Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0F03069g5.528ON48648623130.0
KLTH0G03784g5.528ON569952462e-21
ZYRO0D12584g5.528ON5791082391e-20
Kwal_47.186315.528ON584942382e-20
SAKL0G04950g5.528ON567862249e-19
Kpol_1023.975.528ON591962231e-18
TBLA0G009305.528ON6081262231e-18
NCAS0F011005.528ON475862184e-18
KLLA0A01760g5.528ON583832177e-18
TDEL0A039205.528ON466862132e-17
TPHA0K005205.528ON560892089e-17
NDAI0C010605.528ON637832062e-16
YDR423C (CAD1)5.528ON4091392032e-16
KAFR0E032905.528ON2651141939e-16
Smik_4.6985.528ON393961981e-15
Smik_13.1445.528ON639911991e-15
KNAG0C032105.528ON384861952e-15
KAFR0C054005.528ON481911962e-15
Ecym_40645.528ON426821962e-15
Suva_13.1555.528ON645911972e-15
CAGL0H04631g5.528ON5881061954e-15
NCAS0H025605.528ON587991954e-15
Kpol_1004.225.528ON475781892e-14
YML007W (YAP1)5.528ON650801883e-14
Skud_13.1475.528ON665801831e-13
ADR195C5.528ON288731762e-13
KNAG0B036805.528ON482821784e-13
TBLA0D016405.528ON599641553e-10
TPHA0D023405.528ON506601535e-10
Suva_2.600singletonOFF382621444e-09
NDAI0H016105.528ON5191241197e-06
SAKL0E02420g2.493ON322711169e-06
Kwal_26.78482.493ON291291169e-06
Skud_8.362.493ON332701151e-05
KLTH0D05918g2.493ON310371151e-05
Suva_8.432.493ON330671151e-05
CAGL0K08756g7.115ON3491021123e-05
Ecym_24302.493ON308521097e-05
Smik_8.332.493ON331701097e-05
KNAG0C056802.493ON359441098e-05
YOR028C (CIN5)5.619ON295681081e-04
NDAI0B018002.493ON446361081e-04
CAGL0M08800g5.619ON263771062e-04
YHL009C (YAP3)2.493ON330671062e-04
ABR018C2.493ON282281042e-04
CAGL0K02585g2.493ON368361053e-04
CAGL0M10087g2.493ON368281027e-04
Kpol_1018.1697.115ON28942990.001
Suva_8.815.619ON30168980.001
ZYRO0B01100g2.493ON25637980.001
KAFR0D013807.115ON37443980.002
KAFR0D034202.493ON27343960.002
NCAS0A08020singletonON23841950.003
Smik_15.2065.619ON29562950.003
Kpol_1055.222.493ON34130950.004
YIR018W (YAP5)7.115ON245114930.005
Smik_9.2187.115ON24845930.005
CAGL0F01265g7.115ON62338940.007
KAFR0A019702.493ON32726930.007
KLLA0E00265gna 1ON28845930.007
Suva_9.2317.115ON24561920.007
NDAI0K020702.493ON36531920.009
TDEL0H033507.115ON34540920.009
KNAG0B031905.619ON27869910.010
TPHA0C005005.619ON30138910.010
KNAG0A067902.493ON308123910.011
KAFR0C059005.619ON27571910.011
KLLA0E16875g5.619ON50848920.012
NCAS0A050202.493ON27031900.012
TPHA0G033102.493ON27564900.013
TBLA0E032805.619ON22744890.016
Skud_9.1967.115ON25431880.024
ZYRO0G04246g7.115ON43467890.025
Skud_15.1267.115ON51534890.029
TPHA0H024807.115ON35740880.030
Kpol_495.175.619ON48638880.032
Smik_15.1367.115ON51757880.033
Skud_15.1935.619ON28939870.034
NCAS0A080305.619ON19954850.035
KLLA0D14399g7.115ON52532880.036
KLLA0B13695g2.493ON37539870.037
Suva_2.4255.619ON38426870.038
KNAG0D045907.115ON26037860.038
YOL028C (YAP7)7.115ON24534860.040
TDEL0A051902.493ON27323860.042
NDAI0A084007.115ON38938870.043
Skud_13.6singletonON31085860.044
YDR259C (YAP6)5.619ON38326860.061
Skud_4.5215.619ON37926850.068
SAKL0G07128g5.619ON27373840.077
KAFR0H005805.619ON48638850.086
Smik_4.5065.619ON37926840.086
NCAS0G008005.619ON27439830.096
Ecym_83547.115ON46936840.097
Ecym_55805.619ON29525830.098
NDAI0F009005.619ON45166840.11
SAKL0F05434g7.115ON46037830.12
NDAI0H014907.115ON44438830.14
AEL222C5.619ON23425810.14
Kpol_473.19singletonON28347810.17
Kwal_55.199475.619ON31879810.20
TBLA0J007905.619ON25267800.21
KLTH0E02222g5.619ON26468800.21
YPR199C (ARR1)na 1ON29496810.21
TBLA0J019407.115ON63941820.21
TBLA0A048607.115ON29141800.23
TPHA0I020507.115ON30836800.24
NCAS0F010007.115ON38946800.26
KNAG0C062105.619ON38026800.33
Kpol_1023.1057.115ON39637790.34
NCAS0I006307.115ON35430790.41
KLTH0G12386g8.318ON58063790.47
TPHA0D029005.619ON26025760.74
TPHA0A015808.318ON60063741.8
KLLA0F08976g8.36ON273127722.4
Skud_4.699singletonOFF5632652.5
NCAS0A125302.493ON30418722.7
Kwal_55.208247.115ON25027704.1
KLTH0F12496g7.115ON26129695.9
TPHA0A003803.22ON131086689.3
NOTE: 1 genes in the same pillar as CAGL0F03069g were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F03069g
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...   895   0.0  
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...    99   2e-21
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...    97   1e-20
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...    96   2e-20
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...    91   9e-19
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...    91   1e-18
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    91   1e-18
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    89   4e-18
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...    88   7e-18
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...    87   2e-17
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    85   9e-17
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...    84   2e-16
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    83   2e-16
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    79   9e-16
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    81   1e-15
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...    81   1e-15
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    80   2e-15
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    80   2e-15
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    80   2e-15
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...    80   2e-15
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...    80   4e-15
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...    80   4e-15
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    77   2e-14
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...    77   3e-14
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...    75   1e-13
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    72   2e-13
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...    73   4e-13
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    64   3e-10
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    64   5e-10
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    60   4e-09
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    50   7e-06
SAKL0E02420g Chr5 complement(192871..193839) [969 bp, 322 aa] {O...    49   9e-06
Kwal_26.7848 s26 (539163..540038) [876 bp, 291 aa] {ON} YHL009C ...    49   9e-06
Skud_8.36 Chr8 complement(72120..73118) [999 bp, 332 aa] {ON} YH...    49   1e-05
KLTH0D05918g Chr4 (526400..527332) [933 bp, 310 aa] {ON} some si...    49   1e-05
Suva_8.43 Chr8 complement(86607..87599) [993 bp, 330 aa] {ON} YH...    49   1e-05
CAGL0K08756g Chr11 (881947..882996) [1050 bp, 349 aa] {ON} weakl...    48   3e-05
Ecym_2430 Chr2 (837395..838321) [927 bp, 308 aa] {ON} similar to...    47   7e-05
Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON} YH...    47   7e-05
KNAG0C05680 Chr3 complement(1096585..1097664) [1080 bp, 359 aa] ...    47   8e-05
YOR028C Chr15 complement(383533..384420) [888 bp, 295 aa] {ON}  ...    46   1e-04
NDAI0B01800 Chr2 (429150..430490) [1341 bp, 446 aa] {ON} Anc_2.4...    46   1e-04
CAGL0M08800g Chr13 (878328..879119) [792 bp, 263 aa] {ON} weakly...    45   2e-04
YHL009C Chr8 complement(84068..85060) [993 bp, 330 aa] {ON}  YAP...    45   2e-04
ABR018C Chr2 complement(425339..426187) [849 bp, 282 aa] {ON} Sy...    45   2e-04
CAGL0K02585g Chr11 complement(233972..235078) [1107 bp, 368 aa] ...    45   3e-04
CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} som...    44   7e-04
Kpol_1018.169 s1018 complement(434066..434935) [870 bp, 289 aa] ...    43   0.001
Suva_8.81 Chr8 complement(145144..146049) [906 bp, 301 aa] {ON} ...    42   0.001
ZYRO0B01100g Chr2 (92729..93499) [771 bp, 256 aa] {ON} some simi...    42   0.001
KAFR0D01380 Chr4 complement(276591..277715) [1125 bp, 374 aa] {O...    42   0.002
KAFR0D03420 Chr4 complement(673634..674455) [822 bp, 273 aa] {ON...    42   0.002
NCAS0A08020 Chr1 (1585065..1585781) [717 bp, 238 aa] {ON}              41   0.003
Smik_15.206 Chr15 complement(349411..350298) [888 bp, 295 aa] {O...    41   0.003
Kpol_1055.22 s1055 (53408..54433) [1026 bp, 341 aa] {ON} (53408....    41   0.004
YIR018W Chr9 (384609..385346) [738 bp, 245 aa] {ON}  YAP5Basic l...    40   0.005
Smik_9.218 Chr9 (360302..361048) [747 bp, 248 aa] {ON} YIR018W (...    40   0.005
CAGL0F01265g Chr6 (131725..133596) [1872 bp, 623 aa] {ON} some s...    41   0.007
KAFR0A01970 Chr1 (414629..415612) [984 bp, 327 aa] {ON} Anc_2.49...    40   0.007
KLLA0E00265g Chr5 (12033..12899) [867 bp, 288 aa] {ON} weakly si...    40   0.007
Suva_9.231 Chr9 (372034..372771) [738 bp, 245 aa] {ON} YIR018W (...    40   0.007
NDAI0K02070 Chr11 (463970..465067) [1098 bp, 365 aa] {ON} Anc_2....    40   0.009
TDEL0H03350 Chr8 (557681..558718) [1038 bp, 345 aa] {ON} Anc_7.1...    40   0.009
KNAG0B03190 Chr2 (618434..619270) [837 bp, 278 aa] {ON} Anc_5.61...    40   0.010
TPHA0C00500 Chr3 complement(86444..87349) [906 bp, 301 aa] {ON} ...    40   0.010
KNAG0A06790 Chr1 complement(1059841..1060767) [927 bp, 308 aa] {...    40   0.011
KAFR0C05900 Chr3 complement(1168202..1169029) [828 bp, 275 aa] {...    40   0.011
KLLA0E16875g Chr5 (1498623..1500149) [1527 bp, 508 aa] {ON} some...    40   0.012
NCAS0A05020 Chr1 (996896..997708) [813 bp, 270 aa] {ON} Anc_2.49...    39   0.012
TPHA0G03310 Chr7 complement(708576..709403) [828 bp, 275 aa] {ON...    39   0.013
TBLA0E03280 Chr5 (823520..824203) [684 bp, 227 aa] {ON} Anc_5.61...    39   0.016
Skud_9.196 Chr9 (355156..355920) [765 bp, 254 aa] {ON} YIR018W (...    39   0.024
ZYRO0G04246g Chr7 (340188..341492) [1305 bp, 434 aa] {ON} simila...    39   0.025
Skud_15.126 Chr15 complement(228637..230184) [1548 bp, 515 aa] {...    39   0.029
TPHA0H02480 Chr8 (584363..585436) [1074 bp, 357 aa] {ON} Anc_7.1...    39   0.030
Kpol_495.17 s495 complement(40123..41583) [1461 bp, 486 aa] {ON}...    39   0.032
Smik_15.136 Chr15 complement(235956..237509) [1554 bp, 517 aa] {...    39   0.033
Skud_15.193 Chr15 complement(343322..344191) [870 bp, 289 aa] {O...    38   0.034
NCAS0A08030 Chr1 (1586013..1586612) [600 bp, 199 aa] {ON} Anc_5....    37   0.035
KLLA0D14399g Chr4 (1224490..1226067) [1578 bp, 525 aa] {ON} some...    39   0.036
KLLA0B13695g Chr2 complement(1199239..1200366) [1128 bp, 375 aa]...    38   0.037
Suva_2.425 Chr2 complement(754245..755399) [1155 bp, 384 aa] {ON...    38   0.038
KNAG0D04590 Chr4 (830774..831556) [783 bp, 260 aa] {ON} Anc_7.11...    38   0.038
YOL028C Chr15 complement(270633..271370) [738 bp, 245 aa] {ON}  ...    38   0.040
TDEL0A05190 Chr1 (921017..921838) [822 bp, 273 aa] {ON} Anc_2.49...    38   0.042
NDAI0A08400 Chr1 (1935415..1936584) [1170 bp, 389 aa] {ON} Anc_7...    38   0.043
Skud_13.6 Chr13 (6426..7358) [933 bp, 310 aa] {ON} YPR199C (REAL)      38   0.044
YDR259C Chr4 complement(974631..975782) [1152 bp, 383 aa] {ON}  ...    38   0.061
Skud_4.521 Chr4 complement(929170..930309) [1140 bp, 379 aa] {ON...    37   0.068
SAKL0G07128g Chr7 complement(585312..586133) [822 bp, 273 aa] {O...    37   0.077
KAFR0H00580 Chr8 (106485..107945) [1461 bp, 486 aa] {ON} Anc_5.6...    37   0.086
Smik_4.506 Chr4 complement(919548..920687) [1140 bp, 379 aa] {ON...    37   0.086
NCAS0G00800 Chr7 (137289..138113) [825 bp, 274 aa] {ON} Anc_5.619      37   0.096
Ecym_8354 Chr8 (708203..709612) [1410 bp, 469 aa] {ON} similar t...    37   0.097
Ecym_5580 Chr5 (1191145..1192032) [888 bp, 295 aa] {ON} similar ...    37   0.098
NDAI0F00900 Chr6 (221309..222664) [1356 bp, 451 aa] {ON} Anc_5.619     37   0.11 
SAKL0F05434g Chr6 (420136..421518) [1383 bp, 460 aa] {ON} some s...    37   0.12 
NDAI0H01490 Chr8 complement(359826..361160) [1335 bp, 444 aa] {O...    37   0.14 
AEL222C Chr5 complement(213737..214441) [705 bp, 234 aa] {ON} Sy...    36   0.14 
Kpol_473.19 s473 complement(54667..55518) [852 bp, 283 aa] {ON} ...    36   0.17 
Kwal_55.19947 s55 complement(188372..189328) [957 bp, 318 aa] {O...    36   0.20 
TBLA0J00790 Chr10 complement(180203..180961) [759 bp, 252 aa] {O...    35   0.21 
KLTH0E02222g Chr5 complement(199706..200500) [795 bp, 264 aa] {O...    35   0.21 
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    36   0.21 
TBLA0J01940 Chr10 complement(462906..464825) [1920 bp, 639 aa] {...    36   0.21 
TBLA0A04860 Chr1 complement(1196402..1197277) [876 bp, 291 aa] {...    35   0.23 
TPHA0I02050 Chr9 complement(458058..458984) [927 bp, 308 aa] {ON...    35   0.24 
NCAS0F01000 Chr6 complement(199877..201046) [1170 bp, 389 aa] {O...    35   0.26 
KNAG0C06210 Chr3 complement(1205132..1206274) [1143 bp, 380 aa] ...    35   0.33 
Kpol_1023.105 s1023 complement(248166..249356) [1191 bp, 396 aa]...    35   0.34 
NCAS0I00630 Chr9 complement(104540..105604) [1065 bp, 354 aa] {O...    35   0.41 
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...    35   0.47 
TPHA0D02900 Chr4 complement(604522..605304) [783 bp, 260 aa] {ON...    34   0.74 
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...    33   1.8  
KLLA0F08976g Chr6 complement(833390..834211) [822 bp, 273 aa] {O...    32   2.4  
Skud_4.699 Chr4 complement(1239478..1239576,1239580..1239648) [1...    30   2.5  
NCAS0A12530 Chr1 (2472725..2473639) [915 bp, 304 aa] {ON}              32   2.7  
Kwal_55.20824 s55 complement(574796..575548) [753 bp, 250 aa] {O...    32   4.1  
KLTH0F12496g Chr6 complement(1047883..1048668) [786 bp, 261 aa] ...    31   5.9  
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    31   9.3  

