Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0F03025g5.525ON92892847000.0
KAFR0E033105.525ON93895416660.0
NCAS0F010705.525ON90492916360.0
YDR421W (ARO80)5.525ON95095816100.0
Smik_4.6965.525ON94996916030.0
Suva_2.5985.525ON96596115930.0
NDAI0H015805.525ON90992815780.0
SAKL0G04884g5.525ON93095715630.0
Skud_4.6955.525ON95496015460.0
Kpol_1028.825.525ON92596814860.0
ZYRO0D12518g5.525ON88192814260.0
KNAG0C032505.525ON93695214270.0
TPHA0L003505.525ON85991814130.0
TDEL0A038905.525ON83191913741e-176
KLLA0A01804g5.525ON94598513771e-175
KLTH0G03718g5.525ON85779112741e-161
TBLA0D016705.525ON101881412111e-150
ADR199C5.525ON94469911081e-135
NCAS0A125802.547ON704521010.003
CAGL0L09691g2.654ON82445980.006
CAGL0H06875g8.879ON70238960.011
Kwal_27.96888.879ON84159930.022
YLL054Cna 1ON84346920.031
SAKL0D00264g8.879ON84842910.037
Kpol_1002.52.547ON95873900.060
Kwal_26.7397singletonOFF20135860.062
KLLA0F14322g1.277ON71735890.069
NDAI0E034608.423ON94987890.072
KAFR0E013005.322ON82738890.073
TPHA0C021808.423ON88666890.076
KAFR0B014502.547ON108845890.076
Kpol_455.108.879ON83042890.077
NDAI0K001508.879ON95354890.081
TPHA0C049808.879ON85242880.091
Suva_10.18na 1ON84235880.093
KNAG0B023807.389ON106735860.14
KNAG0M00120singletonON88146860.14
CAGL0L01903g2.547ON128752860.15
KLTH0D03564g1.277ON86242860.17
SAKL0A09856g2.547ON102045850.20
Kpol_1001.34.344ON85673850.21
NCAS0F027005.322ON83538850.21
NDAI0C002602.654ON104176850.22
KNAG0A025508.423ON73059850.23
KLLA0F00572gna 2ON59754840.23
KLTH0D07260g2.547ON97952850.23
TBLA0A007302.654ON103744850.23
ZYRO0E00572g2.654ON83844850.23
KLTH0E16500g8.879ON83338840.25
KAFR0L021308.879ON88238840.25
KAFR0H018008.423ON79484840.25
AAL175W8.879ON88338830.32
TPHA0B015854.344ON81246830.32
SAKL0G02992gna 3ON106152830.34
Ecym_81598.879ON90838830.35
Smik_12.6na 1ON84546830.36
SAKL0D05654g1.277ON91935830.37
TBLA0C040504.113ON120759830.40
KLLA0E02663gna 3ON110948830.40
NDAI0K018002.547ON121045830.41
ACL195Cna 4ON10942760.45
NDAI0B016802.547ON92445820.45
TBLA0F012003.109ON108643820.49
NCAS0H00780singletonON90937820.51
Ecym_63401.277ON95240820.53
Ecym_6141na 4ON11442750.59
SAKL0H14014gsingletonON69142810.59
NDAI0G055301.277ON118635810.60
KNAG0G021308.283ON63237810.61
TPHA0M010403.264ON77044810.61
NDAI0D00900singletonON86540810.65
CAGL0H04367g4.344ON94546810.70
Skud_9.220singletonON79341800.71
NCAS0C027308.423ON77588800.73
TBLA0D054201.277ON75735800.79
TDEL0B004808.879ON83542800.83
AFR096W1.277ON85240800.88
NCAS0C002208.879ON83954790.98
KAFR0I002804.344ON93673791.1
Skud_11.1902.547ON117145791.1
TDEL0B074902.654ON86544781.2
TDEL0D014501.277ON94535781.2
Kpol_538.528.879ON90763781.2
NDAI0E038507.56ON76838781.2
KNAG0J002108.879ON86142781.3
CAGL0A04455g7.389ON109838781.3
KLLA0F04213g3.264ON76844781.3
SAKL0G18062g4.351ON123885781.3
TBLA0H006808.423ON88054781.3
AER153W4.344ON74876781.4
TBLA0E047504.344ON128346781.4
NCAS0A047502.547ON114145781.5
Ecym_11354.344ON82266781.5
Smik_11.2102.547ON116945781.5
Ecym_41448.423ON84047781.5
KLLA0F02750g3.109ON114843781.6
TBLA0I025408.423ON125943781.6
Skud_9.2042.651ON100949771.7
AGL091W8.423ON86649771.7
Kwal_26.81092.547ON97052771.7
NDAI0D031804.344ON98973771.7
Skud_2.397.389ON115938771.8
Suva_2.3818.423ON91857771.9
Smik_4.2693.264ON77844771.9
Skud_4.4758.423ON91357772.0
YKL038W (RGT1)2.547ON117045772.0
SAKL0H25146gna 5ON64551762.0
Suva_9.2392.651ON97149772.1
ZYRO0E05676g2.547ON106645762.2
Smik_17.27singletonON68855762.3
YIR023W (DAL81)2.651ON97045762.4
KAFR0C039002.654ON81851762.5
Suva_2.517.389ON115538762.6
ZYRO0A13596gsingletonON64845752.7
NDAI0I023505.235ON88935752.9
YBL066C (SEF1)7.389ON114838752.9
TBLA0C037406.170ON29351743.0
Smik_2.507.389ON115038753.2
SAKL0D14916gna 2ON63240753.3
SAKL0B01870gsingletonON100966753.4
KAFR0L017207.389ON94135753.4
NCAS0A061904.344ON89473753.5
Suva_15.415na 6ON86743743.6
ZYRO0A10956g5.235ON85538743.7
Kwal_YGOB_gneas1na 4ON51958743.7
TBLA0G026102.231ON100050743.8
Smik_25.2singletonON78537744.0
KLTH0F03014gsingletonON61251744.4
KLLA0F25630g2.547ON100747744.7
Kwal_23.6529na 7ON59844734.8
TPHA0J010307.267ON39844734.8
TDEL0D036103.264ON72444734.8
KNAG0M003504.351ON107685734.9
KLTH0F03300gna 4ON51836735.0
NCAS0H011306.170ON28072725.2
SAKL0G17908g4.344ON80973735.4
Kwal_26.7095na 8ON83848735.7
Kwal_56.223276.4ON560107726.2
Ecym_72392.547ON106445726.7
Kpol_2001.161.199ON80263726.9
KLLA0D01485g8.844ON115145728.0
KLTH0E03256gsingletonON67456718.3
Suva_11.1872.547ON117145718.5
Skud_5.331singletonON17041688.7
TPHA0B004104.344ON94548719.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F03025g
         (928 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...  1815   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   646   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   634   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...   624   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...   622   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...   618   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   612   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   606   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...   600   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   577   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   553   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   554   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     548   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   533   e-176
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   535   e-175
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   495   e-161
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   471   e-150
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   431   e-135
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    44   0.003
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    42   0.006
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    42   0.011
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    40   0.022
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    40   0.031
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    40   0.037
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    39   0.060
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    38   0.062
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    39   0.069
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     39   0.072
KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON} Anc_5.3...    39   0.073
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    39   0.076
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    39   0.076
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    39   0.077
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    39   0.081
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    39   0.091
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    39   0.093
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    38   0.14 
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      38   0.14 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    38   0.15 
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    38   0.17 
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    37   0.20 
