQMKFD 378

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  464 bits (1194), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 227/384 (59%), Positives = 275/384 (71%), Gaps = 9/384 (2%)

Query: 5   ADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
           +  S TL+LF Q  L+KHN++ DCWVS ++RKIY+V+++L +HP  A+ + K   G+  T
Sbjct: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILK-YAGRDIT 60

Query: 65  ------DISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNT--FDST 116
                 D+ +   +  + + D+YLVGYLAT +E  KLLTNK H+VEV L   N   FDST
Sbjct: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120

Query: 117 TFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176
           TFV +LP E+KL+I TDY RDYKKHKFLDLN+ LL Q++FGNF+KDFYLDQ+HRPRHYGK
Sbjct: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180

Query: 177 GSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIE 236
           GSAPLFGNFLE  +KT              +       NMN   + FLF LGIFVWTLIE
Sbjct: 181 GSAPLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240

Query: 237 YCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVF 296
           YCLHRFLFH DEWLP+++    +HFLLHG HHYLPMD YRLV+PP L +VL APIYK VF
Sbjct: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300

Query: 297 AALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVT 356
             LP YWA +GFAGG+ GY+CYDL HYFLHH+K+P +MR            NYQLGFGVT
Sbjct: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 357 SWFWDKVFGTYLGPDAPLSKMKYE 380
           SWFWD VFGTYLGPDAPL+ MKY+
Sbjct: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  463 bits (1192), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 234/382 (61%), Positives = 283/382 (74%), Gaps = 15/382 (3%)

Query: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           ++KTLELF +  +A H  ++DCWV+   RKIYDV+K+L D   + D++   L    GTDI
Sbjct: 3   TAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFL-DENRDFDSL---LLDYAGTDI 58

Query: 67  SQMELTTLKFV-------TDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFV 119
           +  EL   K          D+YLVGY+AT+DEE+KLLTNK HKVEV L  D  FD  T V
Sbjct: 59  TD-ELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD--FDLATLV 115

Query: 120 KDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSA 179
            +LP E+KL+I T+Y+RD+KKHKFLDLNKPLL QIL G FT++FY+DQI+RPRHYG+ SA
Sbjct: 116 VELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSA 175

Query: 180 PLFGN-FLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYC 238
           PLFGN FLE F+KTA             +F   AL NMNNPLALFLF +G+FVWTL+EYC
Sbjct: 176 PLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYC 235

Query: 239 LHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAA 298
           LHRFLFHFD +LPE+++ F +HFLLHG HHYLPMD YRLVVPPALF++LCAPIYK VF  
Sbjct: 236 LHRFLFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLL 295

Query: 299 LPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSW 358
           LPYYWACAGFAGG+ GY+ YD+CHY LHHSK+PPFMR            NY+LG+G+TSW
Sbjct: 296 LPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSW 355

Query: 359 FWDKVFGTYLGPDAPLSKMKYE 380
           FWDKVFGTYL  DAP S MK++
Sbjct: 356 FWDKVFGTYLSKDAPASVMKFD 377

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  455 bits (1171), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 282/385 (73%), Gaps = 14/385 (3%)

Query: 5   ADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
           + S KTL L+ +S   KH   + CWVS  +RKIY+VSK+L ++PE    V   LD   G 
Sbjct: 2   SSSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYV---LDHA-GQ 57

Query: 65  DISQM-------ELTTL--KFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDS 115
           D++Q+       E T L  + ++D YL+GYLATS+EE+KLLTN +H VEVK    N  DS
Sbjct: 58  DVTQLLKDMQTDEPTDLAHQLLSDAYLIGYLATSEEERKLLTNANHVVEVKPANGNRVDS 117

Query: 116 TTFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYG 175
             FVK LPTE+KL+I TD++ DY+KH FLDL+KPL  Q+LFGNFTK+FY+DQ+HRPRHYG
Sbjct: 118 G-FVKKLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYG 176

Query: 176 KGSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLI 235
           K SAPLFGNFLE  +KT+            +Y+I TAL+N++ PLALFLFG+G+FVWTLI
Sbjct: 177 KESAPLFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLI 236

Query: 236 EYCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLV 295
           EY LHRFLFHFD+ +PE ++ F +HFLLHG HHYLPMD YRLV+PPALF+ LC P YKLV
Sbjct: 237 EYGLHRFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLV 296

Query: 296 FAALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGV 355
           F+ LPYY ACAGFAGG+ GY+ YD+ HYFLHH K+PPFMR            NY+LGFGV
Sbjct: 297 FSILPYYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGV 356

