Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0F03047g5.527ON74474437240.0
NCAS0F010905.527ON7878049951e-123
Skud_4.6965.527ON8117889581e-117
NDAI0H016005.527ON8428309391e-114
Smik_4.6975.527ON8178089221e-112
YDR422C (SIP1)5.527ON8158009091e-110
TDEL0A039105.527ON7495548721e-105
Suva_2.5995.527ON8278318711e-104
ZYRO0D12562g5.527ON8183998188e-97
SAKL0G04928g5.527ON8924067983e-93
KNAG0C032305.527ON5615777231e-85
Kwal_47.186425.527ON3093416827e-83
KLTH0G03762g5.527ON7094017033e-81
TBLA0D016505.527ON10164027141e-80
ADR194C5.527ON6373886633e-76
Ecym_40655.527ON7213966684e-76
KAFR0E033005.527ON4663895682e-64
Kpol_1004.215.527ON7554015624e-61
Kpol_1023.985.527ON6674055073e-54
TPHA0K005305.527ON6461662475e-21
KNAG0B036905.527ON3261401552e-10
CAGL0A03696g3.517ON4151701351e-07
KNAG0E015903.517ON4231461242e-06
NCAS0E006203.517ON500401233e-06
NDAI0I028903.517ON582401234e-06
ZYRO0E08404g3.517ON348431215e-06
TBLA0I032703.517ON433411216e-06
KLLA0B00583g3.517ON486411216e-06
YGL208W (SIP2)3.517ON415561217e-06
Kwal_47.190403.517ON429411217e-06
KAFR0I023803.517ON409761208e-06
Ecym_12103.517ON450411209e-06
TDEL0D058503.517ON404411199e-06
Smik_5.1503.517ON417611172e-05
NCAS0F037303.517ON4321521172e-05
KNAG0B006003.517ON389521162e-05
SAKL0F02002g3.517ON503411163e-05
Skud_5.1363.517ON418401153e-05
Kpol_195.23.517ON4351591153e-05
Skud_7.603.517ON441761153e-05
Suva_5.1233.517ON423401153e-05
YER027C (GAL83)3.517ON417401153e-05
NDAI0B060103.517ON503561154e-05
Smik_7.553.517ON415491144e-05
TPHA0A058103.517ON424411136e-05
AER361C3.517ON475761136e-05
KAFR0F041403.517ON348771101e-04
Suva_7.533.517ON414761101e-04
KLTH0G01848g3.517ON416761082e-04
CAGL0K09350g3.517ON432751064e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F03047g
         (744 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...  1439   0.0  
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   387   e-123
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   373   e-117
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   366   e-114
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   359   e-112
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   354   e-110
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   340   e-105
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   340   e-104
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   319   8e-97
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   311   3e-93
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   283   1e-85
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   267   7e-83
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   275   3e-81
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   279   1e-80
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   259   3e-76
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   261   4e-76
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   223   2e-64
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   221   4e-61
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   199   3e-54
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   100   5e-21
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    64   2e-10
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    57   1e-07
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    52   2e-06
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     52   3e-06
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    52   4e-06
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    51   5e-06
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    51   6e-06
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    51   6e-06
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    51   7e-06
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    51   7e-06
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    51   8e-06
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    51   9e-06
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    50   9e-06
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    50   2e-05
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    50   2e-05
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    49   2e-05
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    49   3e-05
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    49   3e-05
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    49   3e-05
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    49   3e-05
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    49   3e-05
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    49   3e-05
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    49   4e-05
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    49   4e-05
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    48   6e-05
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    48   6e-05
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    47   1e-04
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    47   1e-04
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    46   2e-04
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    45   4e-04

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score = 1439 bits (3724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/744 (94%), Positives = 702/744 (94%)

Query: 1   MHSLFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGSALHISSPGPSNATVQTIKR 60
           MHSLFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGSALHISSPGPSNATVQTIKR
Sbjct: 1   MHSLFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGSALHISSPGPSNATVQTIKR 60

Query: 61  EVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVXXXXXXKRKNLPFRTINNV 120
           EVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEV      KRKNLPFRTINNV
Sbjct: 61  EVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVAEAAAAKRKNLPFRTINNV 120

Query: 121 MDXXXXXXXXXXDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVNSKPYLYNYEPSX 180
           MD          DEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVNSKPYLYNYEPS 
Sbjct: 121 MDSQRSSISSSRDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVNSKPYLYNYEPSG 180

Query: 181 XXXXXXXXXMLQGTDVVLNQELLEQALKRDMKRKRADTMQSSTVELNKKVDTNTSKNSNH 240
                    MLQGTDVVLNQELLEQALKRDMKRKRADTMQSSTVELNKKVDTNTSKNSNH
Sbjct: 181 VPVGDPDGGMLQGTDVVLNQELLEQALKRDMKRKRADTMQSSTVELNKKVDTNTSKNSNH 240

Query: 241 TEIMKNXXXXXXXXXXXXXXXXRLYGDRTLLNQQITKQKEDENKYSHTITNAAYKKLKPF 300
           TEIMKN                RLYGDRTLLNQQITKQKEDENKYSHTITNAAYKKLKPF
Sbjct: 241 TEIMKNPPETAEPTSATAAMMMRLYGDRTLLNQQITKQKEDENKYSHTITNAAYKKLKPF 300

Query: 301 SGVKRKILSNPNLNLQPLEPIRPNEPPTSGQRTPNNSAHVHSESPSPDRTNVILKWRDSQ 360
           SGVKRKILSNPNLNLQPLEPIRPNEPPTSGQRTPNNSAHVHSESPSPDRTNVILKWRDSQ
Sbjct: 301 SGVKRKILSNPNLNLQPLEPIRPNEPPTSGQRTPNNSAHVHSESPSPDRTNVILKWRDSQ 360

Query: 361 NQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSHNNEWYVPDL 420
           NQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSHNNEWYVPDL
Sbjct: 361 NQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSHNNEWYVPDL 420

Query: 421 YLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYT 480
           YLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYT
Sbjct: 421 YLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYT 480

Query: 481 SSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSSYYSAKSFEK 540
           SSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSSYYSAKSFEK
Sbjct: 481 SSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSSYYSAKSFEK 540

Query: 541 SITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSNNIPALFRISCD 600
           SITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSNNIPALFRISCD
Sbjct: 541 SITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSNNIPALFRISCD 600

Query: 601 MEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGKMDAEEAENLFLKKYQV 660
           MEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGKMDAEEAENLFLKKYQV
Sbjct: 601 MEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGKMDAEEAENLFLKKYQV 660

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPHVNLKHLLTSSIRDGIVSVACTT 720
           PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPHVNLKHLLTSSIRDGIVSVACTT
Sbjct: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPHVNLKHLLTSSIRDGIVSVACTT 720

Query: 721 RYAGKFITQVIYAPCGNDQLESKE 744
           RYAGKFITQVIYAPCGNDQLESKE
Sbjct: 721 RYAGKFITQVIYAPCGNDQLESKE 744

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  387 bits (995), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 292/804 (36%), Positives = 408/804 (50%), Gaps = 167/804 (20%)

Query: 4   LFKEDYSVTK----------EASEPEADESIDVNMAGLSLTSSMGDG---SALHISSPGP 50
            FK+ YS+++          E       E+I   MA LSL +SM +     +    SPGP
Sbjct: 85  FFKKGYSISRSMQDDSDIKTEGQATVDSENIHEPMASLSLKTSMENDENRKSFSFMSPGP 144

Query: 51  SNATVQTIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVXXXXXXKRK 110
           +N TV+  K +VT+ + S                 EHRPSIV LK +L            
Sbjct: 145 ANPTVEQTKHDVTNKENS----------------FEHRPSIVTLKQTLSGTKVTND---- 184

Query: 111 NLPFRTINNVMDXXXXXXXXXXDEIFVDASPSPVVTRTASIDIPRS-------------- 156
                  NN+             +    AS S +  RT SIDIP+               
Sbjct: 185 -------NNIDKLNKTISSSSNSQSVSTASSSSIANRTGSIDIPKENRYNFKDAMDTIPK 237

Query: 157 ----------------EDGRRSSN-RLVNSKPYLYNYEPSXXXXXXXXXXMLQGTDVVLN 199
                           E+ R  S+ RL  S     N EP           +LQ  D+VLN
Sbjct: 238 QHSVHAYQHDYFTINDENARNGSDGRLSTSGD---NSEPG----------VLQNVDIVLN 284

Query: 200 QELLEQALKRDMKRKRADTMQSS-TVELNKKVDTNTSKNSNHTEIMKNXXXXXXXXXXXX 258
           Q  L+ A+KRDMKRKR DT  S+ T ++ K  +     ++    ++K             
Sbjct: 285 QSFLKDAMKRDMKRKRTDTGASTATPDIEKPTEKKKPISATAAMMLK------------- 331

Query: 259 XXXXRLYGDRTLLNQQITKQKED---ENKYSHTITNAAYKKLKPFSGVKRKI------LS 309
                LYGD+  + ++  K        ++Y H+ +    +++K    ++         +S
Sbjct: 332 -----LYGDKNQMEKEEKKSSGSYSYADQYEHSTSQINLREVKKIKHIENDFVEDNFGIS 386

Query: 310 NPN-LNLQPLEPIRPNEPPTSGQRTPNNSAHVHSESPSPDRTNVILKWRDSQNQSNNKEL 368
           +P  + +Q ++ ++   P +      ++S    S+  + D   V+LKWRD  +  N K  
Sbjct: 387 SPKEIKIQHIDDVKNAPPSSLSSSMSSSSFGPSSDEQTNDNVQVVLKWRDQID--NPKHC 444

Query: 369 KVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSHNNEWYVPDLYLPQGIYR 428
           K+ +VS++I +++                 ++  K+P+ ++    EWYVP+L LP GIYR
Sbjct: 445 KISIVSDDISSAI-------------PAKATKAGKLPMLFNPMIKEWYVPNLLLPPGIYR 491

Query: 429 LQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYTSSVDTTLE 488
           L+F +NG+L HS+FLPTATD  GNI+NWFEVL GYD +EPYRDE          ++TT  
Sbjct: 492 LKFSINGDLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRDE---------IIETTF- 541

Query: 489 GMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSSYYSAKSFEKSITQFSDY 548
               NG QG       ++R+NNP  +          ++ R+SS+ SA     S+T +SDY
Sbjct: 542 --HTNGSQG-------TLRDNNPTTI----------RSRRSSSFVSANGDLASMTPYSDY 582

Query: 549 TGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSNNIPALFRISCDMEDVDDDN 608
           TG+SR+NS +++      +      L+ F P++PK  EYSN IP LF+IS  +ED DDD 
Sbjct: 583 TGISRSNSALNSKRTSLVSLRGVGKLDLFTPMEPKKIEYSNEIPELFKISNSIEDEDDDE 642

Query: 609 GT--ENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGKMDAEEAENLFLKKYQVPDLPVY 666
           G    N   + ++ PSFTNRVVDCNQD LF DLQK G +DAE AE LFL KYQVPDLP+Y
Sbjct: 643 GDYGHNETLSPFEEPSFTNRVVDCNQDKLFSDLQKNGNIDAETAEMLFLNKYQVPDLPIY 702