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/486 (90%), Positives = 440/486 (90%)

Query: 1   MSKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSK 60
           MSKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSK
Sbjct: 1   MSKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSK 60

Query: 61  KNSETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEIKADDLKSVEVVPEQPSATNFM 120
           KNSETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEIKADDLKSVEVVPEQPSATNFM
Sbjct: 61  KNSETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEIKADDLKSVEVVPEQPSATNFM 120

Query: 121 NSPTNITTAGSDKQADKTSSKKSSPHVKLXXXXXXXXXXXXXRGVLXXXXXXXXXXXXXX 180
           NSPTNITTAGSDKQADKTSSKKSSPHVKL             RGVL              
Sbjct: 121 NSPTNITTAGSDKQADKTSSKKSSPHVKLESNTSSVSVTSEERGVLSHTPTTTNTSFDTS 180

Query: 181 XXVINDLQRTAANRLESTGSWMDSIFDQDSKLSNLMNDQSFYPFDNISFGNSPVITNNWG 240
             VINDLQRTAANRLESTGSWMDSIFDQDSKLSNLMNDQSFYPFDNISFGNSPVITNNWG
Sbjct: 181 PSVINDLQRTAANRLESTGSWMDSIFDQDSKLSNLMNDQSFYPFDNISFGNSPVITNNWG 240

Query: 241 ENDMVAKQAGLESFNFAISNSNSTFGLPXXXXXXXXXXXXXXXXXRIEPQLAFPGEDIKY 300
           ENDMVAKQAGLESFNFAISNSNSTFGLP                 RIEPQLAFPGEDIKY
Sbjct: 241 ENDMVAKQAGLESFNFAISNSNSTFGLPAIATDISDINDINDTTTRIEPQLAFPGEDIKY 300

Query: 301 SRENMVMRRESSAMNNGGILDTVINSPIPMLDDNSEDILGDFTCSCQNKANSCPTRQLEN 360
           SRENMVMRRESSAMNNGGILDTVINSPIPMLDDNSEDILGDFTCSCQNKANSCPTRQLEN
Sbjct: 301 SRENMVMRRESSAMNNGGILDTVINSPIPMLDDNSEDILGDFTCSCQNKANSCPTRQLEN 360

Query: 361 EAKATPVGKKIADMNLDDVELRCELLTQHIIYREPLSTVLQLLKRTRHERDARSSEGKPV 420
           EAKATPVGKKIADMNLDDVELRCELLTQHIIYREPLSTVLQLLKRTRHERDARSSEGKPV
Sbjct: 361 EAKATPVGKKIADMNLDDVELRCELLTQHIIYREPLSTVLQLLKRTRHERDARSSEGKPV 420

Query: 421 LRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTL 480
           LRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTL
Sbjct: 421 LRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTL 480

Query: 481 AKHISS 486
           AKHISS
Sbjct: 481 AKHISS 486

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/95 (52%), Positives = 63/95 (66%)

Query: 4   VSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNS 63
           + K    K GRK +DTEAKNKRTAQNRAAQRAFRERKE K+R LEE +  L+ +  +   
Sbjct: 17  LPKRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEM 76

Query: 64  ETEYLKECLSELLTEVTKYRPANEKDQGILKRLKE 98
           E+E+L+  L  L+ E+ KYRP    D  +LK L E
Sbjct: 77  ESEFLRSQLQMLIAEIQKYRPQQSSDSQVLKYLAE 111

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479
           +L+C +I   +     Y  +D + LC EL  KAK S+ G          VV+ + D+Q  
Sbjct: 514 LLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKG----------VVVNSDDVQSA 563

Query: 480 LAKHIS 485
           LAKH+S
Sbjct: 564 LAKHMS 569

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 73/108 (67%), Gaps = 6/108 (5%)

Query: 2   SKVSKEGKKKAG---RKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMN 58
           S  S E +KK G   RK +D+EAK+KRTAQNRAAQRAFRERKE K++ LE+ +  L+ +N
Sbjct: 26  SPTSDEPRKKGGKPGRKPLDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELN 85

Query: 59  SKKNSETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEI---KADD 103
            +   ETE+L+  L  L+TE+ +YRP N  D  +L+ L +    K+DD
Sbjct: 86  QQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVLQYLAKTENSKSDD 133

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473
           SS+GK +L+C ++   +     Y  +D + LC ELM KAK S+          R VV++A
Sbjct: 519 SSDGK-LLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSE----------RGVVVQA 567

Query: 474 GDLQRTLAKHI 484
            D+Q  L   +
Sbjct: 568 EDVQYALNNRV 578

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 63/94 (67%)

Query: 3   KVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKN 62
           ++ K    K GRK +DTEAKNKRTAQNRAAQRAFRERKE K+R LEE +  L+ +  +  
Sbjct: 16  ELHKRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSE 75

Query: 63  SETEYLKECLSELLTEVTKYRPANEKDQGILKRL 96
            E+E+L+  L +LL E+ KYRP    D  +L  L
Sbjct: 76  LESEFLRSQLQKLLAEIQKYRPRQSSDSQVLNFL 109

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 10/66 (15%)

Query: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479
           +L+C ++   +     Y  +D + LC EL  KAK S+ G          VV+   D+QR 
Sbjct: 529 LLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKG----------VVVNIDDVQRA 578

Query: 480 LAKHIS 485
           L KH+S
Sbjct: 579 LTKHMS 584

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score = 90.9 bits (224), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (69%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           K GRK + TEAKNKRTAQNRAAQRAFRERKE K++ LE+ +  L+ +  +   ETE+L+ 
Sbjct: 48  KPGRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQNEVETEFLRS 107

Query: 71  CLSELLTEVTKYRPANEKDQGILKRL 96
            L  L++E+ KYRP    D  +L+ L
Sbjct: 108 QLMTLISELKKYRPEQSMDTQVLEYL 133

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 11/72 (15%)

Query: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473
           S +GK +L+C +I   +     Y  LD + LC EL  KAK S+ G          VV+ A
Sbjct: 507 SRDGK-LLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKG----------VVVNA 555