Query: 356 TSWFWDKVFGTYLGPDAPLSKMKYE 380
           TSW+WDKVF TYL P APLS+ KY+
Sbjct: 357 TSWYWDKVFNTYLSPTAPLSRAKYD 381

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  454 bits (1168), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 219/383 (57%), Positives = 276/383 (72%), Gaps = 15/383 (3%)

Query: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
            +KTL L+  S + +HNS DDCWV+   RKIYDV+K+L+DHP   D + +      G DI
Sbjct: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYA----GKDI 57

Query: 67  SQM---------ELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117
           +++              + + ++Y VGYLAT++EE+KLL N  HKVEVKL  ++ +DST 
Sbjct: 58  TEVMKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKL--EDEYDSTV 115

Query: 118 FVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177
           FV ++P E+KLSI TDY RDY +HKFLDLN+PLL Q+L  +FTK+FYLDQ+HRPRHYG+G
Sbjct: 116 FVPEVPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRG 175

Query: 178 SAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEY 237
           SAPLFGNFLE  +KT+             Y I TA+ NMN   A+FLF +GIFVWTLIEY
Sbjct: 176 SAPLFGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEY 235

Query: 238 CLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFA 297
            +HRFLFH D +LP + + + +HFLLHG HHYLPMD YRLV+PP LF++LC P YKLVFA
Sbjct: 236 GMHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFA 295

Query: 298 ALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTS 357
            LPYYWACAGFAGGMLGY+CYDL HYFLHH+K+P  ++            NY+LGFGVTS
Sbjct: 296 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTS 355

Query: 358 WFWDKVFGTYLGPDAPLSKMKYE 380
           W WDKVFGTYL  +APLS+MK++
Sbjct: 356 WVWDKVFGTYLAENAPLSQMKFD 378

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 215/375 (57%), Positives = 264/375 (70%), Gaps = 4/375 (1%)

Query: 5   ADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
           ++ SKTLELF       HN++DDCWVS  +R IYDVSK+++++ +    V  A+  + G 
Sbjct: 4   SNPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVP--VEDAVLKRAGK 61

Query: 65  DISQM-ELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVKDLP 123
           DIS + E  + KFV D YLVGYLA S EE +LLTNK HKVEV L  D T+DST FVK+LP
Sbjct: 62  DISDLLETKSFKFVDDKYLVGYLANSTEEARLLTNKDHKVEVNLK-DGTYDSTVFVKELP 120

Query: 124 TEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPLFG 183
           +E+  +I+TDY++D+  H FLDL KPLL Q+L GNFT++FY+DQIHRPRHYGKGSA LFG
Sbjct: 121 SEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGSAKLFG 180

Query: 184 NFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHRFL 243
           N+LE  + T             +Y       +M+   A+F + LGIFVWT IEYCLHRFL
Sbjct: 181 NWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYCLHRFL 240

Query: 244 FHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPYYW 303
           FH D+W+P+H+ F+ IHFLLHG HHYLPMD YRLVVPPALFVVLC P YK VFA LP Y 
Sbjct: 241 FHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFALLPLYV 300

Query: 304 ACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSWFWDKV 363
           A  GFAGG+ GYI YDL HYF+HH K+P   R            NYQLGFGV+++FWD V
Sbjct: 301 AYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNYFWDLV 360

Query: 364 FGTYLGPDAPLSKMK 378
           FGTYLGPD+P S M+
Sbjct: 361 FGTYLGPDSPASIMR 375

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  431 bits (1109), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 216/379 (56%), Positives = 262/379 (69%), Gaps = 10/379 (2%)

Query: 8   SKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDIS 67
           SKTL L+ ++ L KH  +  CWVS   RKIYDVS++L +HP   D       GK  T + 
Sbjct: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPG-GDQYILDYAGKDITAVL 61

Query: 68  QMEL------TTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVKD 121
           + +L         + + + YLVGYLAT +EE KLLTN+ H +EV        D+TTFVK+
Sbjct: 62  KDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEV---TPENLDTTTFVKE 118

Query: 122 LPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPL 181
           LP E+ LS+ TD+  DY KH FLDLNKPLL Q+L GNFT+DFY+DQIHRPRHYGKGSAPL
Sbjct: 119 LPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPL 178

Query: 182 FGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHR 241
           FGNFLE  +KT             LY++T AL NM   LAL  F  G+FVWTLIEY LHR
Sbjct: 179 FGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHR 238