Query: 667 LNSTYLNKIFHEF---HQVAGPSTQDSS---INHIIPHVNLKHLLTSSIRDGIVSVACTT 720
           LNS+YLNKIF +F   H    PS   +S   I HIIPHVNL HLLTSSIRD I+SVACTT
Sbjct: 703 LNSSYLNKIFLQFQKQHNDPTPSANTASTIGITHIIPHVNLNHLLTSSIRDEIISVACTT 762

Query: 721 RYAGKFITQVIYAPC--GNDQLES 742
           RY GKFITQV+YAPC  GN +++S
Sbjct: 763 RYQGKFITQVMYAPCNYGNPEIKS 786

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score =  373 bits (958), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 290/788 (36%), Positives = 402/788 (51%), Gaps = 136/788 (17%)

Query: 4   LFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGSALH-------ISSPGPSNATVQ 56
           LFK+DYS+   A E       D  +A LSL     DGSA           SPGPS ATV+
Sbjct: 93  LFKKDYSLANAADEN------DTTLANLSLNDDH-DGSAPEEQVKSPSFLSPGPSMATVK 145

Query: 57  TIKREV--------THGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVXXXXXXK 108
             K ++        T  DE+ + +    +  H R    HR SI+ALK +L E        
Sbjct: 146 QTKSDLDDLSTVNCTVVDETMENERSG-HPHHER----HRSSIIALKKTLMENSATASPS 200

Query: 109 RKNLPFRTINNVMDXXXXXXXXXXDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVN 168
               P R+ +                  V ++  P +T+T SIDIP     +++ ++  +
Sbjct: 201 ----PTRSSS------------------VHSASLPPLTKTGSIDIPV----KQTYSKKPS 234

Query: 169 SKPYLYNY--------------EPSXXXXXXXXXXMLQGTDVVLNQELLEQALKRDMKR- 213
              Y Y Y              + +          +LQ  D+VLNQ LL+ ALK+DM+R 
Sbjct: 235 VHAYQYQYLSPDPTFSGNSHTGKEANGDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRL 294

Query: 214 KRADTMQSS-TVELNKKVDTNTSKNSNHTEIMKNXXXXXXXXXXXXXXXXRLYGDRTL-- 270
            RA++  S+ T+    +++ + S        +                  +LYGD+TL  
Sbjct: 295 SRANSSNSTYTMGRENRINNSESNIDGKENSIDPSDDSTVPISATAKMMMKLYGDKTLME 354

Query: 271 --LNQQITKQKEDENKYSHTITNAAYKKLKPFSGV--KRKILSNPNLNLQPLEPIRP--- 323
             LN+   K K+ +NK   + +N+          +  K+ IL+N  LNLQPL P+ P   
Sbjct: 355 RDLNKHQNKTKKAQNKKLRSASNSRRSSFASLHSLQSKKSILTN-GLNLQPLHPLHPIIN 413

Query: 324 -NEPPTSGQR--------TPNNSAHVHSESPSPDRTNVILKWRDSQNQSNNKELKVYLVS 374
            NE   S  +           +S    S + S + T V+LKW+   N +   E  V +VS
Sbjct: 414 DNESQYSAPQHREISHHSNSISSMSSISSTNSTENTLVVLKWKSDTNMTATTE--VSIVS 471

Query: 375 NEICASLKNDDKL-FAEGKLLATDNSQFNKIPLSYDSHNNEWYVPDLYLPQGIYRLQFLV 433
           N+I ++LK   ++   +   L ++    ++I + YDS + EW+VPDL+LP GIYRLQF +
Sbjct: 472 NDIASALKEQREVNLDDDASLDSEKPLNSRIRMIYDSVHREWFVPDLFLPAGIYRLQFSI 531

Query: 434 NGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYTSSVDTTLEGMENN 493
           NG L HS+FLPTATD +GN +NWFEVL GY  IEP+RDE+++     S++D         
Sbjct: 532 NGLLTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRDEADMDFQMRSTLD--------- 582

Query: 494 GFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSSYYSAKSFEKSITQFSDYTGVSR 553
                            P+      P P +  +SR SSYYSAK  E+  T FSDY G+SR
Sbjct: 583 --------------EEAPIR-----PEPKRLSSSRKSSYYSAKDGERPGTPFSDYRGLSR 623

Query: 554 TNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSNNIPALFRISCDMEDVDDDNGTENN 613
           +NS+    S +     + + L+    IKP+  EYSN IP LF I         D+    +
Sbjct: 624 SNSVFLRGSFVR---LKASSLDLMAEIKPEKLEYSNEIPNLFNIGEASTTTSKDHFERLS 680

Query: 614 PRAFYDRPSFTNRVVDCNQDALFGDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLN 673
           P+   DRPSFT++VVDCNQD LF  LQ+GG +DAE AE +FL +Y +PDLP+YLNS+YLN
Sbjct: 681 PQ---DRPSFTHKVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPIPDLPIYLNSSYLN 737

Query: 674 KIFH------EFHQVAGPSTQDSSINHIIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFI 727
           +I +      EFH        +  INHIIPHVNL HLLTSSIRD I+SVACTTRY GKFI
Sbjct: 738 RILNQSNPNSEFHD-----GDEGGINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFI 792

Query: 728 TQVIYAPC 735
           TQVIYAPC
Sbjct: 793 TQVIYAPC 800

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  366 bits (939), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 281/830 (33%), Positives = 413/830 (49%), Gaps = 153/830 (18%)

Query: 2   HSLFKEDYSVTKEASEPEA-------DESIDVNMAGLSLTSSMGD--GSALHISSPGPSN 52
           H++FK+DYS+ +  +           DE+I   MA LSL +S  +    ++  + PGPS 
Sbjct: 75  HNVFKKDYSMDEPLTNKGGIKNNDFNDENIHETMASLSLVTSSDNERKKSMSFARPGPST 134

Query: 53  ATVQTIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVXXXXXXKRKNL 112
            TVQ  K ++T  + S   ++   N   +  ++ HRPSIVALK +L E            
Sbjct: 135 PTVQPTKHDITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAE------------ 182

Query: 113 PFRTINNVMDXXXXXXXXXXDEIFVDASPSPVVTRTASIDIPR--SEDGRRSSNRLVNSK 170
              +I+   D           + F   S S  + +T SIDIPR  S+    + N  +   
Sbjct: 183 --SSIHPPSDLSKTVSTSSNCQSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKH 240

Query: 171 PYLYNYEPS-------------------------XXXXXXXXXXMLQGTDVVLNQELLEQ 205
           P +++Y+                                     +LQ  D+V+NQ  L+ 
Sbjct: 241 PTVHSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQN 300

Query: 206 ALKRDMKRKRADTMQSS-----TVELNKKVDTNTSKNSNHTEIMKNXXXXXXXXXXXXXX 260
           ALKRDMKRKR DT+ ++     T +  K  D   +K       M                
Sbjct: 301 ALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEAKTKTEKPAM----------SATAAM 350

Query: 261 XXRLYGDRTLLNQQITK--------QKEDENKYSHTITNAAY-KKLKPFSGVKR------ 305
             +LYGD TL  ++  K        + +D  K S +  N    KKLK F    +      
Sbjct: 351 MLKLYGDTTLKEKETFKNNTISGTIRYDDFYKRSESSVNLPENKKLKSFDNNTKNGNGYV 410

Query: 306 KILSNPN---------------------LNLQPLEPIRPNEPPTSGQRTPNNSAHVHSES 344
            +  NPN                     + +Q ++ ++ + P +    T + S+ + S +
Sbjct: 411 SVSGNPNSGLSNTYNSNSNLSFSSSPRDIKIQHIDDVKTHLPSSFSSSTSSTSSSLGSSA 470

Query: 345 PSP-DRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNK 403
               D  +V+LKWRD  +  N K+ K+ ++S++I  +L++     +  +   T+N+  N 
Sbjct: 471 GLINDNVHVVLKWRDQID--NPKKCKIAIISDDIVNALESS----SSKRKSNTNNNDNNT 524

Query: 404 IPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGY 463
           +P+ ++    EWY+P+L LP GIYRL+F +N ++ HS+FLPTATD  GNI+NWFEVL GY
Sbjct: 525 LPMVFNPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGY 584

Query: 464 DRIEPYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSK 523
           D +EPYRDE          ++TT     + G                     L     + 
Sbjct: 585 DAVEPYRDE---------IIETTFHTAPSQG--------------------TLSVHDLTM 615

Query: 524 AQASRNSSYYSAKSFEKSITQFSDYTGVSRTNSMV-SAVSPINNANTRD-NDLEFFPPIK 581
            ++ R+SS+ SAKS   S T +SDY G+SR++S V +A    +  + R  N L+ F PI+
Sbjct: 616 IRSRRSSSFVSAKSDLSSFTPYSDYAGISRSSSSVGTATKKASLVSLRGTNKLDLFTPIE 675

Query: 582 PKVYEYSNNIPALFRIS----CDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFG 637
           PK   YS  IP LF+I+     +  ++DDD  +       ++RPSFT++V+DCNQD LF 
Sbjct: 676 PKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSP------FERPSFTHKVIDCNQDKLFA 729

Query: 638 DLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAG----PSTQDSSIN 693
           DLQ+ G +DAE AE LFL +Y +PDLP+YLNSTYLNKIF +F +       P++    + 
Sbjct: 730 DLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLT 789

Query: 694 HIIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQLESK 743
           HIIPHVNL HLLTSSIRD I+SVACTTRY GKFITQV+YAPC     E+K
Sbjct: 790 HIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNYSSQENK 839

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score =  359 bits (922), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 291/808 (36%), Positives = 407/808 (50%), Gaps = 172/808 (21%)

Query: 4   LFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGS------ALHISSPGPSNATVQT 57
           LFK+DYS+   A      +  D  +A LSL      G+      +    SPGPS ATV+ 
Sbjct: 93  LFKKDYSLNNTA------DGNDTTLANLSLIDDHDVGAPEEQVKSPSFLSPGPSMATVKQ 146

Query: 58  IKREV--------THGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVXXXXXXKR 109
            K ++        T  DE+    ++D    H R    HR SI+ALK +L E         
Sbjct: 147 TKSDLENLSTSNYTTVDEA----TEDGRTNHPR-HERHRSSIIALKKTLLENSATASPS- 200

Query: 110 KNLPFRTINNVMDXXXXXXXXXXDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVNS 169
              P R+ +                  V ++  P +T+  SID P     + + ++  + 
Sbjct: 201 ---PTRSSS------------------VHSASMPPLTKMDSIDTPL----KPAYSKKPSI 235

Query: 170 KPYLYNY---EPSXXXXXXX-----------XXXMLQGTDVVLNQELLEQALKRDMKR-K 214
             Y Y Y   +P+                     +LQ  D+VLNQ LL+ ALK+DM+R  
Sbjct: 236 HAYQYQYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLS 295