Query: 474 GDLQRTLAKHIS 485
            D+Q+ LAKH+S
Sbjct: 556 DDVQKALAKHMS 567

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 2   SKVSKEGKKKAGRKII-DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSK 60
           S V+   KKK GRK++ D E KNKRTAQNRAAQRAFRERKE K++ LE+ +  L+ +  +
Sbjct: 36  STVANANKKKVGRKLLGDHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQ 95

Query: 61  KNSETEYLKECLSELLTEVTKYRPANEKDQGILKRL 96
            + E+E+L+  L+ ++ E+ KYRP    D  +L+ L
Sbjct: 96  NDVESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYL 131

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 11/78 (14%)

Query: 408 HERDARSSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKR 467
           H+    +S+GK +L+C ++   +     Y  +D + LC ELM+ AK SD G         
Sbjct: 525 HDMVIPTSDGK-LLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAKCSDKG--------- 574

Query: 468 HVVIKAGDLQRTLAKHIS 485
            VV+ + D+Q+ L+ H+S
Sbjct: 575 -VVVDSKDVQKALSNHMS 591

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 79/126 (62%), Gaps = 9/126 (7%)

Query: 2   SKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKK 61
           +K +K+   K GRK+ D EAK+KRTAQNRAAQRAFRER+E K++ LE+ +  L+ ++ K 
Sbjct: 30  TKETKKKSNKVGRKLSDQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVKSLEEVHKKS 89

Query: 62  NSETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEIKADDLKSVEVVPEQPSATNFMN 121
             E+++L++ L  LL E+ +YRP  + D  + + L   K D        P   SA+N  N
Sbjct: 90  EIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLSTHKFD--------PSVVSASN-KN 140

Query: 122 SPTNIT 127
           SP +I+
Sbjct: 141 SPNDIS 146

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 10/70 (14%)

Query: 416 EGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGD 475
           +GK  ++C ++   +     Y  LD + LC ELM+KAK S+ G          VV+KA D
Sbjct: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKG----------VVVKADD 598

Query: 476 LQRTLAKHIS 485
           +Q+ L KH+S
Sbjct: 599 VQKALTKHLS 608

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 60/86 (69%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           + GRK +DT AKN+RTAQNRAAQRAFRERKE K++ LE+ I  L+ +      E+ +L++
Sbjct: 23  RPGRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVESTFLRD 82

Query: 71  CLSELLTEVTKYRPANEKDQGILKRL 96
            + +L+ ++ KYRP N  D  +LK L
Sbjct: 83  YMMDLICDMQKYRPNNSTDSKVLKYL 108

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 9/45 (20%)

Query: 440 DFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTLAKHI 484
           D ++LC EL+ KAK SD+G          +VI++ D++ TL KH 
Sbjct: 440 DIDSLCQELITKAKCSDEG---------TIVIRSRDVKNTLRKHF 475

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score = 88.2 bits (217), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 62/83 (74%)

Query: 2   SKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKK 61
           S  SK  ++K GRK ++TEAK+KRTAQNRAAQRAFRER+E K++ LE+ +  L+ +N + 
Sbjct: 34  SPASKRRERKPGRKPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQS 93

Query: 62  NSETEYLKECLSELLTEVTKYRP 84
             ET++L+  ++ LL+E+ +Y P
Sbjct: 94  ELETKFLRNQVTNLLSELKRYNP 116

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 77/183 (42%), Gaps = 35/183 (19%)

Query: 304 NMVMRRESSAMNNGGI--LDTVINSPIPMLDDNSEDILGDFTCSCQNKANSCPTRQLENE 361
           NMV R     M N  I  +DT +    P  DD   DIL +   + Q + +S P + L NE
Sbjct: 433 NMVSRN----MQNPEIPFIDTGL--AFPDYDDPLLDILKEEQENEQVEGDSDPIQALINE 486

Query: 362 AKATPVGKKIADMNLDDVELRCELLTQHIIYREPLSTVLQLLKRTRHERDARSSEGKPVL 421
             + P+    A      V    +L  Q  I ++ +                 S++GK +L
Sbjct: 487 EPSMPLCHDPAANAGASVSETDKLSNQEEIVQDIIP----------------SNDGK-LL 529

Query: 422 RCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTLA 481
           +C ++   +     Y  LD + LC EL  KAK S+ G          VV+ A D+Q+ L 
Sbjct: 530 KCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKG----------VVVNAEDVQKALI 579

Query: 482 KHI 484
            H+
Sbjct: 580 SHM 582

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 57/86 (66%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           K GRK +D E KNKRTAQNRAAQRAFRERKE K++ LE+ +  L+  N     E+E+L+ 
Sbjct: 48  KPGRKPLDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESEFLRS 107

Query: 71  CLSELLTEVTKYRPANEKDQGILKRL 96
            L  L+ E+ KYRPA   D  +L  L
Sbjct: 108 QLLTLVNELKKYRPAKANDLQVLDYL 133

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 16/114 (14%)

Query: 376 LDDVE-LRCELLTQHIIYREPLSTVLQLLKRTRH----ERDARSSEGKPVLRCEDICGTV 430
           LD+VE      + +++I  EP ST   + + TR     E D   S    +L+C ++   +
Sbjct: 362 LDEVEPTDNNFVNENLINEEP-STTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRI 420

Query: 431 GPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTLAKHI 484
                Y ++D + LC ELM KAK S+ G          VV++A D+QR L KH+
Sbjct: 421 TTHPKYSAIDIDGLCGELMTKAKCSEKG----------VVVQAEDVQRVLDKHM 464

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (68%), Gaps = 1/89 (1%)

Query: 9   KKKAGRKII-DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEY 67
           +KK GRK++ D++ K+KRT QNR AQRAFRERKE KL+ LE+ ++ L+ +N  K  ET +
Sbjct: 27  RKKVGRKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNF 86

Query: 68  LKECLSELLTEVTKYRPANEKDQGILKRL 96
           L+  L  +  E+ KYRPA   D  +L+ L
Sbjct: 87  LRSRLKSMADELKKYRPAQSSDLEVLEYL 115

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 10/72 (13%)

Query: 415 SEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAG 474
           +E    L+C  +   +     Y  LD + LC ELM +AK S+ G          VV+++ 
Sbjct: 499 AEDGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKG----------VVVESR 548

Query: 475 DLQRTLAKHISS 486
           D+Q+ L+K++SS
Sbjct: 549 DVQKALSKYLSS 560

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 57/83 (68%)

Query: 14  RKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLS 73
           ++++D EA+NKRTAQNRAAQRAFRERKE K++ LEE +  L  +  +   E+E+L+  L 
Sbjct: 69  KQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIESEFLRSQLI 128

Query: 74  ELLTEVTKYRPANEKDQGILKRL 96
            L+ E+ KY+P NE    +L  +
Sbjct: 129 TLVNELKKYKPNNENASKVLNYI 151

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479
           +LRC +I   +     Y  LD + LC+ELM KAK S+          R VV+ A D+Q  
Sbjct: 582 LLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSE----------RGVVVNAEDVQMA 631

Query: 480 LAKHIS 485
           L KH+S
Sbjct: 632 LTKHMS 637

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 87/139 (62%), Gaps = 6/139 (4%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           + GRK ID+EAK++RTAQNRAAQRAFR+RKEAK+++L+E + +L+  +++  + T++L  
Sbjct: 35  RPGRKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDAQNKTTTDFLLC 94

Query: 71  CLSELLTEVTKYRPANEKDQGILKRLKEIKADDLKSVEVVP-EQPSATNFMNSPTNITTA 129
            L  LL+E+TKYR  N  D+ IL  L     DDL+  +    E+ ++T    +   + + 
Sbjct: 95  SLKSLLSEITKYRAKNSDDERILAFL-----DDLQEQQKRENEKGTSTAVSKAAKELPSP 149

Query: 130 GSDKQADKTSSKKSSPHVK 148
            SD+     +S +  PH +
Sbjct: 150 NSDENMTVNTSIEVQPHTQ 168

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 25/117 (21%)

Query: 380 ELRCELLTQHIIYREPLSTVLQLLKRTRHERDARS------------SEGKPVLRCEDIC 427
           E++C+L+T H++ ++ L++VL +     H +  R+            S GK    C  I 
Sbjct: 305 EIKCDLITSHLLNQKSLASVLPVA--ASHTKTIRTQSEAIEHISSAISNGKA--SCYHIL 360

Query: 428 GTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTLAKHI 484
             +     Y SLD ++LC+EL+ KAK +DD           +V+KA DLQ  L + +
Sbjct: 361 EEISSLPKYSSLDIDDLCSELIIKAKCTDDC---------KIVVKARDLQSALVRQL 408

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 79.0 bits (193), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 68/114 (59%), Gaps = 2/114 (1%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           + GRK +D +AKNKRT QNR AQRAFRERKEAKL+ LE  +  L+  N  K    E+LK+
Sbjct: 11  RPGRKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEIIEFLKQ 70

Query: 71  CLSELLTEVTKYRPANEKDQGILKRLKEIKADDLKSVEVVPEQPSATNFMNSPT 124
            +  LL E+  YR    KD+ +L  + +++ D + +  +  +    +N+ + P 
Sbjct: 71  NVMTLLGEIKNYRKQTNKDKKLLDTIGKLENDGMDATTL--QHSPVSNYGSPPV 122

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 68/96 (70%)

Query: 4   VSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNS 63
           + K    + GRK +D+EAKN+RTAQNRAAQRAFR+RKEA+L++L E I +L+  +++  S
Sbjct: 12  IPKRKVGRPGRKRVDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQKDAQNKS 71

Query: 64  ETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEI 99
             ++L+  L  LL+EVTKYR  N  D+ IL  L ++
Sbjct: 72  VIDFLQSSLKSLLSEVTKYRAKNVNDERILAFLDDL 107

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 63/134 (47%), Gaps = 17/134 (12%)

Query: 359 ENEAKATPVGKKIADMNLDDVELRCELLTQHIIYREPLSTVLQLLKRTRHERDARSSEGK 418
           ENE      GK   D  L + E++CEL+T+ ++ +E L +++      R     RS   +
Sbjct: 268 ENECNGKCNGKCAEDTPLLNKEIKCELITKRLLNQESLDSIVPASAPYRENIGIRSEAIR 327

Query: 419 PV--------LRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVV 470
            +          C  I   +     Y SLD +NLC ELM KA+ +DD +         +V
Sbjct: 328 RISSAISNQNTSCCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCE---------IV 378

Query: 471 IKAGDLQRTLAKHI 484
           ++A DLQ TL K +
Sbjct: 379 VRAHDLQTTLVKQL 392

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 59/91 (64%)

Query: 6   KEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSET 65
           ++G K + ++ +D E K KRTAQNRAAQRAFRERKE K++ LE+ +  L+ +  +   E 
Sbjct: 51  RKGTKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEA 110

Query: 66  EYLKECLSELLTEVTKYRPANEKDQGILKRL 96
            +L++ L  L+ E+ KYRP    D  +L+ L
Sbjct: 111 TFLRDQLVTLVNELKKYRPETRNDSKVLEYL 141

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473
           S EG  +LRC +I   +     Y  +D + LC+ELM KAK S+ G          VVI A
Sbjct: 579 SKEGS-LLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG----------VVINA 627