Query: 242 FLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPY 301
           FLFHFD+ +PE ++ F +HFLLHG HHYLPMD YRLV+PPALFVVLCAP Y+LVF+  P 
Sbjct: 239 FLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPE 298

Query: 302 YWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 361
           Y AC  FAGG+ GY+CYD+ HYFLHH K+PPFMR            NY+LGFGVTSW+WD
Sbjct: 299 YCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWD 358

Query: 362 KVFGTYLGPDAPLSKMKYE 380
           KVFGTYL  ++P+S+ K E
Sbjct: 359 KVFGTYLASNSPVSRPKCE 377

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  427 bits (1097), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 215/389 (55%), Positives = 263/389 (67%), Gaps = 16/389 (4%)

Query: 4   AADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHG 63
            + S  T ELF    + KHN+K DCWV    RKIYDVS+YL D+P+      K +D   G
Sbjct: 16  TSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNS---KIIDFA-G 71

Query: 64  TDISQM---------ELTTLKFVT--DDYLVGYLATSDEEKKLLTNKSHKVEVKLNAD-N 111
            DI+           +  T  F++  D YLVGYLA  +E  KLL+N SHKVEVKL    +
Sbjct: 72  KDITSSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPS 131

Query: 112 TFDSTTFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRP 171
           T+DSTTFVK+LP+ED   I TDY++D+ +H FLDL KPL+ Q+    F + FY+DQIHRP
Sbjct: 132 TYDSTTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRP 191

Query: 172 RHYGKGSAPLFGNFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFV 231
           RH+G  SAPLFGNFLE  TKTA             Y +  A  NMNN  A FLF +G+FV
Sbjct: 192 RHFGNKSAPLFGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFV 251

Query: 232 WTLIEYCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPI 291
           WTLIEY LHRFLFH D  +P+H MF+++HF +HGCHHYLPMD YRLV+PP LF++LC P 
Sbjct: 252 WTLIEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPF 311

Query: 292 YKLVFAALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQL 351
           YKLVF+ LP YWA AGFAGG+ GY+CYD  HY+LHHS++P FMR            NYQL
Sbjct: 312 YKLVFSVLPLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQL 371

Query: 352 GFGVTSWFWDKVFGTYLGPDAPLSKMKYE 380
            FGV+++FWDKVFGTYL PD+PLS MKYE
Sbjct: 372 AFGVSNYFWDKVFGTYLYPDSPLSPMKYE 400

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  311 bits (796), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 183/256 (71%), Gaps = 1/256 (0%)

Query: 124 TEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPLFG 183
           TE+KL +TTDY +D+ ++ FL L++PL  Q+L  NFT+DFY+DQ+H+PRHYG  SAP+FG
Sbjct: 19  TEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFG 78

Query: 184 NFLEAFTKTAXXXXXXXXXXXXLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHRFL 243
           NFLE FTKT             LY    +L  ++  LA+ LF +G+FVWTLIEYC+HR+L
Sbjct: 79  NFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYL 138

Query: 244 FHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPYYW 303
           FH D+ +PE  +FF++HFLLHG HHYLPMD YRLV+PPALF +LC P Y L FA  P YW
Sbjct: 139 FHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYW 198

Query: 304 ACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRXXXXXXXXXXXXNYQLGFGVTSWFWDKV 363
           A AGFAGG+ GY+CYD+ HYFLHH KMP FMR            N+QLGFGVTS FWD+V
Sbjct: 199 AHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRV 258

Query: 364 FGTYLGPDA-PLSKMK 378
           FGTYL P   P ++ K
Sbjct: 259 FGTYLDPKTIPYARSK 274

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 13/93 (13%)

Query: 1   MSVAADSSKTLELF-PQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALD 59
           +S+   S K+L++  PQ V+ KHNSKDDCWV  ++  +YD++ ++K HP   D +     
Sbjct: 78  VSIEQLSKKSLKIITPQEVI-KHNSKDDCWVVIND-IVYDLTFFIKKHPGGQDVIV---- 131

Query: 60  GKHGTDISQMEL------TTLKFVTDDYLVGYL 86
           G  G D+S + L      T  KF+  D ++G +
Sbjct: 132 GNAGKDVSNIFLPLHPLDTIEKFIPKDKIIGVI 164

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa]
          {ON} YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 5  ADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
          + +S  L       +A H   DDCW+S H  K+YDVS YL  HP  A  + K L GK  T
Sbjct: 25 SQTSSQLPFISSDEVATHTDADDCWISIH-GKVYDVSSYLPQHPGGAQVMLK-LAGKDAT 82