Query: 215 RADTMQSSTV---------------ELNKKVDTNTSKNSNHTEIMKNXXXXXXXXXXXXX 259
           RA++  S+                  +  K D+ +  ++++  I                
Sbjct: 296 RANSSNSTCTIENSNNNNNYSSSENNIRNKEDSGSFNDNSNVPI-----------SATAK 344

Query: 260 XXXRLYGDRTL----LNQQITKQKEDENKYSHTITNAAYKKLKPFSGV--KRKILSNPNL 313
              +LYGD+TL    LN+  TK K+ +NK   +++N+          +  K+ IL+N +L
Sbjct: 345 MMMKLYGDKTLMERDLNKHQTKTKKVQNKKLKSVSNSRRSSFASLHSLQSKKSILTN-SL 403

Query: 314 NLQPLEPIRP----NEPPTSGQR--------TPNNSAHVHSESPSPDRTNVILKWRDSQN 361
           NLQPL P+ P    NE   S  +           +S    S + S + T VILKW++  N
Sbjct: 404 NLQPLHPLHPIINDNESQYSAPQHREMSHPSNSMSSMSSISSTNSAESTLVILKWKNYSN 463

Query: 362 QSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFN-KIPLSYDSHNNEWYVPDL 420
            +   E  V +VSN+I ++LK   ++ A+         Q N +I + YD+ + EW+ PDL
Sbjct: 464 MAVTTE--VSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDL 521

Query: 421 YLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYT 480
           +LP GIYRLQF +NG L HS++LPTATD +GN +NWFEVL GY  IEP+R+E    +D  
Sbjct: 522 FLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNE----ADLG 577

Query: 481 SSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSSYYSAKSFEK 540
           S V+  LE                     +P+   L+      + +SR SSYYSAK  E+
Sbjct: 578 SQVEPVLE-------------------EESPIRPELKR----FSSSSRKSSYYSAKGVER 614

Query: 541 SITQFSDYTGVSRTNSMVSAVSPINNANTRD-------NDLEFFPPIKPKVYEYSNNIPA 593
             T FSDY G+SR++S+          N RD       + L+    IKP+  EYSN IP 
Sbjct: 615 PSTPFSDYRGLSRSSSV----------NMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPN 664

Query: 594 LFRISCDMEDVDDDNGTENNPRAFYD-----RPSFTNRVVDCNQDALFGDLQKGGKMDAE 648
           LF I+        D GT +  R   D     +PSFT +VVDCNQD LF  LQ+GG +DAE
Sbjct: 665 LFNIA--------DGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAE 716

Query: 649 EAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQD-SSINHIIPHVNLKHLLTS 707
            AE +FL +Y +PDLP+YLNS+YLNKI ++ +  + P  +D  +INHIIPHVNL HLLTS
Sbjct: 717 TAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTS 776

Query: 708 SIRDGIVSVACTTRYAGKFITQVIYAPC 735
           SIRD I+SVACTTRY GKFITQVIYAPC
Sbjct: 777 SIRDEIISVACTTRYEGKFITQVIYAPC 804

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score =  354 bits (909), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 282/800 (35%), Positives = 390/800 (48%), Gaps = 156/800 (19%)

Query: 4   LFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGS------ALHISSPGPSNATVQT 57
           LFK+DYS++  A      +  D  +A L+L+     G+      +    SPGPS ATV+ 
Sbjct: 93  LFKKDYSLSSAA------DVNDTTLANLTLSDDHDVGAPEEQVKSPSFLSPGPSMATVKR 146

Query: 58  IKREV--------THGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVXXXXXXKR 109
            K ++        T  DE+ + + +D    H R    HR SI+ALK +L E         
Sbjct: 147 TKSDLDDLSTLNYTMVDETTENERND-KPHHER----HRSSIIALKKNLLESSATASPS- 200

Query: 110 KNLPFRTINNVMDXXXXXXXXXXDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVNS 169
              P R+ +                  V ++  P +T+T SIDIP  +   +  +     
Sbjct: 201 ---PTRSSS------------------VHSASLPALTKTDSIDIPVRQPYSKKPSIHAYQ 239

Query: 170 KPYLYNYEP----------SXXXXXXXXXXMLQGTDVVLNQELLEQALKRDMKR-KRADT 218
             YL N E                      +LQ  D+VLNQ LL+ ALK+DM+R  R ++
Sbjct: 240 YQYLNNDETFSENSQMDKEGNSDSVDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRVNS 299

Query: 219 MQS----STVELNKKVDTNTSKNSNHTEIMKNXXXXXXXXXXXXXXXXRLYGDRTL---- 270
             S      +          +   N      +                +LYGD+TL    
Sbjct: 300 SNSMYTAERISHANNNGNIENNTRNKGNAGGSNDDFTAPISATAKMMMKLYGDKTLMERD 359

Query: 271 LNQQITKQKEDENKYSHTITNAAYKKLKPFSGV-----KRKILSNPNLNLQPLEPIRP-- 323
           LN+   K K+ +NK    I + +  +   F+ +     ++ IL+N  LNLQPL P+ P  
Sbjct: 360 LNKHHNKTKKAQNK---KIRSVSNSRRSSFASLHSLQSRKSILTN-GLNLQPLHPLHPII 415

Query: 324 --NEPPTSGQR--------TPNNSAHVHSESPSPDRTNVILKWRDSQNQSNNKELKVYLV 373
             NE   S  +           +S    S + S + T V+LKW+D    +   E  V++V
Sbjct: 416 NDNESQYSAPQHREISHHSNSMSSMSSISSTNSTENTLVVLKWKDDGTVAATTE--VFIV 473

Query: 374 SNEICASLKNDDKLFAEGKLLATDNSQFN-KIPLSYDSHNNEWYVPDLYLPQGIYRLQFL 432
           S +I ++LK   +L  +         Q N +I + YD  + EW+VPDL+LP GIYRLQF 
Sbjct: 474 STDIASALKEQRELTLDENASLDSEKQLNPRIRMVYDDVHKEWFVPDLFLPAGIYRLQFS 533

Query: 433 VNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYTSSVDTTLEGMEN 492
           +NG L HS+FLPTATD +GN +NWFEVL GY  IEP+R+E++I S    ++D  L     
Sbjct: 534 INGILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADIDSQVEPTLDEEL----- 588

Query: 493 NGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASR------NSSYYSAKSFEKSITQFS 546
                                       P + +  R       SSYYSAK  E+  T FS
Sbjct: 589 ----------------------------PKRPELKRFPSSSRKSSYYSAKGVERPSTPFS 620

Query: 547 DYTGVSRTNSMVSAVSPINNANTRDN-------DLEFFPPIKPKVYEYSNNIPALFRI-- 597
           DY G+SR++S+          N RD+        L+    +KP+   YSN IP LF I  
Sbjct: 621 DYRGLSRSSSI----------NMRDSFVRLKASSLDLMAEVKPERLVYSNEIPNLFNIGD 670

Query: 598 -SCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGKMDAEEAENLFLK 656
            S      D D+     P      PSFT+RVVDCNQD LF  LQ+GG +DAE AE +FL 
Sbjct: 671 GSTISVKGDSDDVHPQEP------PSFTHRVVDCNQDDLFATLQQGGNIDAETAEAVFLS 724

Query: 657 KYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQD-SSINHIIPHVNLKHLLTSSIRDGIVS 715
           +Y VPDLP+YLNS+YLN+I ++ +Q +    +D  +INHIIPHVNL HLLTSSIRD I+S
Sbjct: 725 RYPVPDLPIYLNSSYLNRILNQSNQNSESHERDEGAINHIIPHVNLNHLLTSSIRDEIIS 784

Query: 716 VACTTRYAGKFITQVIYAPC 735
           VACTTRY GKFITQV+YAPC
Sbjct: 785 VACTTRYEGKFITQVVYAPC 804

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  340 bits (872), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 220/554 (39%), Positives = 300/554 (54%), Gaps = 61/554 (11%)

Query: 191 LQGTDVVLNQELLEQALKRDMKRKRADTMQSSTVELNKKVDTNTSKNSNHTEIMKNXXXX 250
           LQ  DVVLNQ LL+  L+RDMKRKR    +S     +   +   S NS   E ++N    
Sbjct: 236 LQSEDVVLNQSLLQNVLRRDMKRKRP-AKKSKVPNTSHVSNLKASSNSVSYESLENGNVP 294

Query: 251 XXXXXXXXXXXXRLYGDRTLLNQQITKQKEDE-NKYSHTITNAAYKKLKPF---SGVKRK 306
                        L  D +L + Q T Q  D  N  +H   +  + ++  F   S   R+
Sbjct: 295 DAKKLKS------LSYDGSLPSFQPTAQNNDRLNGLAH---DNGFNRIDSFEKGSVEHRE 345

Query: 307 ILSNPNLNLQPLEPIRPNEPPTSGQRTPNNSAHVHSESPSPDRTNVILKWRDSQNQSNNK 366
           + ++P +                   + + S+     +  P++ +VILKWRD     +  
Sbjct: 346 VETSPTMR---------------NSSSASPSSSSIISNTEPEKVHVILKWRD--QIEDPS 388

Query: 367 ELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSHNNEWYVPDLYLPQGI 426
           + K+ ++S +I ++L  D           +D S      + YD   N +YVP+L LP GI
Sbjct: 389 KCKITIISTDIASALNFD----------PSDKSFHGTFSMKYDEKENNFYVPNLSLPPGI 438

Query: 427 YRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYTSSVDTT 486
           Y+ QF++NG + HS+ LP+ATD  GNI+NWFEV+ GY+ +EP+R+E +            
Sbjct: 439 YKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNEIDYH---------- 488

Query: 487 LEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQ-ASRNSSYYSAKSFEKSITQF 545
            E M  +  Q  S  ST    + +P  + L  P P +   A+R++S YS K  E+S T +
Sbjct: 489 -ENMGIDPPQSDSSTSTGKHHDESPGKVPLVQPVPGRPPLAARHTSSYSNKQ-ERSGTPY 546

Query: 546 SDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSNNIPALFRISCDMEDVD 605
           SDYTGVSR NS V   SP+ +      DL     ++PK YEYSN IP LF+    +   D
Sbjct: 547 SDYTGVSRCNSAVRK-SPLIHQTLSSIDL--VTALQPKKYEYSNEIPELFKAGNVLGQSD 603

Query: 606 DDN----GTENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGKMDAEEAENLFLKKYQVP 661
           ++              YD+PSF   VVDCNQD LF  LQ+GG +DAE AE LFL+KY VP
Sbjct: 604 ENQFPTPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSLQQGGLLDAETAEQLFLEKYTVP 663

Query: 662 DLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPHVNLKHLLTSSIRDGIVSVACTTR 721
           DLPVYLNSTYLNKIF+EF +     +  S +NHIIPHVNL HLLTSSIRD ++SV CTTR
Sbjct: 664 DLPVYLNSTYLNKIFNEFQKHNSLGSNSSGLNHIIPHVNLNHLLTSSIRDEMISVGCTTR 723