Query: 474 GDLQRTLAKHI 484
            D+Q  L KH+
Sbjct: 628 EDVQLALNKHM 638

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 54/86 (62%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           + GR+ +D EAKNKRT QNR AQRA+RERKEAKLR LE  I  L+ +NS      E +  
Sbjct: 17  RPGRRKLDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERLNSYNEDRAELMAA 76

Query: 71  CLSELLTEVTKYRPANEKDQGILKRL 96
            L +LL E  K+R    +D+ + + L
Sbjct: 77  HLRDLLGEANKFRGEKPRDKTVRELL 102

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 51/108 (47%), Gaps = 20/108 (18%)

Query: 379 VELRCELLTQHIIYREPLSTVLQLLKRTRHERDARSSEGKPVLRCEDICGTVGPSIGYDS 438
            +++C+LLT+ ++  E L +++        E+   S++      C  +  T+  S  Y  
Sbjct: 297 TDIKCDLLTRRVMNNESLRSIIA-------EKRCGSNDT-----CAHVIRTLTQSPHYQE 344

Query: 439 LDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTLAKHISS 486
            D E+LC ELM K K  D  D +       + +   D++  L +HI++
Sbjct: 345 NDLEDLCQELMVKCKF-DTHDAS-------ITVGREDVRSALERHIAA 384

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%)

Query: 6   KEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSET 65
           K    K+ R  +D EAK KRTAQNRAAQRAFRERKE K++ LE  +  L  +  +   E+
Sbjct: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIES 90

Query: 66  EYLKECLSELLTEVTKYRPANEKDQGILKRL 96
           E+L+  L  L+ E+ KYRP    D  +L  L
Sbjct: 91  EFLRSQLITLVKELKKYRPETANDSQVLNYL 121

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 411 DARSSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVV 470
           D   S+ K +LRC ++   +     Y  +D + LC ELM KAK S+ G          VV
Sbjct: 417 DVVPSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKG----------VV 466

Query: 471 IKAGDLQRTLAKHIS 485
           + A D+Q  L+KH+S
Sbjct: 467 VNAEDVQSALSKHLS 481

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 55/82 (67%)

Query: 5   SKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSE 64
           S+    K GRK +DTEAKN+RTAQNRAAQRAFRERKE K++ LE+ +  L+    +   E
Sbjct: 38  SRRKGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSERE 97

Query: 65  TEYLKECLSELLTEVTKYRPAN 86
            + L+  +  LL E+ KYRP +
Sbjct: 98  VQSLRNQVVSLLRELKKYRPGS 119

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 60/91 (65%)

Query: 6   KEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSET 65
           ++G K + ++ +D E K KRTAQNRAAQRAFRERKE K++ LE+ +  L+ +  +   E 
Sbjct: 51  RKGSKTSKKQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEVEA 110

Query: 66  EYLKECLSELLTEVTKYRPANEKDQGILKRL 96
            +L++ L  L++E+ KYRP    D  +L+ L
Sbjct: 111 TFLRDQLVTLVSELKKYRPETRNDSKVLEYL 141

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473
           S EG  +LRC +I   +     Y  +D + LC+ELM KAK S+ G          VVI A
Sbjct: 585 SKEGS-LLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG----------VVINA 633

Query: 474 GDLQRTLAKHI 484
            D+Q  L KH+
Sbjct: 634 EDVQLALNKHM 644

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 6/106 (5%)

Query: 1   MSKVSKEGKKK--AGRKI----IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVL 54
           M++V   G +K  A RK     +D E + KR AQNRAAQ+AFRERKE K++ LE  +V L
Sbjct: 1   MAEVDNGGAQKSSASRKKRYQELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDL 60

Query: 55  KGMNSKKNSETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEIK 100
           + +      ET +L++ LS L+ E+ KYRP  ++D  +LK L++ K
Sbjct: 61  ENLTKLNEVETNFLRDQLSILVKELRKYRPETKQDHKVLKYLEKHK 106

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479
           +LRC +I   +     Y  +D + LC+ELM KAK S+          R VVI A D+Q  
Sbjct: 533 LLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSE----------RGVVINADDVQVA 582

Query: 480 LAKHIS 485
           L KH+S
Sbjct: 583 LNKHMS 588

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 61/99 (61%)

Query: 14  RKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLS 73
           +K +D EAKNKRTAQNRAAQRAFRERKE K++ LEE +  L  +  +   E+E+L+  L 
Sbjct: 60  KKQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFLRGQLI 119

Query: 74  ELLTEVTKYRPANEKDQGILKRLKEIKADDLKSVEVVPE 112
            L+ E+ KYR  N  +  +L+ L +   ++       PE
Sbjct: 120 TLVNELKKYRDPNPNESKVLEYLSQHNGNNKDFTFQFPE 158

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479
           +LRC +I   +     Y  LD + LC+ELM KAK S+ G          VV+ A D+Q  
Sbjct: 532 LLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERG----------VVVNAEDVQLA 581

Query: 480 LAKHIS 485
           L KH+S
Sbjct: 582 LTKHMS 587

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 52/78 (66%)

Query: 17  IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELL 76
           ID EA+ +RTAQNRAAQRAFRERKE K++ LE  +  L+ ++ K   ETE+L+  +  L+
Sbjct: 39  IDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFLRSQVLTLV 98

Query: 77  TEVTKYRPANEKDQGILK 94
            E+ KYR     D  ILK
Sbjct: 99  NELKKYRSETTSDSKILK 116

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 10/92 (10%)

Query: 394 EPLSTVLQLLKRTRHERDARSSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAK 453
            PL+ ++Q       E     S    ++RC +I   +  +  Y  LD + LC ELM  AK
Sbjct: 394 HPLTVLVQEPDDELDEDVVVPSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAK 453

Query: 454 ISDDGDGTDIVPKRHVVIKAGDLQRTLAKHIS 485
            SD G          VV+ + D+ + LAKH++
Sbjct: 454 CSDKG----------VVVASKDVHKVLAKHMA 475

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%)

Query: 17  IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELL 76
           +D E K KRTAQNRAAQRAFRERKE K++ LE+ +  L+ +  +   E  +L++ L  L+
Sbjct: 62  LDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLV 121

Query: 77  TEVTKYRPANEKDQGILKRL 96
            E+ KYRP    D  +L+ L
Sbjct: 122 NELKKYRPETRNDSKVLEYL 141

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473
           S EG  +LRC +I   +     Y  +D + LC+ELM KAK S+ G          VVI A
Sbjct: 590 SKEGS-LLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG----------VVINA 638

Query: 474 GDLQRTLAKHI 484
            D+Q  L KH+
Sbjct: 639 EDVQLALNKHM 649

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (63%)

Query: 17  IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELL 76
           +D E K KRTAQNRAAQRAFRERKE K+  LE+ +  L+ +  +   E  +L++ L  L+
Sbjct: 62  LDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTLV 121

Query: 77  TEVTKYRPANEKDQGILKRL 96
            E+ KYRP    D  +L+ L
Sbjct: 122 NELKKYRPETRNDSKVLEYL 141

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473
           S EG  +LRC +I   +     Y  +D + LC+ELM KAK S+ G          VVI A
Sbjct: 605 SKEGS-LLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG----------VVINA 653

Query: 474 GDLQRTLAKHI 484
            D+Q  L KH+
Sbjct: 654 EDVQLALNKHM 664

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (69%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           K GRK +DTEAKN+RTAQNRAAQRAFRERKE K+R LE+ +  L+   S    E + L+ 
Sbjct: 28  KPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECEVQSLRG 87

Query: 71  CLSELLTEVTKYR 83
            +  L+ E+ ++R
Sbjct: 88  HVIALVRELRRWR 100

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%)

Query: 15  KIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSE 74
           K +D EA+ KRT QNRAAQRAFRERKE K++ LE  +  L  +  +   E+E+L+  L  
Sbjct: 43  KPLDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQKQNEVESEFLRGQLVT 102

Query: 75  LLTEVTKYRPANEKDQGILKRL 96
           L+ E+ KYRP    D  +L+ L
Sbjct: 103 LVHELKKYRPETSNDSKVLEYL 124

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 11/72 (15%)

Query: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473
           S +GK +L+C +I   +     Y  LD + LC ELM KAK S+ G          VV+ A
Sbjct: 422 SKDGK-LLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAKCSERG----------VVVNA 470

Query: 474 GDLQRTLAKHIS 485
            D++  L +HI+
Sbjct: 471 DDVKDALNRHIA 482

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON}
          Anc_5.528 YDR423C
          Length = 599

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%)

Query: 18 DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELLT 77
          + E K+KRTAQNRAAQRAFRERKE K+++LEE +V L+ +     SET +L+  L    T
Sbjct: 29 NAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAHESETSFLRSQLILFGT 88

Query: 78 EVTK 81
          E+ K
Sbjct: 89 ELRK 92

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479
           +L C  I   +     Y S D ENLC ELM+KAK SD G          VV+ + D+ + 
Sbjct: 536 MLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKG----------VVVSSLDVDKV 585

Query: 480 L 480
           L
Sbjct: 586 L 586

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa]
          {ON} Anc_5.528 YDR423C
          Length = 506

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 42/60 (70%)

Query: 24 KRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELLTEVTKYR 83
          KR AQNRAAQ+AFRERKE K++ L+E +  L+ +N K   ET +L+  L  L+ E+ KYR
Sbjct: 21 KRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNELKKYR 80

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479
           +L C +I   +     Y  +D + LC ELM  AK SD G          V++ + D+Q+ 
Sbjct: 451 LLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKG----------VLVSSDDVQKV 500

Query: 480 LAKHI 484
           L++ +
Sbjct: 501 LSRRL 505

>Suva_2.600 Chr2
          complement(1070824..1071000,1071004..1071024,
          1071028..1071144,1071132..1071362,1071366..1071527,
          1071531..1071734,1071738..1071752,1071756..1071953,
          1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
          (PSEUDO)
          Length = 382

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/62 (51%), Positives = 42/62 (67%)

Query: 17 IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELL 76
          I  EAKN+RTAQNRAAQ+AFR RKE K + LEE   +L+  +++    T+YL+  L  LL
Sbjct: 8  IAVEAKNERTAQNRAAQQAFRNRKEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRSLL 67

Query: 77 TE 78
           E
Sbjct: 68 LE 69

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 69/170 (40%), Gaps = 43/170 (25%)

Query: 330 MLDDNSEDILG------DFTCSCQNK---ANSCPTRQLENEAKATPVGKKIADMNLDDVE 380
           +L+D S D+L          C+C  K   A  CP ++L                   D +
Sbjct: 240 LLNDASNDLLSANQTPISLKCNCNGKCMKAIPCPIKRL-------------------DKK 280

Query: 381 LRCELLTQHIIYREPLSTVLQL------LKRTRHERDARSSEGKPVLRCEDICGTVGPSI 434
           ++  L+T+H+I +EPL ++L        + +   E             C  I   +    
Sbjct: 281 IKYGLITRHLINQEPLDSILPASAPRGGVLKLHPEPFTSKMPYNETFFCSHILRHISSIP 340

Query: 435 GYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTLAKHI 484
            + SLD +NLC ELM KAK S D           ++++A  LQ  LA+ +
Sbjct: 341 KHSSLDIDNLCCELMVKAKCSGDC---------QIMVQAHGLQSVLARQL 381

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 26/124 (20%)