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    37   0.21 
NCAS0F02700 Chr6 complement(547682..550189) [2508 bp, 835 aa] {O...    37   0.21 
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    37   0.22 
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    37   0.23 
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    37   0.23 
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    37   0.23 
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    37   0.23 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    37   0.23 
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    37   0.25 
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    37   0.25 
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    37   0.25 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    37   0.32 
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     37   0.32 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    37   0.34 
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    37   0.35 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    37   0.36 
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    37   0.37 
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    37   0.40 
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    37   0.40 
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    37   0.41 
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    34   0.45 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     36   0.45 
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    36   0.49 
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    36   0.51 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    36   0.53 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    33   0.59 
SAKL0H14014g Chr8 complement(1196584..1198659) [2076 bp, 691 aa]...    36   0.59 
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            36   0.60 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    36   0.61 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    36   0.61 
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               36   0.65 
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    36   0.70 
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    35   0.71 
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     35   0.73 
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    35   0.79 
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    35   0.83 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    35   0.88 
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       35   0.98 
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    35   1.1  
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    35   1.1  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    35   1.2  
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    35   1.2  
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    35   1.2  
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      35   1.2  
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    35   1.3  
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    35   1.3  
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    35   1.3  
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    35   1.3  
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    35   1.3  
AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic ho...    35   1.4  
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    35   1.4  
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    35   1.5  
Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}...    35   1.5  
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    35   1.5  
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    35   1.5  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    35   1.6  
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    35   1.6  
Skud_9.204 Chr9 (367291..370320) [3030 bp, 1009 aa] {ON} YIR023W...    34   1.7  
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    34   1.7  
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    34   1.7  
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    34   1.7  
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    34   1.8  
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    34   1.9  
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    34   1.9  
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    34   2.0  
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    34   2.0  
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    34   2.0  
Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa...    34   2.1  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    34   2.2  
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    34   2.3  
YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Posit...    34   2.4  
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    34   2.5  
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    34   2.6  
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    33   2.7  
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     33   2.9  
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    33   2.9  
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    33   3.0  
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    33   3.2  
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    33   3.3  
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    33   3.4  
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    33   3.4  
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    33   3.5  
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    33   3.6  
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    33   3.7  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    33   3.7  
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    33   3.8  
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     33   4.0  
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    33   4.4  
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    33   4.7  
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    33   4.8  
TPHA0J01030 Chr10 (239778..240974) [1197 bp, 398 aa] {ON} Anc_7....    33   4.8  
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    33   4.8  
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    33   4.9  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    33   5.0  
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    32   5.2  
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    33   5.4  
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    33   5.7  
Kwal_56.22327 s56 complement(48538..50220) [1683 bp, 560 aa] {ON...    32   6.2  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    32   6.7  
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    32   6.9  
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...    32   8.0  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    32   8.3  
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    32   8.5  
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    31   8.7  
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    32   9.4  