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 26/37 (70%), Gaps = 1/37 (2%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
          +++    +AKHNS DD W+   E K+YDVSK+L +HP
Sbjct: 3  QIYTYEEIAKHNSPDDTWIVI-EGKVYDVSKFLDEHP 38

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP---------EEADAVHKALDGKH 62
          +++    +A+HN  DD W+   E K+YDVSK+L +HP            DA    LD  H
Sbjct: 3  QVYSYQQIAEHNKPDDAWIII-EGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIGH 61

Query: 63 GTDISQM 69
            D  Q+
Sbjct: 62 SDDALQI 68

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa]
          {ON} weakly similar to uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
          sterol and lipid biosynthesis pathways
          Length = 233

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
          LA H S +DCW++ H   +YDVS+YL  HP  A  + K L GK  T
Sbjct: 39 LATHTSAEDCWLAIH-GAVYDVSRYLTQHPGGAQVMLK-LAGKDAT 82

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 12/82 (14%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT----DISQME--LT 72
           +A+HN+ +D W+   + K+YDV+K+++DHP   D +   L G+ GT    DI   E  + 
Sbjct: 66  VAEHNTPEDAWLIV-DGKVYDVTKFVEDHP-GGDEIILDLAGQDGTEAFNDIGHSEDAVN 123

Query: 73  TLKFVTDDYLVGYLATSDEEKK 94
            LK    D++VG L  +    K
Sbjct: 124 MLK----DFIVGSLDPASRPAK 141

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 6/62 (9%)

Query: 10  TLELFP-----QSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
           T +++P     ++ L KHN+ +DCW   ++R +Y VS YL  HP  A+ + +   GK  T
Sbjct: 120 TFKIYPPIKVTKAQLQKHNTAEDCWCVLNQR-VYCVSSYLDFHPGGAEILLRTAAGKDAT 178

Query: 65  DI 66
            +
Sbjct: 179 AL 180

>NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.536
           YMR073C
          Length = 189

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 6/60 (10%)

Query: 10  TLELFP-----QSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
           T +++P      S+L +H S+ DCW + ++ K+Y VS YL+ HP   D + +   GK  T
Sbjct: 104 TYQIYPFLKINNSILQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDST 162

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 37.7 bits (86), Expect = 0.009,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
          +A+HN  ++CW+   + K+YDVS++  +HP   D +   L G+  TD
Sbjct: 10 VAEHNGPENCWIIIDD-KVYDVSQFKDEHP-GGDEIIMDLGGQDATD 54

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 37.4 bits (85), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 11/66 (16%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHP---------EEADAVHKALDGKHGTDISQM 69
          +++HN + DCW+   +  +YDVSK+L +HP            DA    +D  H  D  ++
Sbjct: 10 VSEHNKEGDCWIII-DGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIGHSDDALKI 68

Query: 70 ELTTLK 75
           L TLK
Sbjct: 69 -LKTLK 73

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 37.4 bits (85), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 12/70 (17%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHP--EE-------ADAVHKALDGKHGTDISQM 69
          +A+H++ +D W+    R +Y+V+K+L +HP  EE       ADA    LD  H  D   M
Sbjct: 10 VAQHSTSEDAWIVIDNR-VYEVTKFLDEHPGGEEILLEMAGADATTNFLDIGHSDD--AM 66

Query: 70 ELTTLKFVTD 79
          ++   +++ D
Sbjct: 67 KILKTRYIGD 76

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 14  FPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           F   +L KH S+DDCW + H  K+Y ++ YL  HP  AD + +   GK  T +
Sbjct: 147 FNHKILQKHVSEDDCW-TVHNGKVYCMTYYLHFHPGGADILLEEAAGKDCTRL 198

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 37.4 bits (85), Expect = 0.013,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 23/30 (76%), Gaps = 1/30 (3%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
          +A+HNS +D W+   + K+YDV+K++ +HP
Sbjct: 10 IAEHNSAEDIWIVV-DGKVYDVTKFMDEHP 38

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
          YNL111C
          Length = 126

 Score = 37.4 bits (85), Expect = 0.014,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 10/63 (15%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP---------EEADAVHKALDGKH 62
          +++  + +A+H   DDCW++  + K+Y+VSK+L +HP           +DA    LD  H
Sbjct: 3  QVYTYADVAEHVLPDDCWIAI-DGKVYNVSKFLDEHPGGDEIIYELAGSDATEYFLDIGH 61