Query: 375 NLDDVELRCELLTQHIIYREPLSTVLQLLKRTRHERDARS----SEGKPVLRCEDICGTV 430
           N DD E+ CELL+++++  E + ++++  K+TR    A S      G    +C  I   +
Sbjct: 408 NSDDEEIECELLSRNLLNDESMKSIIK-EKQTRPSNVAPSCCNGGYGNRFAKCSKIWERI 466

Query: 431 ----------GPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTL 480
                     GP   +   D ++LC ELM KA+ S +G          +VIK GD++++L
Sbjct: 467 NNKMNIETNSGPR--FKDSDIDDLCNELMTKARCSTNG---------SIVIKTGDIKQSL 515

Query: 481 AKHI 484
            KH 
Sbjct: 516 MKHF 519

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%)

Query: 44 LRALEETIVVLKGMNSKKNSETEYLKECLSELLTEVTKYRPANEKDQGILKRL 96
          ++ LE+ I  L+ +  + + ET +L+  +++L+ EV K+RP N  D  ILK L
Sbjct: 1  MKELEDKISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYL 53

>SAKL0E02420g Chr5 complement(192871..193839) [969 bp, 322 aa] {ON}
           some similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 322

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 42/71 (59%), Gaps = 14/71 (19%)

Query: 16  IIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSEL 75
           + + E + ++ AQNRAAQRAFRERKEAKL+ LE  +     M S++N E+         L
Sbjct: 143 LTEKEIQARKKAQNRAAQRAFRERKEAKLKELERKL-----MESEQNRES---------L 188

Query: 76  LTEVTKYRPAN 86
           L EV + R  N
Sbjct: 189 LKEVEQLRRQN 199

>Kwal_26.7848 s26 (539163..540038) [876 bp, 291 aa] {ON} YHL009C
           (YAP3) - bZip DNA binding proteins [contig 55] FULL
          Length = 291

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 26/29 (89%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETIV 52
           K+ AQNRAAQRAFRERKEAKL+ LEE ++
Sbjct: 119 KKKAQNRAAQRAFRERKEAKLKELEEKLI 147

>Skud_8.36 Chr8 complement(72120..73118) [999 bp, 332 aa] {ON}
           YHL009C (REAL)
          Length = 332

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 14/70 (20%)

Query: 17  IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELL 76
           I  + K K+ AQNRAAQRAFRERKEA+LR L++     K M S+KN ++         LL
Sbjct: 143 IPGDFKAKKKAQNRAAQRAFRERKEARLRELQD-----KLMKSEKNRQS---------LL 188

Query: 77  TEVTKYRPAN 86
            E+ + R  N
Sbjct: 189 KEIKELRKVN 198

>KLTH0D05918g Chr4 (526400..527332) [933 bp, 310 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 310

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%)

Query: 17  IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVV 53
           I+  +  K+ AQNRAAQRAFRERKEAK++ L+E +V 
Sbjct: 133 IEDASARKKKAQNRAAQRAFRERKEAKMKQLQEQLVT 169

>Suva_8.43 Chr8 complement(86607..87599) [993 bp, 330 aa] {ON}
           YHL009C (REAL)
          Length = 330

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 14/67 (20%)

Query: 20  EAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELLTEV 79
           ++K K+ AQNRAAQ+AFRERKEA+L+ LE+ +     + S+KN ++         LL E+
Sbjct: 141 DSKAKKKAQNRAAQKAFRERKEARLKELEDKL-----LESEKNRQS---------LLKEI 186

Query: 80  TKYRPAN 86
            + R AN
Sbjct: 187 EELRKAN 193

>CAGL0K08756g Chr11 (881947..882996) [1050 bp, 349 aa] {ON} weakly
           similar to uniprot|P40574 Saccharomyces cerevisiae
           YIR018w YAP5 involved in transcription activation
          Length = 349

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (51%), Gaps = 8/102 (7%)

Query: 2   SKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKK 61
           +KVS  G    G         N++  QNR AQRA+RER   KL+ LE+ +  L+GM   K
Sbjct: 60  AKVSPAGDSPTGEDSKHMSGPNRKRLQNREAQRAYRERSRNKLQTLEDNVETLQGM--VK 117

Query: 62  NSETEYLKECLSELLTEVTKYR-PANEKDQGILKRLKEIKAD 102
             +++Y      +L +E  +Y+  +NEK   + K + E K D
Sbjct: 118 MWQSKY-----KQLASEFDQYKQSSNEKIVELEKTISESKED 154

>Ecym_2430 Chr2 (837395..838321) [927 bp, 308 aa] {ON} similar to
           Ashbya gossypii ABR018C
          Length = 308

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%)

Query: 18  DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLK 69
           D   K K+ AQNRAAQ+AFRERKEA+L+ LE+ +   +      N E E LK
Sbjct: 126 DGYVKEKKKAQNRAAQKAFRERKEARLKELEQRLKESEENRDALNKEMEELK 177

>Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON}
           YHL009C (REAL)
          Length = 331

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 14/70 (20%)

Query: 17  IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELL 76
           I  ++K K+ AQNRAAQ+AFRERKEA+L+ L++ +     + S+KN ++         LL
Sbjct: 142 ISDDSKAKKKAQNRAAQKAFRERKEARLKELQDKL-----LESEKNRQS---------LL 187

Query: 77  TEVTKYRPAN 86
            E+ + R  N
Sbjct: 188 KEIEELRKVN 197

>KNAG0C05680 Chr3 complement(1096585..1097664) [1080 bp, 359 aa]
           {ON} Anc_2.493 YHL009C
          Length = 359

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 31/44 (70%)

Query: 9   KKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIV 52
           + + G  + +   K ++ AQNRAAQ+AFRERKEA+L+ LEE + 
Sbjct: 136 QHEGGGHVSEEVNKARKKAQNRAAQKAFRERKEARLKELEEKLA 179

>YOR028C Chr15 complement(383533..384420) [888 bp, 295 aa] {ON}
           CIN5Basic leucine zipper (bZIP) transcription factor of
           the yAP-1 family; physically interacts with the
           Tup1-Cyc8 complex and recruits Tup1p to its targets;
           mediates pleiotropic drug resistance and salt tolerance;
           nuclearly localized under oxidative stress and
           sequestered in the cytoplasm by Lot6p under reducing
           conditions
          Length = 295

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%), Gaps = 5/68 (7%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           K G+ + +T    KR AQNR+AQ+AFR+R+E  ++ LEE   +  G+  K+NSE + + E
Sbjct: 233 KTGKPLRNT----KRAAQNRSAQKAFRQRREKYIKNLEEKSKLFDGL-MKENSELKKMIE 287

Query: 71  CLSELLTE 78
            L   L E
Sbjct: 288 SLKSKLKE 295

>NDAI0B01800 Chr2 (429150..430490) [1341 bp, 446 aa] {ON} Anc_2.493
           YHL009C
          Length = 446

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (77%)

Query: 16  IIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETI 51
           + + E K K+ AQNRAAQ+AFRERK+AKL+ L E +
Sbjct: 181 LTEEEIKAKKKAQNRAAQKAFRERKDAKLKELREKL 216

>CAGL0M08800g Chr13 (878328..879119) [792 bp, 263 aa] {ON} weakly
           similar to uniprot|Q03935 Saccharomyces cerevisiae
           YDR259c YAP6 transcription factor of a fungal-specific
           family of bzip proteins
          Length = 263

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 11/77 (14%)

Query: 19  TEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGM---NSKKNSETEYLKECLSEL 75
           T+   KR  QNR AQ+AFR+RKE  ++ LE    ++  +   N    SE E L++CL+ L
Sbjct: 157 TKKNTKRAMQNRKAQKAFRQRKEQYIKLLENEAKLIDDVMKKNQDLTSENEQLRDCLNRL 216

Query: 76  LTEVTKYRPANEKDQGI 92
           + ++        KD GI
Sbjct: 217 IEKL--------KDNGI 225

>YHL009C Chr8 complement(84068..85060) [993 bp, 330 aa] {ON}
           YAP3Basic leucine zipper (bZIP) transcription factor
          Length = 330

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 14/67 (20%)

Query: 20  EAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELLTEV 79
           ++K K+ AQNRAAQ+AFRERKEA+++ L++     K + S++N ++         LL E+
Sbjct: 145 DSKAKKKAQNRAAQKAFRERKEARMKELQD-----KLLESERNRQS---------LLKEI 190

Query: 80  TKYRPAN 86
            + R AN
Sbjct: 191 EELRKAN 197

>ABR018C Chr2 complement(425339..426187) [849 bp, 282 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL009C
           (YAP3)
          Length = 282

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETI 51
           K+ AQNRAAQ+AFRERKEA+LR LE+ +
Sbjct: 115 KKKAQNRAAQKAFRERKEARLRELEQKL 142

>CAGL0K02585g Chr11 complement(233972..235078) [1107 bp, 368 aa]
           {ON} some similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009c transcription factor
          Length = 368

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 28/36 (77%)

Query: 16  IIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETI 51
           + + E K ++ AQNRAAQ+AFRERKEA+L+ LE  +
Sbjct: 189 LTEDEIKARKKAQNRAAQKAFRERKEARLKELENKL 224

>CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009c transcription factor
          Length = 368

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/28 (67%), Positives = 23/28 (82%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETI 51
           K+ AQNRAAQRAFRERKEAK + L+  +
Sbjct: 169 KKKAQNRAAQRAFRERKEAKFKELQRKV 196

>Kpol_1018.169 s1018 complement(434066..434935) [870 bp, 289 aa]
           {ON} complement(434066..434935) [870 nt, 290 aa]
          Length = 289

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 30/42 (71%)

Query: 16  IIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGM 57
           ++ T+  +K+   NR AQRAFRERKE K++ LE+TI  L+ +
Sbjct: 62  VVSTDVVSKKRQLNRDAQRAFRERKEKKIQDLEDTIDTLQML 103

>Suva_8.81 Chr8 complement(145144..146049) [906 bp, 301 aa] {ON}
           YOR028C (REAL)
          Length = 301

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 5/68 (7%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           K G+ + +T    KR AQNR+AQ+AFR R+E  ++ LEE   +  G+  K+N E + + +
Sbjct: 235 KTGKPLRNT----KRAAQNRSAQKAFRHRREKYIKNLEEKSKIFDGL-VKENDELKKMID 289

Query: 71  CLSELLTE 78
            L+  + E
Sbjct: 290 LLNAKIKE 297

>ZYRO0B01100g Chr2 (92729..93499) [771 bp, 256 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 256

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (75%)

Query: 15  KIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETI 51
           ++ + + K  + AQNRAAQRAFRERKE +L+ LE+ +
Sbjct: 73  ELTEEKLKQIKRAQNRAAQRAFRERKETRLKELEQEL 109

>KAFR0D01380 Chr4 complement(276591..277715) [1125 bp, 374 aa] {ON}
           Anc_7.115 YIR018W
          Length = 374

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 31/43 (72%), Gaps = 2/43 (4%)

Query: 13  GRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLK 55
           G K +D+ A+  R  QNR AQRA+RERK  ++++LE T+ +L+
Sbjct: 112 GSKKVDSTAR--RRKQNREAQRAYRERKANRIQSLENTVNMLR 152

>KAFR0D03420 Chr4 complement(673634..674455) [822 bp, 273 aa] {ON}
           Anc_2.493 YHL009C
          Length = 273