Query: 722 YAGKFITQVIYAPC 735
           Y GKFITQV+YAPC
Sbjct: 724 YEGKFITQVVYAPC 737

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 3   SLFKEDYSVTKEASEPEAD----ESIDVNMAGLSLTSSMGDGSALHISSPGPSNATVQTI 58
           SLFK DYS+   A E  A+    E+I  NMAGLSL SS  +       +PG S  TVQ  
Sbjct: 73  SLFKSDYSLRSTAEETPANTGSTENIRDNMAGLSLKSSNENAQVPSFLTPGHSTPTVQPT 132

Query: 59  KREVTHGDESPQGDSDDINAQHSRAMSEH---RPSIVALKMSL 98
           ++      +      + +N Q  + +S H   RPS+VALK +L
Sbjct: 133 RQAAVPAADLKNKLQNGLNQQ--KEISSHRFQRPSVVALKKTL 173

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score =  340 bits (871), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 290/831 (34%), Positives = 398/831 (47%), Gaps = 209/831 (25%)

Query: 4   LFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGSALH-------ISSPGPSNATVQ 56
           LFK+DYSV K A + E        +A LSL     D SA           SPGPS ATV+
Sbjct: 96  LFKKDYSVAKAADDNE------TTLANLSLYDRH-DASAPEEQVKSPTFLSPGPSMATVK 148

Query: 57  TIKR--------EVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVXXXXXXK 108
             K           T  DE+  GD    +  H R    HR SI+ALK +L E        
Sbjct: 149 QTKNYPDDLSTVNNTIVDET-IGDERKDHPHHER----HRSSIIALKKTLLENSAT---- 199

Query: 109 RKNLPFRTINNVMDXXXXXXXXXXDEIFVDASPSPVVTRTASID----IPRSEDG----- 159
                                         ASPSP  TR++SI     +P S+ G     
Sbjct: 200 ------------------------------ASPSP--TRSSSIHSTSLLPLSKAGSIDIP 227

Query: 160 -RRSSNRLVNSKPYLYNY--------------EPSXXXXXXXXXXMLQGTDVVLNQELLE 204
            +++ ++  +   Y Y Y              + S          +LQ  D+VLNQ LL+
Sbjct: 228 IKQTYSKKPSVHAYQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQ 287

Query: 205 QALKRDMKRKRADTMQSSTVELNKKVDTNTSKNSNHTEIMK----------------NXX 248
            ALK+D++R       +ST  ++     N + N+N++                    +  
Sbjct: 288 NALKKDIQRLSRVNSSNSTYTIDSATHNNNNNNNNNSNSNNSSNSENNIGYKENSSDSND 347

Query: 249 XXXXXXXXXXXXXXRLYGDRTLLNQQITKQKEDENKYSHTITN--------------AAY 294
                         +LYGD+TL+ + + K    +NK    + N              A+ 
Sbjct: 348 DSGAPISATAKMMMKLYGDKTLMERDLNKH---QNKSLKKVQNKKLRSASNSRRSSFASL 404

Query: 295 KKLKPFSGVKRKILSNPNLNLQPLEPIRPNEPPTSGQRTPNNSAHVHSESP--------- 345
             L+P    ++ +L+N +LNLQPL P+ P       Q     S   H E P         
Sbjct: 405 HSLQP----RKSVLTN-SLNLQPLHPLHPIINDNDSQY----SVPQHREIPHHYNSMSSM 455

Query: 346 -------SPDRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDN 398
                  S + T VILKW+++ N     E  V ++S++I ++LK   ++  +        
Sbjct: 456 SSISSTNSSESTLVILKWKNNSNMPATTE--VSIISHDIASTLKEQLEVNLDEDASLDSE 513

Query: 399 SQFN-KIPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWF 457
            Q N +I + YD+ + EW+VP+L+LP GIYRLQF +NG L HS+FLPTATD +G  +NWF
Sbjct: 514 KQLNPRIRMIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWF 573

Query: 458 EVLRGYDRIEPYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQ 517
           EVL GY  IEP+RDE++ +S   S++D                           V   ++
Sbjct: 574 EVLPGYHTIEPFRDEADTESQVGSTID---------------------------VEAPIR 606

Query: 518 APAPSKAQASRNSSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDN----- 572
                 + +SR SSYYSAK  E+  T FSDY G+SR+NS          AN RD+     
Sbjct: 607 PEPKRLSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSNS----------ANLRDSFVRLK 656

Query: 573 --DLEFFPPIKPKVYEYSNNIPALFRISCDMEDVDDDNGT-----ENNPRAFYDRPSFTN 625
              L+    IKP++ EYSN IP+LF I          NG+     E+ P    D PSFT+
Sbjct: 657 ASSLDLMAQIKPEILEYSNEIPSLFTIG---------NGSATPIQEDLPSQ--DLPSFTH 705

Query: 626 RVVDCNQDALFGDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGP 685
           +VVDCNQD LF  LQ+GG +DAE AE +FL +Y +PDLP+YLNS+YLNKI ++ +  +  
Sbjct: 706 KVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSES 765

Query: 686 STQD-SSINHIIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
             +D  +INHIIPHVNL HLLTSSIRD I+SVACTTRY GKFITQVIYAPC
Sbjct: 766 GDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  319 bits (818), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 182/399 (45%), Positives = 234/399 (58%), Gaps = 41/399 (10%)

Query: 350 TNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYD 409
            +V +KWRD         +   +VS +I ++L      F   K  A      N  P+ Y+
Sbjct: 439 VHVAIKWRDHLPVDGTNRMS--MVSEDIASTLS-----FERQKHGAR-----NTFPMRYE 486

Query: 410 SHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPY 469
               EW VPDL LP G+YRLQFL+NG L HS++LPTATD  GN +NWFEV+ GY+++EPY
Sbjct: 487 EETKEWVVPDLVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPY 546

Query: 470 RDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKA--QAS 527
           RDE E+ S    +         NNG  GS      S+ N       L  P P K   +  
Sbjct: 547 RDEVELDSGQPLNAG-------NNGIAGS----VLSLENQGSEGTVLMEPVPGKVNVRPP 595

Query: 528 RNSSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEY 587
             S ++S+    +S T +SDYTG+SR++S +   SPIN   +    L+    ++PK Y+Y
Sbjct: 596 LASMHHSSNRVIRSNTPYSDYTGISRSSSALRK-SPINCTTS---SLDLHTALQPKKYKY 651

Query: 588 SNNIPALFRISCDMEDVDDDN-----GTENNPRAFYDR--PS----FTNRVVDCNQDALF 636
           SN IP LF+ +  +   +D+N     G    P   + R  PS    F N+VVDCNQD LF
Sbjct: 652 SNEIPELFK-TAPITKANDENEDFTFGHMEPPTYDWARGHPSSNAGFGNQVVDCNQDELF 710

Query: 637 GDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHII 696
            +LQ+GG +DAE AE LFL+KY VPDLP+YLNS YLN+I  EF +   P      INHII
Sbjct: 711 TELQQGGLLDAETAEQLFLEKYPVPDLPIYLNSYYLNRIISEFQKNNYPGGGSGGINHII 770

Query: 697 PHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           PHVNL HLLTSSIRD ++SV CTTRY GKFITQVIYAPC
Sbjct: 771 PHVNLNHLLTSSIRDEMISVGCTTRYEGKFITQVIYAPC 809

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 74/206 (35%), Gaps = 57/206 (27%)

Query: 22  ESIDVNMAGLSLTSSMGDGSALHISSPGPSNATVQTIKREVTHGDESPQGDSDDINAQHS 81
           ES+  NMAGLS+ SS   G      SPGP+  TVQ  K E       P  D+        
Sbjct: 127 ESVRENMAGLSIKSSNETGPMFF--SPGPATPTVQPTKEEAI----PPMDDN-------- 172

Query: 82  RAMSEHRPSIVALKMSLKEVXXXXXXKRKNLPFRTINNVMDXXXXXXXXXXDEIFVDASP 141
             +  +R S+VALK +L+E                                       S 
Sbjct: 173 -MIFHNRQSVVALKKNLEESEQPSSRS------------------------------GSS 201

Query: 142 SPVVTRTASID------IPRSEDGRRSSNRLV------NSKPYLYNYEPSXXXXXXXXXX 189
           + + TRT  ID      +PR       +          N +P +     S          
Sbjct: 202 ANMETRTTPIDNRRLKPLPRQAVAAAITATATTAPATPNGRPSIDTDPESSDIDNISDDG 261

Query: 190 MLQGTDVVLNQELLEQALKRDMKRKR 215
            L   D+VLNQ LL   +KRDMKRKR
Sbjct: 262 YLHSKDIVLNQSLLHNVIKRDMKRKR 287

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  311 bits (798), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 178/406 (43%), Positives = 245/406 (60%), Gaps = 49/406 (12%)

Query: 348 DRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLS 407
           D  NV+LKWRD     + K  K+ ++S++I A             +LA  +S+  KIP+ 
Sbjct: 524 DLVNVVLKWRDCI--VDPKTCKISVISSDISA-------------VLALQSSK--KIPME 566

Query: 408 YDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIE 467
           Y++    W+VP+L LP G+Y+LQFL+NG L HS+FLPTATD  GN +NWFEVL GY  IE
Sbjct: 567 YETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIE 626

Query: 468 PYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQAS 527
           P RD      +Y S +  +++   N G    SD + T+     P+      P P     +
Sbjct: 627 PLRDVPVDSMNYGSDLGVSMKESVNGG----SDFTITA-----PI------PRPPLLSQA 671

Query: 528 RNSSYYSAKSFEKSITQFSDYTGV-SRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYE 586
            +SSY S+K  E+S T +SDYTG+ SR+NS      P+ N   + +  + F P+ PK YE
Sbjct: 672 TSSSYRSSKYIERSTTPYSDYTGILSRSNS----ARPLLN-QKKSSSYDVFAPLPPKKYE 726

Query: 587 YSNNIPALFRISCDMEDVDDDNGTENNPRAF--------YDRPSFTNRVVDCNQDALFGD 638
           YS +IP LF+++ D ED D D     +P ++         ++PSF  RV DCNQD LF D
Sbjct: 727 YSTDIPELFKVN-DEEDHDHD--IPEDPPSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSD 783

Query: 639 LQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPH 698
           LQ+  ++DA+ AE  FL+KY VPDLP+YLNS+YLNK+F++  +        + +N +IPH
Sbjct: 784 LQQHDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGETKAVVNPVIPH 843

Query: 699 VNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQLESKE 744
           VNL HLLTSSIR+ I+SV CTTRY GKFIT V+YAPC  +    KE
Sbjct: 844 VNLNHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYENTNRKE 889

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 76/188 (40%), Gaps = 19/188 (10%)

Query: 47  SPGPSNATVQTIKREV----THGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVX 102
           SPGP++ TV+  + E     T  +   + ++D    Q    +  HRPSIVALK SL E  
Sbjct: 203 SPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSYL--HRPSIVALKRSLVEGR 260

Query: 103 XXXXXKRKNLPFRTINNVMDXXXXXXXXXXDEIFVDASPSPVV-------TRTASIDIP- 154
                  +     T N              D+      PS ++        RT SIDIP 
Sbjct: 261 IGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPG 320