Query: 63 GTD 65
            D
Sbjct: 62 SDD 64

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 36.6 bits (83), Expect = 0.023,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
          +A+HN+ + CW+   + K+YD +K+L +HP   D +   L G+  T+
Sbjct: 10 IAEHNTTESCWIVI-DGKVYDTTKFLDEHP-GGDEIILDLAGQDATE 54

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 36.2 bits (82), Expect = 0.028,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
          +A+HN  ++CW+   + K+YDVS++  +HP   D +   L G+  T+
Sbjct: 10 VAEHNGPENCWIIIDD-KVYDVSQFKDEHP-GGDEIIMDLGGQDATE 54

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 13 LFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHK 56
          L     +A+H+S+ DCW   H  K+YD++ +L  HP  A  + K
Sbjct: 5  LITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLK 47

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 16  QSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           ++ LA+H + +DCW   ++ K+Y +S YL  HP   D + K   GK  T +
Sbjct: 125 KAQLAQHKAPEDCWCVINQ-KVYCISSYLDFHPGGVDILMKGAAGKDCTSM 174

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAV 54
           +AKHNS DDCWV  +   +YD+++++ +HP   D +
Sbjct: 96  VAKHNSADDCWVVINGY-VYDLTRFVPNHPGGPDVI 130

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 6   DSSKTLELFPQSV----LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVH 55
           D+   L++  Q +    +AKHN  DDCWV  +   +YD++++L +HP   D + 
Sbjct: 79  DNEPKLDMNKQKISPAEVAKHNKPDDCWVVINGY-VYDLTRFLPNHPGGQDVIK 131

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 17  SVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDISQ---MELTT 73
           S +AKHN+ DDCWV   E  +Y++++++  HP     V K+  GK  T I +    + T 
Sbjct: 95  SEVAKHNTPDDCWVVI-EGYVYNLTEFIPTHP-GGPMVIKSNAGKDVTAIFKPLHAKGTI 152

Query: 74  LKFVTDDYLVGYLA 87
            KFV  ++ +G L+
Sbjct: 153 EKFVKKEWFIGPLS 166

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 6   DSSKTLELFPQSV----LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVH 55
           D+   L++  Q +    +AKHN  DDCWV  +   +YD+++++ +HP   D + 
Sbjct: 79  DNEPKLDMNKQKISPAEVAKHNKADDCWVVINGY-VYDLTRFMPNHPGGPDVIK 131

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 35.8 bits (81), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 11 LELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAV 54
          + +   S + KHN  DDCW+  H  K+Y+++ +L  HP  A  +
Sbjct: 1  MHVISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVI 43

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 16  QSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           + +L +HN+KDDCW    + K+Y ++ Y   HP   D + +   GK  T +
Sbjct: 121 KELLRRHNTKDDCWCVI-QGKVYCLTNYFDFHPGGVDILLRYCAGKDATKM 170

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVH 55
           +AKHN  DDCWV  +   +YD++++L +HP   D + 
Sbjct: 96  VAKHNKPDDCWVVINGY-VYDLTRFLPNHPGGQDVIK 131

>NCAS0A02970 Chr1 (576222..585539) [9318 bp, 3105 aa] {ON} Anc_4.14
            YLL040C
          Length = 3105

 Score = 37.4 bits (85), Expect = 0.080,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 9/97 (9%)

Query: 21   KHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDISQMELTTLKFVTDD 80
            K+ +K D ++  +   I+D+S + +   EE +       G    D ++++L  LK ++D 
Sbjct: 1253 KNGTKQDLYMIENITLIFDISHH-RLTAEETELKISGYFGPLEVDFTELQLLYLKEISDQ 1311

Query: 81   YLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117
             L G    SDEEK+ LT        + N  NT DS+T
Sbjct: 1312 -LKGAFTISDEEKQQLT-------TEYNYTNTLDSST 1340

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 2   SVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGK 61
           +++ ++  T  + P+ V AKH + DDCWV  +   +YD++ ++  HP   D     L+  
Sbjct: 72  TISNEAITTRLILPEEV-AKHKTPDDCWVVINGY-VYDITSFIMSHPGGPD----VLETN 125

Query: 62  HGTDISQM 69
            G D++ +
Sbjct: 126 AGKDVTAI 133

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 4   AADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHG 63
           AA  SK   +    V+ +HN +DDCWV   +  +YDV+ ++  HP  +  +     G  G
Sbjct: 110 AAKHSKRRHVSATEVI-RHNKEDDCWVVI-DGYVYDVTAFIDQHPGGSAVIR----GNAG 163