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 29/43 (67%)

Query: 28  QNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           QNR AQ+AFRERKEAK++ L+  +   +  N K  +E + LKE
Sbjct: 103 QNRMAQKAFRERKEAKIKELQNRLATTQEDNEKLMNEIKVLKE 145

>NCAS0A08020 Chr1 (1585065..1585781) [717 bp, 238 aa] {ON} 
          Length = 238

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 8   GKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALE 48
           G K   RK I T    KR AQNR AQ+AFR+RKE  ++ LE
Sbjct: 169 GTKSITRKPISTA---KRAAQNRNAQKAFRQRKERYIKILE 206

>Smik_15.206 Chr15 complement(349411..350298) [888 bp, 295 aa] {ON}
           YOR028C (REAL)
          Length = 295

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 5/62 (8%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           K G+ + +T    KR AQNR+AQ+AFR+R+E  ++ LEE   +   +  ++NSE + + E
Sbjct: 233 KTGKPLRNT----KRAAQNRSAQKAFRQRREKYIKNLEEKSKLFDSL-VEENSELKKMVE 287

Query: 71  CL 72
            L
Sbjct: 288 SL 289

>Kpol_1055.22 s1055 (53408..54433) [1026 bp, 341 aa] {ON}
           (53408..54433) [1026 nt, 342 aa]
          Length = 341

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%)

Query: 19  TEAKNKRTAQNRAAQRAFRERKEAKLRALE 48
           ++ K K+  +NR AQ+AFRERKEAKLR LE
Sbjct: 127 SDDKAKKKERNRQAQKAFRERKEAKLRELE 156

>YIR018W Chr9 (384609..385346) [738 bp, 245 aa] {ON}  YAP5Basic
           leucine zipper (bZIP) iron-sensing transcription factor
          Length = 245

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 55/114 (48%), Gaps = 16/114 (14%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETI----VVLKGMNSK----------KNSETEYLK 69
           K+  QNR AQRA+RERK  KL+ LEETI     V+K   +K          K SE   LK
Sbjct: 63  KKKRQNRDAQRAYRERKNNKLQVLEETIESLSKVVKNYETKLNRLQNELQAKESENHALK 122

Query: 70  ECLSELLTEVTKYRPANEKD-QGILKRLKEIKADDLKSVEVVPEQPSATNFMNS 122
           + L E LT      PA +   Q +++  K +KA  +K    +     +T   +S
Sbjct: 123 QKL-ETLTLKQASVPAQDPILQNLIENFKPMKAIPIKYNTAIKRHQHSTELPSS 175

>Smik_9.218 Chr9 (360302..361048) [747 bp, 248 aa] {ON} YIR018W
           (REAL)
          Length = 248

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYL 68
           K+  QNR AQRA+RERK  KL  LEETI  L  +   KN ET+ +
Sbjct: 63  KKKRQNRDAQRAYRERKNNKLLVLEETIESLSKI--IKNYETKLI 105

>CAGL0F01265g Chr6 (131725..133596) [1872 bp, 623 aa] {ON} some
           similarities with uniprot|Q08182 Saccharomyces
           cerevisiae YOL028c YAP7
          Length = 623

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (73%), Gaps = 2/38 (5%)

Query: 18  DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLK 55
           DT A+ +R  QNR AQRA+RERK  ++  LE+T+ +L+
Sbjct: 197 DTAARRRR--QNREAQRAYRERKATRINELEKTVSLLQ 232

>KAFR0A01970 Chr1 (414629..415612) [984 bp, 327 aa] {ON} Anc_2.493
           YHL009C
          Length = 327

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 22/26 (84%)

Query: 28  QNRAAQRAFRERKEAKLRALEETIVV 53
           QNRAAQ+AFRERKEA+L+ LE  ++ 
Sbjct: 143 QNRAAQKAFRERKEARLKELETKLMA 168

>KLLA0E00265g Chr5 (12033..12899) [867 bp, 288 aa] {ON} weakly
          similar to uniprot|Q06596 Saccharomyces cerevisiae
          YPR199C ARR1 Transcriptional activator of the bZIP
          family required for transcription of genes involved in
          resistance to arsenic compounds
          Length = 288

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%)

Query: 4  VSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALE 48
          +SK   +  GRK   +  K+KRTAQ R +Q+ +RER+  +LR LE
Sbjct: 1  MSKPRGRNGGRKPSSSPPKDKRTAQLRKSQKTYRERRINRLRELE 45

>Suva_9.231 Chr9 (372034..372771) [738 bp, 245 aa] {ON} YIR018W
           (REAL)
          Length = 245

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 18  DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELLT 77
           D E   K+  QNR AQRA+RERK  KL+ LE+TI  L  +     S+   L++ L E  +
Sbjct: 58  DDEELQKKKRQNRDAQRAYRERKNNKLQVLEDTIESLTKIIKNYESKLTRLQDELQERNS 117

Query: 78  E 78
           E
Sbjct: 118 E 118

>NDAI0K02070 Chr11 (463970..465067) [1098 bp, 365 aa] {ON} Anc_2.493
           YHL009C
          Length = 365

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 25/31 (80%)

Query: 22  KNKRTAQNRAAQRAFRERKEAKLRALEETIV 52
           K+K+  QNRAAQ+AFRERKE +L+ L+  ++
Sbjct: 178 KDKKKEQNRAAQKAFRERKENELKILQSKLM 208

>TDEL0H03350 Chr8 (557681..558718) [1038 bp, 345 aa] {ON}
          Anc_7.115 YIR018W
          Length = 345

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 29/40 (72%), Gaps = 2/40 (5%)

Query: 18 DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGM 57
          D E + KR  QNR AQRA+RER+  +++ LE+T+  L+G+
Sbjct: 56 DEEERKKR--QNRDAQRAYRERRTNRIQELEDTVETLQGL 93

>KNAG0B03190 Chr2 (618434..619270) [837 bp, 278 aa] {ON} Anc_5.619
           YOR028C
          Length = 278

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           K+G+ + DT    KR AQNR+AQ+AFR R+E  ++ LE+   +   +      E + LKE
Sbjct: 216 KSGKLVRDT----KRAAQNRSAQKAFRLRREKYIKNLEQKSKIFDDI----VRENQQLKE 267

Query: 71  CLSELLTEV 79
            L+ L + +
Sbjct: 268 QLNSLTSRL 276

>TPHA0C00500 Chr3 complement(86444..87349) [906 bp, 301 aa] {ON}
           Anc_5.619 YOR028C
          Length = 301

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 4/38 (10%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALE 48
           K+G+ + +T    KR AQNR AQ+AFR+RKE  ++ LE
Sbjct: 231 KSGKPLRNT----KRAAQNRNAQKAFRQRKEKYIKKLE 264

>KNAG0A06790 Chr1 complement(1059841..1060767) [927 bp, 308 aa] {ON}
           Anc_2.493 YHL009C
          Length = 308

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 58/123 (47%), Gaps = 28/123 (22%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELLTEVTKYR 83
           K+ AQNRAAQ+A+RERKEA+++ LE            K  E+E  +E   +L  EV + R
Sbjct: 142 KKKAQNRAAQKAYRERKEARMKDLE-----------YKLRESELHRE---KLYREVEELR 187

Query: 84  PANEKDQGILKRL--------KEIKADDLKSVE------VVPEQPSATNFMNSPTNITTA 129
            AN + Q   + L        +E  A+ + +V+      V P +      M S    T  
Sbjct: 188 RANFQIQTTNRHLLQQCEKKQREGAANTMTTVQPSQQRYVFPTEGQCFENMASSKQSTAQ 247

Query: 130 GSD 132
           GS+
Sbjct: 248 GSE 250

>KAFR0C05900 Chr3 complement(1168202..1169029) [828 bp, 275 aa] {ON}
           Anc_5.619 YOR028C
          Length = 275

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 38/71 (53%), Gaps = 14/71 (19%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALE---ETIVVLKGMNSKKNSETEY 67
           K+G+ + DT    KR AQNR AQ+AFR R+E  ++ LE   E    L   NSK       
Sbjct: 210 KSGKVLRDT----KRAAQNRYAQKAFRLRREKYIKGLEKKAEEFDALLTENSK------- 258

Query: 68  LKECLSELLTE 78
           LKE + EL  E
Sbjct: 259 LKELVEELRKE 269

>KLLA0E16875g Chr5 (1498623..1500149) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P40917 Saccharomyces
           cerevisiae YOR028C CIN5 Basic leucine zipper
           transcriptional factor of the yAP-1 family that mediates
           pleiotropic drug resistance and salt tolerance;
           localizes constitutively to the nucleus
          Length = 508

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 33/48 (68%), Gaps = 6/48 (12%)

Query: 3   KVSKEGK--KKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALE 48
           +++ EG+   K+G+ + +T    KR AQNR AQRAFR+R+E  ++ LE
Sbjct: 429 RLNTEGELIGKSGKALRNT----KRAAQNRNAQRAFRQRREKYIKDLE 472

>NCAS0A05020 Chr1 (996896..997708) [813 bp, 270 aa] {ON} Anc_2.493
           YHL009C
          Length = 270

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 25/31 (80%)

Query: 22  KNKRTAQNRAAQRAFRERKEAKLRALEETIV 52
           K K+  QNRAAQ+AFRERKE +L+ L++ ++
Sbjct: 91  KQKKKEQNRAAQKAFRERKENELKRLQDELL 121

>TPHA0G03310 Chr7 complement(708576..709403) [828 bp, 275 aa] {ON}
           Anc_2.493 YHL009C
          Length = 275

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 32/64 (50%), Gaps = 14/64 (21%)

Query: 20  EAKNKRTAQNRAAQRAFRERKEAKLRALE--------------ETIVVLKGMNSKKNSET 65
           E K  +  +NR AQ+AFR RKEAK++ LE                I  LK MN K    +
Sbjct: 112 EDKEIKKQKNRDAQKAFRNRKEAKIKELEIKLQNSEQSKTSLINEIAALKAMNEKLILHS 171

Query: 66  EYLK 69
           +YLK
Sbjct: 172 DYLK 175

>TBLA0E03280 Chr5 (823520..824203) [684 bp, 227 aa] {ON} Anc_5.619
           YOR028C
          Length = 227

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 4/44 (9%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVL 54
           K+G+ + +T    KR AQNR++Q+ FRER+   ++ LEE + +L
Sbjct: 149 KSGKPLRNT----KRAAQNRSSQKHFRERRGKYIKQLEEKVEIL 188

>Skud_9.196 Chr9 (355156..355920) [765 bp, 254 aa] {ON} YIR018W
          (REAL)
          Length = 254

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%)

Query: 24 KRTAQNRAAQRAFRERKEAKLRALEETIVVL 54
          K+  QNR AQRA+RERK  KL+ LE+TI  L
Sbjct: 69 KKKRQNRDAQRAYRERKNNKLQVLEDTIESL 99

>ZYRO0G04246g Chr7 (340188..341492) [1305 bp, 434 aa] {ON} similar
           to uniprot|P40574 Saccharomyces cerevisiae YIR018W YAP5
           bZIP transcription factor
          Length = 434

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 7/67 (10%)