Query: 155 --RSEDGRRSSNRLVN--SKPYLYNYEP-SXXXXXXXXXXMLQGTDVVLNQELLEQALKR 209
              +      SNR     S     +  P S           L+  DV+LN  +LE A+++
Sbjct: 321 RGHAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEGFLEDNDVLLNNAVLESAIRK 380

Query: 210 DMKRKRAD 217
           DMKRKR +
Sbjct: 381 DMKRKRQE 388

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  283 bits (723), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 209/577 (36%), Positives = 293/577 (50%), Gaps = 111/577 (19%)

Query: 190 MLQGTDVVLNQELLEQALKRDMKRKRADTMQSST---VELNKKVDTNTSKN-SNHTEIMK 245
           ++Q  D VLNQ +L+ A+K+DMKRKR D+  S T   V  N +      +N    T +  
Sbjct: 68  IVQNQDRVLNQAILQHAIKKDMKRKRNDSNASGTAAAVLHNHRQQQQQEENVEGPTLVGA 127

Query: 246 NXXXXXXXXXXXXXXXXRLYGDRTLLNQQITKQKEDENKYSHTITNAAYKKLKPFSGVKR 305
                            +LYGD+  L  ++ + +E      H + +AA            
Sbjct: 128 QTGAASGEMSATAAIMLKLYGDKNQLAHEVHEARE-----VHEVKSAA------------ 170

Query: 306 KILSNPNLNLQPLEPIRPNEPPTSGQRTPNNSAHVHSE-SPSPDRTN----VILKWRDSQ 360
                 N+ L  ++ I+   P    ++     A    + S   D  N    VILKWRD Q
Sbjct: 171 -----SNVRLPEVKKIKKPLPEKETEKVRTQVAAADEQFSNFSDFENENVRVILKWRDPQ 225

Query: 361 NQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATD-NSQFNKIPLSYDSHNNEWYVPD 419
            Q   +     + S++I ++L+       + +L+  +  ++ + + L YD+   +W+VPD
Sbjct: 226 LQPY-QGTGAAIKSHDIYSTLRA-----IKSELITPERENKEDLLYLDYDAKKKDWFVPD 279

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSD- 478
           LYLP GIYRL+FL+NG L+HS+FLPTATD  G I+NWFEVL GY+ IEPYRDES I  D 
Sbjct: 280 LYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDD 339

Query: 479 -------YTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSS 531
                  Y S+ D T        + G S +S+   +++     NL+ P       ++ SS
Sbjct: 340 ESIDSQPYKSTTDVT-------DYAGISRSSSVVSKHS---KSNLRLPNLHITSLNKESS 389

Query: 532 YYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSNNI 591
                                      ++V+  N  N   ND++  P  +PK YEYS  I
Sbjct: 390 ---------------------------ASVNEANETN-EGNDIQLLP--EPK-YEYSTEI 418

Query: 592 PALF-------RISCDMEDVDDDNGTEN-NPRAFYDRPSFT-NRVVDCNQDALFGDLQKG 642
           P LF       R + D+++V  ++  E   P   +D   FT  RVV+ NQDALF  +QK 
Sbjct: 419 PELFQFDDVNTRKTNDIKEVRKESKLETLYPNGKFD---FTLARVVNSNQDALFASIQKI 475

Query: 643 GKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPHVNLK 702
           GKM  EEAE  FL K++V DLP+YLNSTYLNK F               +NHIIPHVNL+
Sbjct: 476 GKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNF------------SGEVNHIIPHVNLR 523

Query: 703 HLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQ 739
           HLLT+SI++ I+ V CTTRYAGKFITQVIYAPC  D+
Sbjct: 524 HLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCSYDK 560

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  267 bits (682), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 156/341 (45%), Positives = 203/341 (59%), Gaps = 52/341 (15%)

Query: 406 LSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDR 465
           + +D  +N W  PDLYLP G+Y+ QFL+NG L HS+FLPTATD  GN +NWFEV+ G+  
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 466 IEPYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQ 525
           IEP RD   I +D+T          EN            ++  N+P A    +P P    
Sbjct: 61  IEPSRD--VISNDFT----------ENQ----------VAISANDPSA----SPRPPILS 94

Query: 526 ASRNSSYY--SAKSFEKSITQFSDYTGV-SRTNSMVSAVSPINNANTRDNDLEFFPPIKP 582
            S + S +  SAK  E+S T +SDYTG+ SRT+    A   + + NT   DL    P+  
Sbjct: 95  GSSSFSNWKNSAKHIERSGTPYSDYTGLCSRTD---LAKPELRHKNTSSYDL--LAPVPR 149

Query: 583 KVYEYSNNIPALFRISCD--------MEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDA 634
            VYEYSN IP LF+ + +         E V   N  +N       +PSF +RV DCNQD 
Sbjct: 150 PVYEYSNEIPELFKANFEGSSTPPPYQESVPSQNPVKN-------QPSFLHRVQDCNQDV 202

Query: 635 LFGDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINH 694
           LF DLQK G++D++ AE  FL++Y  PDLPVYL+S++LN +F  F +    +   S +NH
Sbjct: 203 LFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQE---KNDTKSKLNH 259

Query: 695 IIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           I+PHVNL HLLTSSIRD I+SV CTTRY GKFITQ+IY PC
Sbjct: 260 IVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 300

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  275 bits (703), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 161/401 (40%), Positives = 216/401 (53%), Gaps = 76/401 (18%)

Query: 350 TNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYD 409
           T+VIL W+D  N  + K  K+ +VS +I ++L    K              F+KIP+ +D
Sbjct: 361 THVILNWKD--NIVDPKTCKMSIVSKDISSTLNPHKK--------------FSKIPMVFD 404

Query: 410 SHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPY 469
              N W   DLYLP G+Y+ QFL+NG L HSD+LPTATD  GN +NWFEV+ G+D IEP 
Sbjct: 405 MERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPS 464

Query: 470 RDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRN 529
           R       D  SS D  L          S D             + ++ PAP +     +
Sbjct: 465 R-------DVISSEDVKL----------SKDQ------------IAVEQPAPERPALGSD 495

Query: 530 S-----SYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKV 584
                    S++  E+S T FSDYTG+   + +       NN ++ D       P+    
Sbjct: 496 GSSSSNWKGSSRHVERSGTPFSDYTGLCSRSELTKPELRHNNTSSYD----LLAPVPRPK 551

Query: 585 YEYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDR----------PSFTNRVVDCNQDA 634
           YEY++ IP LF+ + D   V         P  + +R          PSF +RV DCNQD 
Sbjct: 552 YEYTDEIPELFKANFDGSLV---------PPPYEERELTKDGSQKPPSFLHRVQDCNQDV 602

Query: 635 LFGDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINH 694
           LF DLQ+ G++D++ AE  FL++Y  PDLPVYL+S++LN +F  F       T+   +NH
Sbjct: 603 LFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTR---VNH 659

Query: 695 IIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           I+PHVNL HLLTSSIRD I+SV CTTRY GKFITQ+IY PC
Sbjct: 660 IVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  279 bits (714), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 171/402 (42%), Positives = 231/402 (57%), Gaps = 61/402 (15%)

Query: 351  NVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDS 410
            NVI+K+RD   +S   E K+ L+S +I  +L  D         L T+N   NK+ L Y+ 
Sbjct: 663  NVIIKYRDPMEESEIPETKIQLISKDINTTLHYD------TTDLLTEN---NKMELVYNK 713

Query: 411  HNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYR 470
                W +P+L LP GIY++QFLVN +L HSDFLPTATDD GNI+NWFEVL GYD IEP+R
Sbjct: 714  DEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFR 773

Query: 471  DESEIQSDYTSSVDTTLEGMENNGFQGSSDNS-TTSMRNNNPVALNLQAPAPSKAQASRN 529
            DE+                        S+DNS  T M+N  P  L   +        S+ 
Sbjct: 774  DEN----------------------ISSADNSDGTLMQNIIPEKLKTISMTKMAGNGSKG 811

Query: 530  SSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSN 589
            S            T  S+YTGVSR+NS+ ++ S     +    ++  F P++P   EYS 
Sbjct: 812  S------------TPRSNYTGVSRSNSLSASSSSSVWKSV---NVNLFTPLEPNKVEYST 856

Query: 590  NIPALFRISCDMEDVDDDNGTENNPRAFY---DRPSFTNRVVDCNQDALFGDLQKGGKMD 646
             IP +F+ + +       N T N P  ++    RP   + VVDC+Q+ LFGDL   G MD
Sbjct: 857  EIPEIFKNTTE-------NNTSNAPMQYHPERKRPGLLHNVVDCSQEELFGDLLADGLMD 909

Query: 647  AEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGP----STQDSSINHIIPHVNLK 702
             E AE +FL KY VP+LP+YLNS Y+ +I  E +Q +G     S  ++ +NHIIPHVNL+
Sbjct: 910  TETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQPSGSGPPSSLNNNDLNHIIPHVNLQ 969

Query: 703  HLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQLESKE 744
            HLLTSSIR+ ++SVACTTRY GKF+TQ++Y PC  + L+S E
Sbjct: 970  HLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYENLKSGE 1011

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 58/148 (39%), Gaps = 49/148 (33%)

Query: 3   SLFKEDYSVT----------KEASEPEADESIDVNMAGL--SLTSSMGDG---------- 40
           SLFK++YS+T          K  S PE D +I  N +    S  S   D           
Sbjct: 70  SLFKQNYSLTQNNETYEPILKPLSSPENDTNITYNNSTFNNSRASKNSDQDIIRNDNDPI 129

Query: 41  ----SALHISSPGPSNATVQTIKREVTHGDES-----------------------PQGDS 73
                 L I SPGPS+ TV+  K++  + ++                        P   +
Sbjct: 130 NNQQQPLLILSPGPSHPTVEQSKQQANYNEDQEMFKNGITQTKNSSSYRNTSPNIPSNTN 189

Query: 74  DDINAQHSRAMSEHRPSIVALKMSLKEV 101
           + IN       S HRPS+VALK SL+E 
Sbjct: 190 NIINMNSHNYASSHRPSVVALKKSLEET 217

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  259 bits (663), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 159/388 (40%), Positives = 206/388 (53%), Gaps = 69/388 (17%)

Query: 352 VILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSH 411
           VI+KWRD     + +  K+ +VS +I + +  + K                K+ + +   
Sbjct: 308 VIIKWRDCL--LDPQRTKLSIVSPDIASVIHKNSK---------------RKVAMVFSKD 350

Query: 412 NNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRD 471
              W  PDL LP GIY+LQFL+NG L HS+FLPTATD   NI+NWFEV+  YDR EPYRD
Sbjct: 351 EQFWVAPDLRLPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRD 410

Query: 472 ESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASR--N 529
            +  +                            +M   +P    L APA  +    +   
Sbjct: 411 PAPEE---------------------------VAMPPESP---QLTAPAAGRPPLLKRGT 440

Query: 530 SSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSN 589
           SS   A+  E+S T  SDYTG+SR+ S      P+   +   N +E   PI   V +YS 
Sbjct: 441 SSSSRARVVERSNTPISDYTGISRSGS----ARPLLAHHKSANSIEL-SPIPRCVLQYST 495