Query: 64  TDISQM 69
            D+S +
Sbjct: 164 KDVSAL 169

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 36.2 bits (82), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           +++H S+DDCW   H R +YD++  L++HP
Sbjct: 98  VSQHTSRDDCWFIIHGR-VYDITGLLENHP 126

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 35.8 bits (81), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 16  QSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           + +L KH + DDCW     R +Y ++ Y   HP   D + K   GK GT++
Sbjct: 127 RELLQKHKTLDDCWCVIKGR-VYCLTYYFDFHPGGVDILFKTCAGKDGTEM 176

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 31/48 (64%), Gaps = 2/48 (4%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           +AKH++  DCWV  H+ K+YD++ ++  HP   D + K+  GK  T+I
Sbjct: 101 VAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDII-KSNAGKDVTNI 146

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
           LA+HN+ +DCW   +  K+Y +S YL  HP  A  +     G+  T
Sbjct: 124 LARHNTAEDCWTVING-KVYSISSYLSFHPGGAKILIDKSSGQDST 168

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 34.3 bits (77), Expect = 0.16,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
          +LF    +A+HN++ D W+   + K+YD +K++ +HP
Sbjct: 3  KLFTYQEIAEHNTEGDLWMII-DGKVYDCTKFIDEHP 38

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 33.9 bits (76), Expect = 0.17,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
          +L+    +A HN+ +  W+   + K+YDV+K+L  HP   D +   L G+  T
Sbjct: 3  KLYSYEEIAAHNTTESAWIIIKD-KVYDVTKFLDSHP-GGDEIILELAGQDAT 53

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (57%), Gaps = 6/57 (10%)

Query: 13  LFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDISQM 69
           + P+ V A+HN +DDCWV  ++  +Y+++ ++  HP   + +        G D++++
Sbjct: 73  ITPEEV-ARHNKRDDCWVVIND-SVYNLTDFIDSHPGGKNVIV----ANSGKDVTKL 123

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 17 SVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHK 56
          S + +H S DDCW   H  K+YD++  L  HP  A  + K
Sbjct: 9  SEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLK 47

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 33.5 bits (75), Expect = 0.27,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
          +L+    +A+HN++ D W+   + K+YD +K++ +HP
Sbjct: 3  KLYSYKEIAEHNTEKDLWMII-DGKVYDCTKFMDEHP 38

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
          +L+    +A+HNS++D W+  +  K+YD +K+ ++HP   D V   L G+  T+
Sbjct: 42 KLYTYQEIAEHNSENDLWLIIN-GKVYDCTKFAEEHP-GGDEVLIDLAGQDATE 93

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVH 55
           + KHNS++DCW+  +  ++YD++ ++  HP  +D + 
Sbjct: 100 VTKHNSENDCWIVIN-GQVYDLTSFMSIHPGGSDIIK 135

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 18/83 (21%)

Query: 13  LFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGK---------HG 63
           + PQ V AKH+  DDCWV  +   +YD+S ++  HP    A+ KA  GK         H 
Sbjct: 79  IRPQEV-AKHSKPDDCWVVINGY-VYDLSDFIAVHP-GGPAIIKANAGKDVSAIFNAFHA 135

Query: 64  TDISQMELTTLKFVTDDYLVGYL 86
           +D+ +      KF+ +   +G L
Sbjct: 136 SDVIE------KFIPEKKRIGPL 152

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 32.7 bits (73), Expect = 0.41,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
          +A+HN  ++ W+   + K+YDVSK+  +HP   D +   L G+  T+
Sbjct: 10 VAEHNGPENFWIIIDD-KVYDVSKFKDEHP-GGDEIIMDLGGQDATE 54

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query: 22  HNSKDDCWVSTHERKIYDVSKYLKDHP 48
           HN  DDCW+   + ++YD++K+L  HP
Sbjct: 89  HNRIDDCWIVI-DNEVYDITKFLSQHP 114

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
          + +HN+  DCW++ H R +YDV+  L  HP
Sbjct: 30 VREHNTAHDCWMAIHGR-VYDVTPILSKHP 58

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 16  QSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           Q +L++H   DDCW     R +Y +S+Y+  HP
Sbjct: 146 QKILSEHQEVDDCWCVIKGR-VYSISRYMDYHP 177

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 1/32 (3%)

Query: 17  SVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           S L KHN+  DCW++ +  ++YDV+ +L+ HP
Sbjct: 78  SELRKHNTVHDCWIALNG-EVYDVTAFLQMHP 108