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score = 1815 bits (4700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 886/928 (95%), Positives = 886/928 (95%)

Query: 1   MDNKIVKPVPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPP 60
           MDNKIVKPVPKKKSRSTTPV         KHKNTFGACLRCKYKKIKCDLGPADRPVSPP
Sbjct: 1   MDNKIVKPVPKKKSRSTTPVGGSSSSQGQKHKNTFGACLRCKYKKIKCDLGPADRPVSPP 60

Query: 61  CAACRRSRSHCFFNAPKVKIGKLGNILDXXXXXXXXXXXXXXXXMLNAITQSLQNHRAMN 120
           CAACRRSRSHCFFNAPKVKIGKLGNILD                MLNAITQSLQNHRAMN
Sbjct: 61  CAACRRSRSHCFFNAPKVKIGKLGNILDSQGLQSSQSTSPTSASMLNAITQSLQNHRAMN 120

Query: 121 GNQNMHLNNLSNLVGLKNQNLEGVSLNSPNTALIEACDRVKSDTAWKLELTSMQSALEFL 180
           GNQNMHLNNLSNLVGLKNQNLEGVSLNSPNTALIEACDRVKSDTAWKLELTSMQSALEFL
Sbjct: 121 GNQNMHLNNLSNLVGLKNQNLEGVSLNSPNTALIEACDRVKSDTAWKLELTSMQSALEFL 180

Query: 181 AKATKLRNDYKNNEPFGSTRSDAASTTSETRDLSEKDNGNEXXXXXXXXXXXXXXXXXYP 240
           AKATKLRNDYKNNEPFGSTRSDAASTTSETRDLSEKDNGNE                 YP
Sbjct: 181 AKATKLRNDYKNNEPFGSTRSDAASTTSETRDLSEKDNGNESDSTTNSTSKDTSTRSSYP 240

Query: 241 SIEAIKPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELF 300
           SIEAIKPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELF
Sbjct: 241 SIEAIKPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELF 300

Query: 301 KYPLLLHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRS 360
           KYPLLLHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRS
Sbjct: 301 KYPLLLHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRS 360

Query: 361 IGTTLAFLLFTEWNPRAIHWEVSDTAHYLSDNNVSSSKEDPDGLGGIATVKRSDRMAWMF 420
           IGTTLAFLLFTEWNPRAIHWEVSDTAHYLSDNNVSSSKEDPDGLGGIATVKRSDRMAWMF
Sbjct: 361 IGTTLAFLLFTEWNPRAIHWEVSDTAHYLSDNNVSSSKEDPDGLGGIATVKRSDRMAWMF 420