Query: 20  EAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELLTEV 79
           E + K+  QNR AQRA+RER+  +L+ LE+T+      N+ +N+   + + C+ +L  E+
Sbjct: 66  EDETKKKKQNRDAQRAYRERRANRLQELEDTV------NTLRNAMKNWKRRCM-DLEAEL 118

Query: 80  TKYRPAN 86
              R  N
Sbjct: 119 QDARKDN 125

>Skud_15.126 Chr15 complement(228637..230184) [1548 bp, 515 aa] {ON}
           YOL028C (REAL)
          Length = 515

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 25/34 (73%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETIVVLKGM 57
           KR  QNR AQRA+RER+  +++ LEE + +L+ +
Sbjct: 127 KRRKQNRDAQRAYRERRTTRIQVLEEKVEMLQNL 160

>TPHA0H02480 Chr8 (584363..585436) [1074 bp, 357 aa] {ON} Anc_7.115
           YIR018W
          Length = 357

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%), Gaps = 1/40 (2%)

Query: 16  IIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLK 55
           I DTE K KR   NR AQRAFRERK  ++  L++TI  L+
Sbjct: 78  IDDTELKRKRKL-NREAQRAFRERKSLRMEQLKDTIERLQ 116

>Kpol_495.17 s495 complement(40123..41583) [1461 bp, 486 aa] {ON}
           complement(40123..41583) [1461 nt, 487 aa]
          Length = 486

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 4/38 (10%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALE 48
           K+G+ + +T    KR AQNR AQ+AFR+RKE  ++ LE
Sbjct: 417 KSGKPLRNT----KRAAQNRNAQKAFRQRKEKYIKDLE 450

>Smik_15.136 Chr15 complement(235956..237509) [1554 bp, 517 aa] {ON}
           YOL028C (REAL)
          Length = 517

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1   MSKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGM 57
           + K   EG        +D+  K +R  QNR AQRA+RER+  +++ LEE + +L  +
Sbjct: 109 LGKFDDEGNASGEENGVDSVEKRRR--QNRDAQRAYRERRTTRIQVLEEKVEMLHNL 163

>Skud_15.193 Chr15 complement(343322..344191) [870 bp, 289 aa] {ON}
           YOR028C (REAL)
          Length = 289

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 28/39 (71%), Gaps = 4/39 (10%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEE 49
           K G+ + +T    KR AQNR+AQ+AFR+R+E  ++ LEE
Sbjct: 227 KTGKLLRNT----KRAAQNRSAQKAFRKRREKYIKDLEE 261

>NCAS0A08030 Chr1 (1586013..1586612) [600 bp, 199 aa] {ON} Anc_5.619
          Length = 199

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 3/54 (5%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETIV---VLKGMNSKKNSETEYLKECLSE 74
           KR AQNR AQ+A+RER++ +++ LE+      +LK  N     + E LK  L+E
Sbjct: 143 KRAAQNRNAQKAYRERRDKRIKELEDIAAQFEILKQENLVLRDQVESLKRKLAE 196

>KLLA0D14399g Chr4 (1224490..1226067) [1578 bp, 525 aa] {ON} some
           similarities with uniprot|P40574 Saccharomyces
           cerevisiae YIR018W YAP5 bZIP transcription factor
          Length = 525

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (68%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETIVVLK 55
           KR  QNR AQRA+RERK  KL  L+ TI + +
Sbjct: 144 KRRKQNREAQRAYRERKANKLHELQHTIDMWR 175

>KLLA0B13695g Chr2 complement(1199239..1200366) [1128 bp, 375 aa]
           {ON} some similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 375

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 1/39 (2%)

Query: 13  GRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETI 51
           G K  + + + KR A NRAAQ+AFRERKEA+++ LE+ +
Sbjct: 178 GAKDSEEQIRRKR-ALNRAAQKAFRERKEARVKQLEKQL 215

>Suva_2.425 Chr2 complement(754245..755399) [1155 bp, 384 aa] {ON}
           YDR259C (REAL)
          Length = 384

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 21/26 (80%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEE 49
           +R AQNR AQ+AFR+RKE  ++ LE+
Sbjct: 220 RRAAQNRTAQKAFRQRKEKYIKTLEQ 245

>KNAG0D04590 Chr4 (830774..831556) [783 bp, 260 aa] {ON} Anc_7.115
           YIR018W
          Length = 260

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 27/37 (72%)

Query: 19  TEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLK 55
           T  ++KR  QNR AQRA+RER+  +L+ LE+T+  L+
Sbjct: 71  TGLESKRQVQNREAQRAYRERRAHRLQELEDTVEQLQ 107

>YOL028C Chr15 complement(270633..271370) [738 bp, 245 aa] {ON}
           YAP7Putative basic leucine zipper (bZIP) transcription
           factor
          Length = 245

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (70%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETIVVLKGM 57
           KR  QNR AQRA+RER+  +++ LEE + +L  +
Sbjct: 130 KRRRQNRDAQRAYRERRTTRIQVLEEKVEMLHNL 163

>TDEL0A05190 Chr1 (921017..921838) [822 bp, 273 aa] {ON} Anc_2.493
           YHL009C
          Length = 273

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 21/23 (91%)

Query: 20  EAKNKRTAQNRAAQRAFRERKEA 42
           +AK ++ AQNRAAQ+AFRER+EA
Sbjct: 97  DAKERKKAQNRAAQKAFRERREA 119

>NDAI0A08400 Chr1 (1935415..1936584) [1170 bp, 389 aa] {ON}
          Anc_7.115 YIR018W
          Length = 389

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 20 EAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGM 57
          E+  KR  QNR AQRA+RER   K++ LE+++  L+ +
Sbjct: 57 ESSAKRRKQNRDAQRAYRERNANKIQVLEKSVESLQML 94

>Skud_13.6 Chr13 (6426..7358) [933 bp, 310 aa] {ON} YPR199C (REAL)
          Length = 310

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 43/85 (50%), Gaps = 17/85 (20%)

Query: 4  VSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAF----------RERKEAKLRALEETIVV 53
          +SK   +K GRK   T  K+KRTAQ RA+Q AF           E+KEA+L+   + I V
Sbjct: 17 MSKPRGRKGGRKPSFTPPKDKRTAQLRASQNAFRKRKLERLEELEKKEAQLKVRNDQIHV 76

Query: 54 LKGMNSKKNSETEYLKECLSELLTE 78
          LK        E E L   L  LLTE
Sbjct: 77 LK-------KENELLNVMLGSLLTE 94

>YDR259C Chr4 complement(974631..975782) [1152 bp, 383 aa] {ON}
           YAP6Basic leucine zipper (bZIP) transcription factor;
           physically interacts with the Tup1-Cyc8 complex and
           recruits Tup1p to its targets; overexpression increases
           sodium and lithium tolerance; computational analysis
           suggests a role in regulation of expression of genes
           involved in carbohydrate metabolism
          Length = 383

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 21/26 (80%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEE 49
           +R AQNR AQ+AFR+RKE  ++ LE+
Sbjct: 226 RRAAQNRTAQKAFRQRKEKYIKNLEQ 251

>Skud_4.521 Chr4 complement(929170..930309) [1140 bp, 379 aa] {ON}
           YDR259C (REAL)
          Length = 379

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 21/26 (80%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEE 49
           +R AQNR AQ+AFR+RKE  ++ LE+
Sbjct: 222 RRAAQNRTAQKAFRQRKEKYIKNLEQ 247

>SAKL0G07128g Chr7 complement(585312..586133) [822 bp, 273 aa] {ON}
           some similarities with uniprot|P40917 Saccharomyces
           cerevisiae YOR028C CIN5 Basic leucine zipper
           transcriptional factor of the yAP-1 family that mediates
           pleiotropic drug resistance and salt tolerance localizes
           constitutively to the nucleus and some similarities with
           uniprot|Q03935 Saccharomyces cerevisiae YDR259C YAP6
           Basic leucine zipper (bZIP) transcription factor
          Length = 273

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKN---SETEY 67
           K+G+ + +T    KR AQNR AQ+AFR+R+E  ++ LE        M S+      E E 
Sbjct: 193 KSGKPLRNT----KRAAQNRNAQKAFRQRRERYIKDLENKAKDYDRMASEYGILQRENEA 248

Query: 68  LKECLSELLTEVT 80
           L+  +++L   +T
Sbjct: 249 LQNYVAKLQKRIT 261

>KAFR0H00580 Chr8 (106485..107945) [1461 bp, 486 aa] {ON} Anc_5.619
           YOR028C
          Length = 486

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALE 48
           K  RK + T   +KR  QNR AQ+AFR RKE  ++ LE
Sbjct: 401 KRTRKKVKTLRDSKRAVQNRNAQKAFRLRKERYIKLLE 438

>Smik_4.506 Chr4 complement(919548..920687) [1140 bp, 379 aa] {ON}
           YDR259C (REAL)
          Length = 379

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 21/26 (80%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEE 49
           +R AQNR AQ+AFR+RKE  ++ LE+
Sbjct: 222 RRAAQNRTAQKAFRQRKEKYIKNLEQ 247

>NCAS0G00800 Chr7 (137289..138113) [825 bp, 274 aa] {ON} Anc_5.619
          Length = 274

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (71%), Gaps = 4/39 (10%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEE 49
           K+G+ + +T    +R AQNR AQ+AFR+R+E  ++ LEE
Sbjct: 212 KSGKLLRNT----RRAAQNRNAQKAFRKRREQYIKNLEE 246

>Ecym_8354 Chr8 (708203..709612) [1410 bp, 469 aa] {ON} similar to
           KLTH0F12496g - Lachancea thermotolerans
          Length = 469

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 25/36 (69%), Gaps = 2/36 (5%)

Query: 17  IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIV 52
           +DT A+ KR  QNR AQRA+RERK  ++  LE  +V
Sbjct: 86  VDTGARRKR--QNREAQRAYRERKANRILELERLMV 119

>Ecym_5580 Chr5 (1191145..1192032) [888 bp, 295 aa] {ON} similar to
           Ashbya gossypii AEL222C
          Length = 295

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALE 48
           KR AQNR+AQ+AFR+R+E  ++ LE
Sbjct: 237 KRAAQNRSAQKAFRQRREKYIKDLE 261

>NDAI0F00900 Chr6 (221309..222664) [1356 bp, 451 aa] {ON} Anc_5.619
          Length = 451

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 5/66 (7%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70
           K+G+ + +T    KR AQNR AQ+AFR+R+E  ++ LE    +   +  K+N + + L +
Sbjct: 361 KSGKLLRNT----KRAAQNRNAQKAFRQRRELYIKDLETKAKIFDSI-KKENEDLKTLVD 415

Query: 71  CLSELL 76
            L + L
Sbjct: 416 FLKKKL 421

>SAKL0F05434g Chr6 (420136..421518) [1383 bp, 460 aa] {ON} some
           similarities with uniprot|Q08187 Saccharomyces
           cerevisiae YOL029C Hypothetical ORF
          Length = 460

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSK 60
           KR  QNR AQRA+RER+  +L+ L++ +   K   SK
Sbjct: 72  KRKQQNREAQRAYRERRANRLQELQDVVSTWKEKCSK 108

>NDAI0H01490 Chr8 complement(359826..361160) [1335 bp, 444 aa] {ON}
           Anc_7.115 YIR018W
          Length = 444

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 27/38 (71%)