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 14 FPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
          F    +A HNS+ D W+  +  K+YD SK+  +HP   D V   L G+  T
Sbjct: 5  FTYQEIADHNSEQDLWLIIN-GKVYDCSKFADEHP-GGDEVLLDLGGQDAT 53

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6   DSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
           DS+K   + P+ V  KHN+ DDCWV   +  +YD+S ++  HP    AV +A  GK  + 
Sbjct: 72  DSTKK-SIDPKEV-EKHNAPDDCWV-VIDGYVYDLSDFIPSHP-GGPAVIRANAGKDVSA 127

Query: 66  I 66
           I
Sbjct: 128 I 128

>TDEL0B04890 Chr2 complement(857124..861830) [4707 bp, 1568 aa] {ON}
           Anc_2.125 YNL139C
          Length = 1568

 Score = 33.9 bits (76), Expect = 0.79,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 23/48 (47%)

Query: 241 RFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLC 288
           R +F++ EW  E S+   +  L+   H Y  +   RL V P L   LC
Sbjct: 497 RAVFYYPEWTSELSLVNSVEDLIKTSHEYFSIIGVRLAVCPKLISKLC 544

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 32.0 bits (71), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 26/37 (70%), Gaps = 1/37 (2%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
          +L+    +A+HN+++D W+   + K+YD +K++ +HP
Sbjct: 3  KLYSYKEIAEHNTENDLWMII-DGKVYDCTKFMDEHP 38

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
          YNL111C
          Length = 182

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 12 ELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
          +++    +A+HN+ +  W+   E K+Y+V+K+L +HP
Sbjct: 61 KIYTYEEIAEHNTTESSWIVI-EGKVYNVTKFLDEHP 96

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
          CYB5Cytochrome b5, involved in the sterol and lipid
          biosynthesis pathways; acts as an electron donor to
          support sterol C5-6 desaturation
          Length = 120

 Score = 31.6 bits (70), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
          +A+HN  ++ W+   + K+YDVS++  +HP   D +   L G+  T+
Sbjct: 10 VAEHNGPENFWIIIDD-KVYDVSQFKDEHP-GGDEIIMDLGGQDATE 54

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 4/42 (9%)

Query: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           SS  +E+   S + +HN  DDCW+  +  ++YDV+ +L+ HP
Sbjct: 72  SSDGIEV---SEVMQHNKPDDCWIVLNG-EVYDVTSFLQMHP 109

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           L KHN+ +DCWV  +  ++YD++ +++ HP
Sbjct: 110 LMKHNTPEDCWVVIN-NQVYDLTTFIQVHP 138

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 17  SVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66
           S +A+HN+  DCW+  +   +YD++ ++  HP  AD + K+  GK  T I
Sbjct: 92  SEVARHNTPADCWIVINGV-VYDLTSFIPVHPGGADII-KSNAGKDVTAI 139

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           +AKHNS DDCWV   +  +YD++++   HP
Sbjct: 89  VAKHNSPDDCWV-VIDGYVYDLTEFAPVHP 117

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 6   DSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           DSSK   + PQ V AKHN   DCWV   +  +YD+++++  HP
Sbjct: 75  DSSKK-PIDPQDV-AKHNDPKDCWV-VIDGYVYDLTEFIHSHP 114

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 13  LFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           +  + ++AKH   DDCW      K+Y +S Y K HP
Sbjct: 142 MITKKMVAKHKDIDDCWCIIRG-KVYSISNYFKFHP 176

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 6   DSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65
           DSSK  ++ P  V+ KHN+ +DCWV   +  +YD++ ++  HP   D + K   GK  T 
Sbjct: 84  DSSKP-KISPSEVI-KHNTPEDCWVVI-DGYVYDLTNFIALHPGGPDII-KTNAGKDVTA 139

Query: 66  I 66
           I
Sbjct: 140 I 140

>KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033W ARP9
           Actin-related protein
          Length = 432

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 57/117 (48%), Gaps = 6/117 (5%)

Query: 64  TDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVKDLP 123
           T IS  +   L+ + +D+L+G  A   + ++   +  + V+ K    N+F ++     +P
Sbjct: 310 TSISGFKEALLQKLVEDHLIGEPAHEKDIREREHSAQNSVKKKAKIANSFLNSVDYVQIP 369

Query: 124 TEDKLSITTDYERDYKKHKFLD---LNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177
           T   L+   +Y  ++KKH + +   L   ++ +  FG+  + FY   + R ++  KG
Sbjct: 370 TAISLAKYPEYFPEWKKHGYAEVPFLGAQIVAKQAFGHTNESFY---VTREKYEKKG 423