Query: 590 NIPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGKMDAEE 649
            IP LF+      D +   G            SF   + DCNQD LF  LQ+  KM A+E
Sbjct: 496 EIPELFKPEGCPPDPNTAPG------------SFNENIQDCNQDELFRFLQEDWKMSAQE 543

Query: 650 AENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQ--VAGPSTQDSSINHIIPHVNLKHLLTS 707
           AE + ++KY VPDLPVYLNS+YLN+IF +  +  V G   + SS  HIIPHVNL HLLTS
Sbjct: 544 AEEVLVEKYPVPDLPVYLNSSYLNEIFTKLQRSSVTG-DVKRSSFTHIIPHVNLNHLLTS 602

Query: 708 SIRDGIVSVACTTRYAGKFITQVIYAPC 735
           SIRD I+SV CTTRY GKFITQ++YAPC
Sbjct: 603 SIRDEIISVGCTTRYEGKFITQIMYAPC 630

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 89/219 (40%), Gaps = 50/219 (22%)

Query: 1   MHSLFKEDYSVTKEASEPEADESIDV----NMAGLSLTSSMGDGSALHISSPGPSNATVQ 56
           + S+FK DY++  +A    +++        N+AGL L     D     I SPGPS ATV+
Sbjct: 74  IASMFKCDYTLNADARSISSEQGETCQGMPNLAGLVL-----DACTQGIRSPGPSTATVE 128

Query: 57  TIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVXXXXXXKRKNLPFRT 116
               E +   E               A   HRPSI ALK SL +V      + +     T
Sbjct: 129 HTNLEASMSPE--------------LASQTHRPSISALKQSLIQVQGQTNSRHRAEDIDT 174

Query: 117 INNVMDXXXXXXXXXXDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVNSKPYLYNY 176
              V                +D   S   T TAS+   R++D    S+ L      +  Y
Sbjct: 175 AQYVPSAT------------IDIPCSNPSTNTASV-THRADDSSTRSSLLSLFTQDVEEY 221

Query: 177 EPSXXXXXXXXXXMLQGTDVVLNQELLEQALKRDMKRKR 215
                         ++ ++VVLN+ L++  +++D++RKR
Sbjct: 222 --------------IEASEVVLNESLVDSVVRKDLRRKR 246

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  261 bits (668), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 153/396 (38%), Positives = 216/396 (54%), Gaps = 46/396 (11%)

Query: 347 PDRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPL 406
           P+R  VI+KWRD+                 +         + ++   +     +  KIP+
Sbjct: 359 PERVQVIIKWRDTN----------------VDPRTSKISIISSDIASVVQPTRKRKKIPM 402

Query: 407 SYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRI 466
            Y      W   DL LP GIY+L F +NG + HS++LPTATD   NI+NWFEV+ GYD+I
Sbjct: 403 VYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQI 462

Query: 467 EPYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTT-SMRNNNPVALNLQAPAPSKAQ 525
           EPYRD +                +E +  + ++ N T+  + N  P   N++ P  ++  
Sbjct: 463 EPYRDAA----------------IERSPNELAAYNETSLLLTNETPSPANIRPPLINRG- 505

Query: 526 ASRNSSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVY 585
               SS   A+  E++ T  SDYTGV   NS  S  +   + +    D++  P  K    
Sbjct: 506 ---TSSSSRARVIERTNTPISDYTGVLARNS-CSNPAIYRHKSNNSTDVDILP--KQPTL 559

Query: 586 EYSNNIPALFRI----SCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQK 641
            YS+++P LF++    +   +   D N  +N  +   D P+F   V DCNQD LF  LQ+
Sbjct: 560 IYSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQE 619

Query: 642 GGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQ--VAGPSTQDSSINHIIPHV 699
              M+A+EAE +FL+KY VPDLP+YLNST LN+IF++  Q    G   +  S+ HIIPHV
Sbjct: 620 KWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHV 679

Query: 700 NLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           NL HLLTS+IRD I+SV CTTRY GKFITQ++YAPC
Sbjct: 680 NLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPC 715

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 109/252 (43%), Gaps = 46/252 (18%)

Query: 4   LFKEDYSVTKEASEP-----EADESIDV----NMAGLSLTSSMGDGSALHISSPGPSNAT 54
           LFK DYS++ ++S       + +  +D+    N+AGL L     D  A  I SPGPS+AT
Sbjct: 89  LFKRDYSLSDDSSAVGMEGVQEEGGVDLIGMPNVAGLKL-----DSRAQAIMSPGPSSAT 143

Query: 55  VQTIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVXXXXXXKRKNLPF 114
           V+  K E +   E               A   HRPSIVALK +L +            P 
Sbjct: 144 VEHSKLEASISPE--------------LAAQVHRPSIVALKQNLIQGHMGHPLHS---PL 186

Query: 115 RTINNVMDXXXXXXXXXXDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVNSKPYLY 174
           R   +  D                 +PS     +A+IDIP S     ++  ++      Y
Sbjct: 187 RDDYDGDDDDGD------------TAPSSSYVPSATIDIPYSNPSTMNTLSIIAQHQEDY 234

Query: 175 NYEPSXXXXXXX-XXXMLQGTDVVLNQELLEQALKRDMKRKRADTMQSSTVELNKKVDTN 233
           +   S            ++ +DVVL++ L++  +K DM+RKR   +Q  + E ++ ++ N
Sbjct: 235 STRSSAVSISTQDLDGYIENSDVVLSEALVDSVVKNDMRRKR--QLQKQSAEASEAINEN 292

Query: 234 TSKNSNHTEIMK 245
            ++ +   ++ K
Sbjct: 293 KNEANQQPDVKK 304

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  223 bits (568), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 142/389 (36%), Positives = 205/389 (52%), Gaps = 93/389 (23%)

Query: 353 ILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSHN 412
           ILKWR+  + ++     V +VS +I ++L    K      +   +  +F KI L YD   
Sbjct: 157 ILKWREPIDHNS----AVAIVSKDIVSTLLTIAKTHKSSIITFIERKKF-KINLLYDIVT 211

Query: 413 NEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDE 472
           NEWY+P+L+LP GIY+LQFL+NGNL+HS++LPTAT+  GNI+NWFEV+ GY  IEPYRDE
Sbjct: 212 NEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE 271

Query: 473 SEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSSY 532
             I     S+ + ++           S NS T                            
Sbjct: 272 ERIIHREKSTANESI-----------SSNSLT---------------------------- 292

Query: 533 YSAKSFEKSITQFSDYTGVSR-------TNSMVSAVSPINNANTRDNDLEFFPPIKPKVY 585
                         DY G+SR        +S++S+   + N N  D+++++         
Sbjct: 293 --------------DYAGISRSSSIVSNKSSLISSSLKLTNLNLNDDEIKY--------- 329

Query: 586 EYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGKM 645
             +N IP +F+        D    +  N +AF    S   +V+D NQD +F  LQK  +M
Sbjct: 330 --TNEIPEIFKF-------DSTANSNVNNQAFDMSLS---KVIDLNQDHVFASLQKIARM 377

Query: 646 DAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPHVNLKHLL 705
           + +EAEN FL ++++ DLP+YLNS +LNKIF            + + N+ +PHVNL HLL
Sbjct: 378 NTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIR-------DNNNETTNNTVPHVNLNHLL 430

Query: 706 TSSIRDGIVSVACTTRYAGKFITQVIYAP 734
           T+SI+D  + VACTTRY GKFITQ++YAP
Sbjct: 431 TTSIKDDTLCVACTTRYVGKFITQIMYAP 459

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  221 bits (562), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 143/401 (35%), Positives = 214/401 (53%), Gaps = 64/401 (15%)

Query: 352 VILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSH 411
           V LKWRD  +   N  + +  VSNEI + +  +D        L ++NS   +  + Y   
Sbjct: 396 VFLKWRDLIDDIENANISI--VSNEILSVICMND--------LDSENSDSAR--MVYYPD 443

Query: 412 NNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRD 471
            +EW    L+LP GIY+LQF VNG+L HSD+LPTATD+ GNI+NWFEV RGY+ IEP+RD
Sbjct: 444 TSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD 503

Query: 472 ESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSS 531
                +DY                              N ++  +  P P+       SS
Sbjct: 504 -----NDYVK----------------------------NEISGGILQPIPNTLGIPSVSS 530

Query: 532 YYSAKSFEKS--ITQFSDYTGVSRTNSM-VSAVSPINNANTRDNDLEFFPPIKPKVYEYS 588
             S+ SF  S   T +SD+ G++R++ + +   SP  +  + + DLEF   +    Y+Y+
Sbjct: 531 QLSSFSFHASRPTTPYSDFAGINRSSPLPLREKSP--DVKSTNFDLEFSTAVPEPKYDYT 588

Query: 589 NNIPALFR-ISCDMEDV-------DDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQ 640
             IP +++ +  D+          DD++ T+          S  N V+ C+Q  LF  L 
Sbjct: 589 TEIPEIYKAVDLDLTTAKATETTTDDEDITKPPLYLGTGGNSIFNDVIGCSQRDLFEKLS 648

Query: 641 K--GGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGP----STQDSSINH 694
           K  G  ++ +E E +FL KY + DLP+YLN+ Y+NK   +   + G       + + +NH
Sbjct: 649 KNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEINVVNH 708

Query: 695 IIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           I+PHVN+KHLLT +I+D +++VACT RY GKFITQV+Y+PC
Sbjct: 709 IVPHVNIKHLLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%)

Query: 47  SPGPSNATVQTIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKE 100
           S GPS ATV+    +V   DE      +  + +      EHRPSI+ALK +L E
Sbjct: 132 SLGPSTATVEQSTEKVIRLDEQHHPHQNLASKKDIVINHEHRPSILALKQNLYE 185

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  199 bits (507), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 206/405 (50%), Gaps = 73/405 (18%)

Query: 349 RTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSY 408
           R NV+L+WRDS  Q N     V ++S +I  S++  +     G LL ++ S      ++Y
Sbjct: 309 RVNVVLRWRDSYIQ-NETCKSVSIISEDILTSVQAQNS----GVLLISNFS------MTY 357

Query: 409 DSHNNEWYVPDLYLPQGIYRLQFLVNG-NLVHSDFLPTATDDQGNIMNWFEVLRGYDRIE 467
           D + N W +PDL+LP G YRL+FL++  +  +S++LP   D+ G I+N  E+L GY  +E
Sbjct: 358 DKNENNWVLPDLFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVE 417

Query: 468 PYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQAS 527
           P+   + I                    Q +  NS  S+ N    +  LQ+  PS  +  
Sbjct: 418 PFEHNNHIM------------------IQENIINSELSLNN----SRQLQSEPPSYPELE 455

Query: 528 RNSSYYSAKSFEKSIT-------QFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPI 580
            N S       E  I+       Q+S   G  R NS+  + + ++              I
Sbjct: 456 ENFS----SPIESIISEDELDNDQYSKVYG-KRNNSIGQSKTSLS--------------I 496