Query: 18  DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLK 55
           + E + K+  QNR AQRA+RERK  +++ LE+T+  L+
Sbjct: 74  ENEDEMKKKIQNRDAQRAYRERKANRMKNLEDTVDSLQ 111

>AEL222C Chr5 complement(213737..214441) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR028C
           (CIN5) and YDR259C (YAP6)
          Length = 234

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALE 48
           KR AQNR+AQ+AFR+R+E  ++ LE
Sbjct: 176 KRAAQNRSAQKAFRQRREKYIKDLE 200

>Kpol_473.19 s473 complement(54667..55518) [852 bp, 283 aa] {ON}
           complement(54667..55518) [852 nt, 284 aa]
          Length = 283

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 2   SKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALE 48
           S +S   +    R I  ++  +KR  QNR AQ+AFRERK+  ++ LE
Sbjct: 195 SPISVIDRPTVNRGIQKSKNASKRAIQNRNAQKAFRERKKLYIQELE 241

>Kwal_55.19947 s55 complement(188372..189328) [957 bp, 318 aa] {ON}
           YOR028C (CIN5) - bZIP protein, can activate
           transcription from a promoter containing a Yap
           recognition site [contig 159] FULL
          Length = 318

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 7/79 (8%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNS---ETEY 67
           K+G+ + +T    KR AQNR AQ+AFR+R+E  ++ LE        ++++  +   E E 
Sbjct: 224 KSGKPLRNT----KRAAQNRNAQKAFRQRRERYIKELETKAKEYDRIDAQAAALAQENES 279

Query: 68  LKECLSELLTEVTKYRPAN 86
           LK  + EL  ++   R A+
Sbjct: 280 LKRYILELEQQLGVRRAAS 298

>TBLA0J00790 Chr10 complement(180203..180961) [759 bp, 252 aa] {ON}
           Anc_5.619 YOR028C
          Length = 252

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 11/67 (16%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETI-----VVLKGMNSKKNSET 65
           K+G+ + +T    KR AQNR AQ+AFR R+E  ++ LE        ++++  N KK  E 
Sbjct: 175 KSGKVLRNT----KRAAQNRNAQKAFRLRREKYIKDLELKATKFDSLIIENNNLKK--EI 228

Query: 66  EYLKECL 72
           E LK+ L
Sbjct: 229 ESLKQQL 235

>KLTH0E02222g Chr5 complement(199706..200500) [795 bp, 264 aa] {ON}
           conserved hypothetical protein
          Length = 264

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 7/68 (10%)

Query: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNS---ETEY 67
           K+G+ + +T    KR AQNR AQ+AFR+R+E  ++ LE        M+++  +   E E 
Sbjct: 174 KSGKPLRNT----KRAAQNRNAQKAFRQRRERYIKDLEVKAKEYDRMDAQTAALVQENES 229

Query: 68  LKECLSEL 75
           LK  + EL
Sbjct: 230 LKRYVLEL 237

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
          ARR1Transcriptional activator of the basic leucine
          zipper (bZIP) family, required for transcription of
          genes involved in resistance to arsenic compounds
          Length = 294

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 48/96 (50%), Gaps = 19/96 (19%)

Query: 4  VSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAF----------RERKEAKLRALEETIVV 53
          ++K   +K GRK   T  KNKR AQ RA+Q AF           E+KEA+L    + I +
Sbjct: 1  MAKPRGRKGGRKPSLTPPKNKRAAQLRASQNAFRKRKLERLEELEKKEAQLTVTNDQIHI 60

Query: 54 LKGMNSKKNSETEYLKECLSELLTEVTKYRPANEKD 89
          LK        E E L   L  LLTE  +  P++E++
Sbjct: 61 LK-------KENELLHFMLRSLLTE--RNMPSDERN 87

>TBLA0J01940 Chr10 complement(462906..464825) [1920 bp, 639 aa] {ON}
           Anc_7.115 YIR018W
          Length = 639

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%)

Query: 8   GKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALE 48
           G K+  R+    E   K+  QNR AQRA+RER+  K++ LE
Sbjct: 80  GTKRNSREADLIELIEKKKRQNREAQRAYRERRANKIQELE 120

>TBLA0A04860 Chr1 complement(1196402..1197277) [876 bp, 291 aa]
          {ON} Anc_7.115 YIR018W
          Length = 291

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 17 IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGM 57
          +D+E K +R   NR AQRAFRER   ++  LE+T+  L+ +
Sbjct: 58 LDSEKKKQR---NRDAQRAFRERNANRVTQLEQTVESLQNL 95

>TPHA0I02050 Chr9 complement(458058..458984) [927 bp, 308 aa] {ON}
          Anc_7.115 YIR018W
          Length = 308

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 20 EAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLK 55
          E K ++  QNR AQRAFRERK +++  L + +  LK
Sbjct: 30 EMKARKLLQNRKAQRAFRERKTSRISELADEVGSLK 65

>NCAS0F01000 Chr6 complement(199877..201046) [1170 bp, 389 aa] {ON}
           Anc_7.115 YIR018W
          Length = 389

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSK---KNSETE 66
           ++  QNR AQRA+RER+  KL+ LE+ +  L+ +  K   K  ETE
Sbjct: 103 RKKIQNRDAQRAYRERRANKLKVLEDAVDSLQQLVKKWQRKYKETE 148

>KNAG0C06210 Chr3 complement(1205132..1206274) [1143 bp, 380 aa]
           {ON} Anc_5.619 YOR028C
          Length = 380

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALEE 49
           KR  QNR AQ+AFR RKE  +R LE+
Sbjct: 306 KRAVQNRNAQKAFRLRKEKYMRLLED 331

>Kpol_1023.105 s1023 complement(248166..249356) [1191 bp, 396 aa]
           {ON} complement(248166..249356) [1191 nt, 397 aa]
          Length = 396

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 18  DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVL 54
           D + K ++  QNR AQRA+RER+  ++  LE  +  L
Sbjct: 71  DVDMKERKRVQNREAQRAYRERQSKRIFELETNVNFL 107

>NCAS0I00630 Chr9 complement(104540..105604) [1065 bp, 354 aa] {ON}
           Anc_7.115 YIR018W
          Length = 354

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 23/30 (76%)

Query: 28  QNRAAQRAFRERKEAKLRALEETIVVLKGM 57
           QNR AQRA+RERK  +++ LE+++  L+ +
Sbjct: 89  QNRDAQRAYRERKANRIQVLEKSVENLQTL 118

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 206 FDQDSKLSNLMNDQSFYPFDNISFGNSPVITNNWGENDMVAKQAGLESFNFAISN-SNST 264
           F  DS  S   N+ +FY    I +G+S      WG +++  +   L   + A++N SNST
Sbjct: 194 FATDSSSSFQSNNTAFY----IEYGDSTYALGTWGRDNVTLQDITLSGISMAVANESNST 249

Query: 265 FGL 267
           FG+
Sbjct: 250 FGV 252

>TPHA0D02900 Chr4 complement(604522..605304) [783 bp, 260 aa] {ON}
           Anc_5.619 YOR028C
          Length = 260

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%)

Query: 24  KRTAQNRAAQRAFRERKEAKLRALE 48
           KR  QNR AQ+AFR+RK+  ++ LE
Sbjct: 205 KRAIQNRNAQKAFRQRKKKYIQELE 229

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 206 FDQDSKLSNLMNDQSFYPFDNISFGNSPVITNNWGENDMVAKQAGLESFNFAISN-SNST 264
           FD D   S   ND SF     I++G+      NWG++ +  +   +   +FA++N +NST
Sbjct: 148 FDIDDSSSFTSNDTSF----AITYGDGSYALGNWGQDVLSLQDIDVTGLSFAVANYTNST 203

Query: 265 FGL 267
            G+
Sbjct: 204 VGV 206

>KLLA0F08976g Chr6 complement(833390..834211) [822 bp, 273 aa] {ON}
           some similarities with uniprot|P41546 Saccharomyces
           cerevisiae YFL031W HAC1 bZIP transcription factor
           (ATF/CREB1 homolog) that regulates the unfolded protein
           response
          Length = 273

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 26/127 (20%)

Query: 3   KVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKN 62
           K +K  ++K  R+I       +R  +NR A    RE+K   ++ LEE   +L+G+     
Sbjct: 22  KRAKTQEEKEQRRI-------ERILRNRRAAHQSREKKRLHVQRLEEKCHLLEGI----- 69

Query: 63  SETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEIKADDLKSVEVVPEQPSATNFMNS 122
                LK    ++L+E       N K  G++++ +E++  D  S+       S T  ++S
Sbjct: 70  -----LKMVDLDILSE------NNAKLSGMVEQWREMQVSDSGSIS---SHDSNTGMLDS 115

Query: 123 PTNITTA 129
           P ++T++
Sbjct: 116 PESLTSS 122

>Skud_4.699 Chr4 complement(1239478..1239576,1239580..1239648)
          [168 bp, 56 aa] {OFF} YDR423C (HSP)
          Length = 56

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 1/32 (3%)

Query: 13 GRKIIDTEAKNKRTAQNRAAQRAFRERKEAKL 44
          G+K I+ E  NKRTAQ RAA RAF  +K +++
Sbjct: 15 GKKNINAEP-NKRTAQIRAAPRAFSRQKSSQV 45

>NCAS0A12530 Chr1 (2472725..2473639) [915 bp, 304 aa] {ON} 
          Length = 304

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 16/18 (88%)

Query: 22  KNKRTAQNRAAQRAFRER 39
           K K+ AQNRAAQ+AFRER
Sbjct: 105 KAKKKAQNRAAQKAFRER 122

>Kwal_55.20824 s55 complement(574796..575548) [753 bp, 250 aa]
          {ON} [contig 138] FULL
          Length = 250

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 25 RTAQNRAAQRAFRERKEAKLRALEETI 51
          R  +NR AQRAFRER+  +++ L E +
Sbjct: 61 RKVRNREAQRAFRERQAGQIKILREEV 87

>KLTH0F12496g Chr6 complement(1047883..1048668) [786 bp, 261 aa]
           {ON} some similarities with uniprot|P40574 Saccharomyces
           cerevisiae YIR018W YAP5 bZIP transcription
          Length = 261

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 23  NKRTAQNRAAQRAFRERKEAKLRALEETI 51
           + R A+NR AQRA+RER+   ++ L++ +
Sbjct: 74  DSRKAKNREAQRAYRERQAGHIKELQDLV 102

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 7/86 (8%)

Query: 183 VINDLQRTAANRLESTGSWMDSIFDQDSKLSNLMNDQSFYP--FDNI-SFGNSPVITNNW 239
           V++++QRT     +  GS   ++ +QD  + +   ++ + P  FD   +FGN P + N+ 
Sbjct: 497 VLDNIQRTVVTWRDMDGSGFLAV-NQD--VGDYTTNEDYIPTMFDKTRNFGNKPQV-NSA 552

Query: 240 GENDMVAKQAGLESFNFAISNSNSTF 265
            E   ++K  GLESF   +SNSN ++
Sbjct: 553 QEVHSLSKGKGLESFKKNLSNSNLSY 578

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,099,414
Number of extensions: 2041126
Number of successful extensions: 7234
Number of sequences better than 10.0: 193
Number of HSP's gapped: 7525
Number of HSP's successfully gapped: 220
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)