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 22  HNSKDDCWVSTHERKIYDVSKYLKDHPEEA 51
           HN+ DDCW+  +   +YD+++++K HP  A
Sbjct: 96  HNNIDDCWIVLNG-DVYDITEFIKIHPGGA 124

>NDAI0H00230 Chr8 (34281..36449) [2169 bp, 722 aa] {ON} Anc_4.10
          Length = 722

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 52/131 (39%), Gaps = 34/131 (25%)

Query: 208 FITTALMNMNNPLALFLFGLGIFVWTLIEYCLHRFLFHFDEWLPEHSMFFMIHFLLH--- 264
           FITTA +             GIF  T    CL   +F          M F++ F+L+   
Sbjct: 439 FITTAALQA-----------GIFALTDPYTCLSSDVFPL--------MLFILIFILNASM 479

Query: 265 ----GCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALP-YYW--ACAGFAGGMLGYIC 317
               GC   +  D     + P L +  C    KL++ +   Y+W    A F G + G + 
Sbjct: 480 GVQTGCAINMARD-----LGPRLALYACGFDRKLLWESHHHYFWIPMVAPFVGALCGGLI 534

Query: 318 YDLCHYFLHHS 328
           YD+C Y  H S
Sbjct: 535 YDVCIYQGHES 545

>Kwal_26.8331 s26 (741843..743141) [1299 bp, 432 aa] {ON} YMR033W
           (ARP9) - actin related protein, subunit of the chromatin
           remodeling Snf/Swi complex [contig 59] FULL
          Length = 432

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 61/126 (48%), Gaps = 14/126 (11%)

Query: 64  TDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEV----KLNADNTFDSTTFV 119
           + I+  +   L+ + D+YL+   A     +KLL  + H  ++    K  A N+F ++   
Sbjct: 310 SSITGFKEALLQRLMDNYLIEEPAA----EKLLREQEHTAQITNKKKAKASNSFLNSVDY 365

Query: 120 KDLPTEDKLSITTDYERDYKKHKFLD---LNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176
             +PT   L+   +Y  ++KKH + +   L   ++ +  FG+  + FY   + R ++  K
Sbjct: 366 VQIPTAINLAKYPEYFPEWKKHGYAEVPFLGAQIVAKQGFGHSNESFY---VTREKYEKK 422

Query: 177 GSAPLF 182
           G + ++
Sbjct: 423 GPSVIW 428

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 14  FPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
            P S +  HN  +DCW+  ++ ++YDV+ ++  HP
Sbjct: 81  IPVSEVMLHNKLNDCWIVLND-EVYDVTSFIAAHP 114

>Kpol_1045.50 s1045 (118821..119804) [984 bp, 327 aa] {ON}
           (118823..119806) [984 nt, 328 aa]
          Length = 327

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 5   ADSSKTLELFPQSV---LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGK 61
           AD  K +E F ++V   +A  N++D C +  H   +  + K L+  P   D   K +D  
Sbjct: 228 ADVVKRVEPFLENVVFRIANENNQDSCLIVAHGSSVRSILKLLQGIP---DDEIKDVDIP 284

Query: 62  HGTD-ISQMELTTLKFVTDDYL 82
           +G   + ++E  T KFV   YL
Sbjct: 285 NGIPLVIELEKKTFKFVNKFYL 306

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 16  QSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48
           + ++A+HN+ DDCW    + K+Y ++ Y + HP
Sbjct: 145 EKMVAEHNTVDDCWCII-KGKVYCITNYFEYHP 176

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 22  HNSKDDCWVSTHERKIYDVSKYLKDHPEEA 51
           HN+ +DCW+  +  +IYDV+ ++  HP  A
Sbjct: 84  HNNVNDCWIVLNG-EIYDVTSFIGKHPGGA 112

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 29.3 bits (64), Expect = 8.4,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 19 LAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64
          +++H + DD W+   + K+YD +K++ +HP   D +   L G+  T
Sbjct: 10 VSEHKTVDDLWMII-DGKVYDCTKFVDEHP-GGDEILVDLGGQDAT 53

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.141    0.455 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,287,777
Number of extensions: 1813206
Number of successful extensions: 6937
Number of sequences better than 10.0: 109
Number of HSP's gapped: 7121
Number of HSP's successfully gapped: 109
Length of query: 380
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 269
Effective length of database: 40,753,473
Effective search space: 10962684237
Effective search space used: 10962684237
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)