Query: 581 KPKVYE--YSNNIPALFRIS---CDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDAL 635
           KP + E  Y+N IP LF+I+   C + +  +  G    P   Y  P   NRV+DCNQD L
Sbjct: 497 KPCISEVTYTNEIPQLFKITDNNCIVNENYERYGFVEPPS--YGEPGLENRVIDCNQDIL 554

Query: 636 FGDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIF------HEFHQVAGPSTQD 689
           F   Q+ G +D E AE LFL+KY VPDLPV+L+S +  K+F         + + G   Q 
Sbjct: 555 FATFQQNGAVDVELAEQLFLEKYPVPDLPVFLDSHFSEKLFDNNDSSKNLNDMNGEDIQI 614

Query: 690 SSINHIIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAP 734
            +    IPHVNL H+LT+ I +G++SVACTTRY  KF+T ++Y+P
Sbjct: 615 KNNGQDIPHVNLNHVLTNKISNGMISVACTTRYKRKFVTHILYSP 659

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 90/166 (54%), Gaps = 13/166 (7%)

Query: 586 EYSNNIPALFRIS-CDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQKGGK 644
           +Y+N IP LF+ S  ++ ++  +          Y  PSF N +VDC+Q+ LF  LQ+ G 
Sbjct: 481 KYTNQIPELFKFSEKNIRELSTETEITFLEPPSYGEPSFYNNIVDCSQEKLFLSLQQNGA 540

Query: 645 MDAEEAENLFLKKYQVPDLPVYL----------NSTYLNKIFHEFHQVAG--PSTQDSSI 692
           +D+  AE + L++Y V +LP++           ++  LNK     H + G  P+  D+  
Sbjct: 541 VDSYVAEQVILQRYPVSELPIFFENISMEKLASHNNNLNKSHTNKHWLEGLTPNESDNIT 600

Query: 693 NHIIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGND 738
               PHV L HL+T  I   +VSVA TTRY  K+ITQ++Y+P   D
Sbjct: 601 PKEPPHVILNHLVTQKISRNVVSVAVTTRYKQKYITQILYSPIKPD 646

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 12/121 (9%)

Query: 349 RTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSY 408
           +T V L+W DS+ + NN +  V ++S +I   +              ++N +  ++PL Y
Sbjct: 311 KTRVTLRWIDSKFKPNNYQ-SVSIISEDIIDVIN----------FYRSNNDKIKRLPLKY 359

Query: 409 DSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDF-LPTATDDQGNIMNWFEVLRGYDRIE 467
           DS  +EW + DL+LP G Y   FL+N   VH    + T  D  G  +N+FEV +     E
Sbjct: 360 DSLTHEWKISDLFLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFE 419

Query: 468 P 468
           P
Sbjct: 420 P 420

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 67/140 (47%), Gaps = 19/140 (13%)

Query: 330 GQRTPNNSAHVHSESPSPDRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFA 389
           GQR P      H       RT V L++RDS          V +   +I + L+   K+  
Sbjct: 56  GQRVP------HFYRQPRRRTKVKLRFRDSHTIPFRVH-SVAIQGTDITSKLQRTGKM-- 106

Query: 390 EGKLLATDNSQFNKIPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNL-VHSDFLPTATD 448
            G L         +IPL ++  ++EW  PDLYLP G Y+ +F++N    +HS++LP  T 
Sbjct: 107 -GGL--------QQIPLQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTV 157

Query: 449 DQGNIMNWFEVLRGYDRIEP 468
             G   N+F V+   + +EP
Sbjct: 158 GDGIAYNYFVVIENDEVVEP 177

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 68/161 (42%), Gaps = 33/161 (20%)

Query: 579 PIKPKVYEYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGD 638
           P+  +V EY+N I  LF   CD + +  D+  +  P+   ++ +F        QDA  GD
Sbjct: 190 PLGARV-EYTNEILPLFEGYCDSQQI--DHTAQYKPKTHMNQKTFFYYAFQ-EQDAASGD 245

Query: 639 LQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP- 697
                  DA+     F ++Y VP +P Y  S  +             + QD+++   +P 
Sbjct: 246 ------YDAQ-----FCERYTVPIIPPYFYSIDI-------------TPQDNTLKVPLPI 281

Query: 698 -HVNLKHLLTSS---IRDGIVSVACTTRYAGKFITQVIYAP 734
              NL   +  S   I +  + + C   Y GK++  + Y P
Sbjct: 282 QLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 80/170 (47%), Gaps = 19/170 (11%)

Query: 578 PPIKPKVYEYSNN-----IPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQ 632
           PP+ P+V   S +     + A  RI+ ++E   DD G  N    F+D      +  +  Q
Sbjct: 252 PPLTPQVSGKSGDERKEPMSARSRIALEIEREPDDLG--NGYSRFHDTSPLETKY-EYTQ 308

Query: 633 D--ALFGD----LQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPS 686
           D  A+F D     Q    +D ++  +  +     P LP +L     N I + +    G S
Sbjct: 309 DIPAVFTDPNVMEQYYLTLDQQKNNHQNMAWLTPPQLPPHLE----NVILNSYSNAQGES 364

Query: 687 TQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
            +++S    IP HV L HL TSSI+   + VA   RY  K++TQ++YAP 
Sbjct: 365 NENNSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 414

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV--LRGYDRIEP 468
           L LP G +R +F+V+  L  SDFLPTATD  GN +N+ E+  + G D   P
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAPVAGTDEKPP 252

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 70/146 (47%), Gaps = 12/146 (8%)

Query: 596 RISCDMEDVDDDNGTENNPRAFYDR-PSFTNRVVDCNQDALFGDL----QKGGKMDAEEA 650
           RI+ ++E   DD G       F+D  PS  + V   +  A+F D     Q    +D ++ 
Sbjct: 283 RIAFEIEQEPDDMG--GGYTRFHDETPSKPSLVFTRDIPAVFTDPAVMEQYYLTLDQQQN 340

Query: 651 ENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSI 709
            +  +     P LP +L +  LN     +  + G S +++S    IP HV L HL TSSI
Sbjct: 341 NHQNMAWLTPPQLPPHLENVILNS----YSSLQGESNENNSGALPIPNHVILNHLATSSI 396

Query: 710 RDGIVSVACTTRYAGKFITQVIYAPC 735
           +   + VA   RY  K+ TQ++YAP 
Sbjct: 397 KHNTLCVASIVRYKQKYATQILYAPL 422

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 29/41 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G ++ +F+V+  L  SD+LPTATD  GN +N+ EV+
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVV 232

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           L LP G +R +F+V+  L  SDFLPTATD  GN +N+ EV
Sbjct: 271 LQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 18/81 (22%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHI-----IP-HVNLKHLLTSSIRDGIV 714
           P LP +L +  LN            S+QD+S  +      IP HV L HL+T+SI+   +
Sbjct: 431 PQLPPHLENIILN------------SSQDTSNENTSGALPIPNHVVLNHLVTTSIKHNTL 478

Query: 715 SVACTTRYAGKFITQVIYAPC 735
            VA   RY  K++TQ++YAP 
Sbjct: 479 CVASIIRYKHKYVTQILYAPL 499

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 29/40 (72%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           L LP+G +R +F+V+  L  SD+LPTATD  GN +N+ EV
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 696 IP-HVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           IP HV L HL+T+SI+   + VA   RY  K+ TQ++Y P 
Sbjct: 541 IPNHVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTPL 581

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (69%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRG 462
           L LP G +R +F+V+  L  SD+LPTATD  GN +N+ E+ RG
Sbjct: 155 LQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEIGRG 197

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 67/159 (42%), Gaps = 44/159 (27%)

Query: 579 PIKPKVYEYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGD 638
           P+KP+V EY+ +IPA+F     ME                                    
Sbjct: 231 PLKPQV-EYTQDIPAVFTDPSVME------------------------------------ 253

Query: 639 LQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHI-IP 697
            Q    +D ++  +  +     P LP +L    LN     ++ + G S  +++   + IP
Sbjct: 254 -QYYLTLDQQQHNHQNMAWLTPPTLPPHLEDVPLNS----YNGIQGDSNNENNSGALPIP 308

Query: 698 -HVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
            HV L HL TSSI+   + VA   RY  K++TQ++YAP 
Sbjct: 309 NHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 347

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 29/41 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G +R +F+V+  L  SDFLPTATD  GN +N+ EV+
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEVV 242

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP +L +  LN      +  +G   +++S    IP HV L HL TSSI+   + VA  
Sbjct: 362 PQLPPHLENVILNS-----YSGSGSDNENTSGALPIPNHVVLNHLATSSIKHNTLCVASI 416

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K++TQ++YAP 
Sbjct: 417 VRYKSKYVTQILYAPL 432

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G +R +F+V+  L  SDFLPTATD  GN +N+ E++
Sbjct: 241 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 281

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 5/76 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP  L +  LN     +++ A P ++++S    IP HV L HL TSSI+   + VA  
Sbjct: 414 PQLPPQLENVILNN----YNKNAEPGSENNSGALPIPNHVVLNHLATSSIKHNTLCVASI 469

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K+ TQ++YAP 
Sbjct: 470 VRYKRKYATQILYAPL 485

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (60%)

Query: 404 IPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           I L  DS NN  +   L L  G +R +F+V+  L  SDFLPTATD  GN +N+ EV
Sbjct: 190 IGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP  L +  LNK +    Q      +++S    IP HV L HL+TSSI+   + VA  
Sbjct: 341 PQLPPQLENVILNKYYATQDQF----NENNSGALPIPNHVVLNHLVTSSIKHNTLCVASI 396

Query: 720 TRYAGKFITQVIYAP 734
            RY  K++TQ++Y P
Sbjct: 397 VRYKQKYVTQILYTP 411

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G +R +F+V+  L  SDFLPTATD  GN +N+ E++
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 208

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIPHVNLKHLLTSSIRDGIVSVACTT 720
           P LP +L +  LN    +       S  +S    I  HV L HL TSSI+   + VA   
Sbjct: 354 PQLPPHLENVILNNYSSQSEPGDSGSENNSGALPIPNHVVLNHLATSSIKHSTLCVASIV 413

Query: 721 RYAGKFITQVIYAPC 735
           RY  K+ TQ++Y+P 
Sbjct: 414 RYKRKYATQILYSPL 428

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP +L +  LN     +    G S +++S    IP HV L HL TSSI+   + VA  
Sbjct: 337 PQLPPHLENVILNS----YSNSQGESNENTSGALPIPNHVILNHLATSSIKHNTLCVASI 392

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K++TQ++YAP 
Sbjct: 393 VRYRQKYVTQILYAPL 408

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G +R +F+V+  L  SD+LPTATD  GN +N+ EV+
Sbjct: 178 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 218

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G +R +F+V+  L  SDFLPTATD  GN +N+ E++
Sbjct: 217 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIV 257

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (56%), Gaps = 5/76 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP +L    LN     +++ A  +++++S    IP HV L HL TSSI+   + VA  
Sbjct: 378 PQLPPHLEHVILN----HYNKSADGASENTSGALPIPNHVVLNHLATSSIKHNTLCVASI 433

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K+ TQ++YAP 
Sbjct: 434 VRYKSKYATQILYAPL 449

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G +R +F+V+  L  SD+LPTATD  GN +N+ EV+
Sbjct: 187 LQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 227

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP +L +  LN     +      S +++S    IP HV L HL TSSI+   + VA  
Sbjct: 332 PQLPPHLENVPLNS----YTNSQNDSNENNSGALPIPNHVVLNHLATSSIKHNTLCVASI 387

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K++TQ++YAP 
Sbjct: 388 VRYKRKYVTQILYAPL 403

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYD-RIEPYRDESEIQSD 478
           L LP G +R +F+V+  L  SD+LPTATD  GN +N+ EV    D   EP +  S+ +++
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSSEPQQQGSDNKAN 263

Query: 479 Y 479
           Y
Sbjct: 264 Y 264

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 596 RISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGD----LQKGGKMDAEEAE 651
           RI+ ++E   DD G +   R   + P+  N     +  A+F D     Q    +D ++  
Sbjct: 280 RIALEIEKEPDDMG-DGYTRFHDETPAKPNLEYTQDIPAVFTDPNVMEQYYLTLDQQQNN 338

Query: 652 NLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIR 710
           +  +     P LP +L +  LN         +   T ++S    IP HV L HL TSSI+
Sbjct: 339 HQNMAWLTPPQLPPHLENVILNSY-------SNAQTDNTSGALPIPNHVILNHLATSSIK 391

Query: 711 DGIVSVACTTRYAGKFITQVIYAPC 735
              + VA   RY  K++TQ++Y P 
Sbjct: 392 HNTLCVASIVRYKQKYVTQILYTPL 416

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 591 IPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQD--ALFGDL----QKGGK 644
           I A  RI+ ++E   DD G     R   + P   N  ++  QD  A+F D     Q    
Sbjct: 287 ISARSRIALEIEREPDDIGNGFT-RFRGETPLLKN--IEYTQDIPAVFTDPTVMEQYYLT 343

Query: 645 MDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKH 703
           +D ++  +  +     P LP +L +  LN     +    G + +++S    IP HV L H
Sbjct: 344 LDQQQNNHQNMAWLTPPQLPPHLENVILNS----YSNSQGTNNENNSGALPIPNHVILNH 399

Query: 704 LLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           L TSSI+   + VA   RY  K++TQ++YAP 
Sbjct: 400 LATSSIKHNTLCVASIVRYKRKYVTQILYAPL 431

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           L LP G +R +F+V+  L  SD+LPTATD  GN +N+ E+
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRD 471
           L LP G ++ +F+V+  L  SDFLPTATD  GN +N+ EV    + +E  +D
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKD 244

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 27/37 (72%)

Query: 698 HVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAP 734
           +V L HLLTSSI++ ++ + C+ RY  K++TQV Y P
Sbjct: 351 YVTLNHLLTSSIKNNMLCLGCSVRYRQKYVTQVYYTP 387

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 29/41 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G +R +F+V+  L  SD+LPTATD  GN +N+ E++
Sbjct: 253 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIV 293

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP +L +  LN       Q      +++S    IP HV L HL TSSI+   + VA  
Sbjct: 427 PQLPPHLENVILNNYSANSAQAEESGGENNSGALPIPNHVVLNHLATSSIKHNTLCVASI 486

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K+ TQ++YAP 
Sbjct: 487 VRYKSKYATQILYAPL 502

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 28/40 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           L LP G +R +F+V+  L  SD+LPTATD  GN +N+ EV
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 244

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 596 RISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDL----QKGGKMDAEEAE 651
           RI+ ++E   DD G +   R   + PS  N     +  A+F D     Q    +D ++  
Sbjct: 281 RIALEIEKEPDDMG-DGYTRFHDETPSKPNLEYTQDIPAVFTDPNVMEQYYLTLDQQQNN 339

Query: 652 NLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIR 710
           +  +     P LP +L +  LN         +   T ++S    IP HV L HL TSSI+
Sbjct: 340 HQNMAWLTPPQLPPHLENVILNS-------YSNAQTDNTSGALPIPNHVILNHLATSSIK 392

Query: 711 DGIVSVACTTRYAGKFITQVIYAPC 735
              + VA   RY  K++TQ++Y P 
Sbjct: 393 HNTLCVASIVRYKQKYVTQILYTPL 417

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 67/159 (42%), Gaps = 45/159 (28%)

Query: 579 PIKPKVYEYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGD 638
           P+KP++ EY+ +IPA+F     ME                                    
Sbjct: 319 PLKPQL-EYTQDIPAVFTDPTVME------------------------------------ 341

Query: 639 LQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPST-QDSSINHIIP 697
            Q    +D ++  +  L     P LP +L +  LN      +    P T Q++S +  IP
Sbjct: 342 -QYYLTLDQQQNNHQNLSWLTPPQLPPHLENVILNS-----YSSNSPETGQNNSGSLPIP 395

Query: 698 -HVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
            HV L HL TSSI+   + VA   RY  K++TQ++YAP 
Sbjct: 396 NHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 434

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G ++ +F+V+  L  SDFLPTATD  GN +N+ E +
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 218

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP  L +  LNK +    Q      +++S    IP HV L HL+TSSI+   + VA  
Sbjct: 367 PQLPPQLENVILNKYYATQDQF----NENNSGALPIPNHVVLNHLVTSSIKHNTLCVASI 422

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K++TQ++Y P 
Sbjct: 423 VRYKQKYVTQILYTPI 438

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 404 IPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           I L  D++ N  +   L L  G +R +F+V+  L  SDFLPTATD  GN +N+ EV
Sbjct: 216 IGLIPDANKNGLFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 271

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 28/40 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           L LP G +R +F+V+  L  SD+LPTATD  GN +N+ EV
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 246

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP +L +  LN     +      + +++S    IP HV L HL TSSI+   + VA  
Sbjct: 351 PQLPPHLENVILNN----YSNAQTDNNENTSGALPIPNHVILNHLATSSIKHNTLCVASI 406

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K++TQ++Y P 
Sbjct: 407 VRYKQKYVTQILYTPL 422

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 28/40 (70%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           L LP G +R +F+V+  L  SD+LPTATD  GN +N+ EV
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 243

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 596 RISCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDL----QKGGKMDAEEAE 651
           RI+ ++E   DD G +   R   + P+  N     +  A+F D     Q    +D ++  
Sbjct: 280 RIALEIEKEPDDMG-DGYTRFHDETPAKPNLEYTQDIPAVFTDPNVMEQYYLTLDQQQNN 338

Query: 652 NLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIR 710
           +  +     P LP +L +  LN         +   T ++S    IP HV L HL TSSI+
Sbjct: 339 HQNMAWLTPPQLPPHLENVILNS-------YSNAQTDNTSGALPIPNHVILNHLATSSIK 391

Query: 711 DGIVSVACTTRYAGKFITQVIYAPC 735
              + VA   RY  K++TQ++Y P 
Sbjct: 392 HNTLCVASIVRYKQKYVTQILYTPL 416

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 404 IPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           IP++   H N  +V  L LP G +R +F+V+  L  SD+LPTATD  GN +N+ E+
Sbjct: 238 IPVA--GHPNLLHV-KLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (65%)

Query: 698 HVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           HV L HL TSSI+   + VA   RY  K++TQ++YAP 
Sbjct: 465 HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 411 HNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           H+  ++V    LP G +R +F+V+  L  SDFLPTATD  GN +N+ EV
Sbjct: 198 HSGAFHVKLRLLP-GTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query: 696 IP-HVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           IP HV L HL+TSSI+   + VA   RY  K++TQ++YAP 
Sbjct: 372 IPNHVVLNHLITSSIKHNTLCVASIVRYKQKYVTQILYAPI 412

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G ++ +F+V+  L  SDFLPTATD  GN +N+ E +
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 223

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (65%)

Query: 698 HVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735
           HV L HL TSSI+   + VA   RY  K++TQ++YAP 
Sbjct: 386 HVVLHHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 423

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP +L    LN     +++ A   ++++S    IP HV L HL TSSI+   + VA  
Sbjct: 403 PQLPPHLEHVILN----HYNKSADGVSENTSGALPIPNHVVLNHLATSSIKHNTLCVASI 458

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K+ TQ++YAP 
Sbjct: 459 VRYKQKYATQILYAPL 474

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVL 460
           L LP G +R +F+V+  L  SDFL TATD  GN +N+ E++
Sbjct: 236 LQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIV 276

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 8/77 (10%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHI-IP-HVNLKHLLTSSIRDGIVSVAC 718
           P +P + +   LN       Q +   T DS+   + IP HV L HL+ +S++  +++++ 
Sbjct: 277 PQIPPHFDVVILND------QNSLQHTDDSNAGFLPIPNHVVLNHLIVNSVKSNMLAIST 330

Query: 719 TTRYAGKFITQVIYAPC 735
           TTRY  KFITQV Y+P 
Sbjct: 331 TTRYKEKFITQVCYSPI 347

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%)

Query: 412 NNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           N +W    L LP G +R +F+V+  L  SD +P+ATD  GN++N+ EV
Sbjct: 140 NPDWARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEV 187

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP  L +  LNK      QV     +++S    IP HV L HL+TSSI+   + V+  
Sbjct: 340 PQLPPQLENVILNKYCTTQDQV----NENNSGALPIPNHVVLNHLITSSIKHNTLCVSSI 395

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K++TQ++Y P 
Sbjct: 396 VRYKQKYVTQILYTPI 411

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%)

Query: 404 IPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           I L  DS  +  +   L L  G +R +F+V+  L  SDFLPTATD  GN +N+ EV
Sbjct: 189 IGLVPDSDKSGSFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 244

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP +L +  LN  +       G  ++++S    IP HV L HL TSSI+   + VA  
Sbjct: 341 PQLPPHLENVILNN-YSNSSDPGGSGSENNSGALPIPNHVVLNHLATSSIKHNTLCVASI 399

Query: 720 TRYAGKFITQVIYAPC 735
            RY  K+ TQ++Y+P 
Sbjct: 400 VRYKRKYATQILYSPL 415

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 27/40 (67%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           L LP G +R +F+V+  L  SD+L TATD  GN +N+ E+
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEI 207

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 661 PDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSINHIIP-HVNLKHLLTSSIRDGIVSVACT 719
           P LP  L +  LNK    F +    ST++++    IP H  L HL+T+SI+   + VA  
Sbjct: 361 PQLPPQLENVILNK----FGEPLSQSTENNAGALPIPNHSVLNHLVTTSIKHNTLCVATN 416

Query: 720 TRYAGKFITQVIYAP 734
            RY  K+++Q+ Y P
Sbjct: 417 NRYRQKYVSQIYYVP 431

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 420 LYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEV 459
           L L  G +R +F+V+  L  SD LPTATD  GN +N+ EV
Sbjct: 213 LQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV 252

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 83,230,178
Number of extensions: 4028971
Number of successful extensions: 14740
Number of sequences better than 10.0: 181
Number of HSP's gapped: 15345
Number of HSP's successfully gapped: 235
Length of query: 744
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 627
Effective length of database: 40,065,477
Effective search space: 25121054079
Effective search space used: 25121054079
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)