Query: 421 TGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNP 480
           TGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNP
Sbjct: 421 TGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNP 480

Query: 481 KSQDDIENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDEYSI 540
           KSQDDIENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDEYSI
Sbjct: 481 KSQDDIENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDEYSI 540

Query: 541 NYLDENSSFLKNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDV 600
           NYLDENSSFLKNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDV
Sbjct: 541 NYLDENSSFLKNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDV 600

Query: 601 LSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTANIRGESFISDYYYCQLYTFSL 660
           LSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTANIRGESFISDYYYCQLYTFSL
Sbjct: 601 LSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTANIRGESFISDYYYCQLYTFSL 660

Query: 661 ALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRS 720
           ALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRS
Sbjct: 661 ALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRS 720

Query: 721 ASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASK 780
           ASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASK
Sbjct: 721 ASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASK 780

Query: 781 FSTILMFLCKEIDERKRDNENLMTGNGLNNDPSLESQTTHKESLEASNHDTISSDAQEPP 840
           FSTILMFLCKEIDERKRDNENLMTGNGLNNDPSLESQTTHKESLEASNHDTISSDAQEPP
Sbjct: 781 FSTILMFLCKEIDERKRDNENLMTGNGLNNDPSLESQTTHKESLEASNHDTISSDAQEPP 840

Query: 841 SENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTE 900
           SENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTE
Sbjct: 841 SENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTE 900

Query: 901 LIEQKYIQNKDGFQDFDQLFDEFAIRPS 928
           LIEQKYIQNKDGFQDFDQLFDEFAIRPS
Sbjct: 901 LIEQKYIQNKDGFQDFDQLFDEFAIRPS 928

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/954 (38%), Positives = 555/954 (58%), Gaps = 104/954 (10%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDX 89
           K + ++ ACL C+ +K+KCDLGP D P  PPC  C+R +  C F + + K   +      
Sbjct: 15  KWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLFTSRRKKKDDV------ 68

Query: 90  XXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSP 149
                          + +AITQ   N R       + LN+     G     L   S  +P
Sbjct: 69  ------ISGTVSLTNVPSAITQEDDNDR-------IQLNS-----GSSKGALFSNSPKNP 110

Query: 150 NTALIEACDRVKSDTAWKLELTSMQSALEFLAKA------------TKLRNDYK-NNEPF 196
           NT         +  + WK  L SMQ+ LEFLA A            T  R+ ++   E  
Sbjct: 111 NT---------QDQSKWKYGLGSMQNTLEFLATAAGSVSKESNRRLTTARHSHQYAKETS 161

Query: 197 GSTRSDAASTTSETRDLSEKDNGNEXXXXXXXXXXXXXXXXXYPSIEAIKPEVPTPSNHN 256
              R D +S +SE +D+++    +                     +  ++P+ P     +
Sbjct: 162 EDFRVDDSSPSSERKDITDTSEQSVIAPLLKECGTQRATVSLIEELSRVRPK-PNKKLAD 220

Query: 257 YDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARY 316
            D +G   L++  EAR L++ +F  MHPF+P IPL LQD DEL  YP+LL  IL +S+RY
Sbjct: 221 IDYIGPSNLLSEQEARELIDAYFLTMHPFFPNIPLQLQDPDELVNYPILLCAILTMSSRY 280

Query: 317 NPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPR 376
           +PF + GF NG    RN+ +H  LW +CQ+L+SQTVW++ASTRSIGT LAF++FTEWNPR
Sbjct: 281 HPFSEFGFYNGENNKRNIEVHETLWDYCQRLISQTVWAEASTRSIGTVLAFIIFTEWNPR 340

Query: 377 AIHWEVSDTAHYLS-DNNVSSSKEDPDGLGGIATVKRSDRMAWMFTGTAIRLAQEMDILE 435
            IHW  +D A+    D +V  S++D DGL GI  ++RSDRM+WM TG+A+RLAQ+M  +E
Sbjct: 341 QIHWRRTDYANSAEKDTDVPHSQKDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDMGFIE 400

Query: 436 NNAKIYTAANIAEICYASNMNLKPTLGE--SLVSIDGGMKEFE-IDNPKSQ-DDIENEDL 491
            + KI+ A++I++   + NMN +  L E  S+V    G +    ID+ ++  D++ NE  
Sbjct: 401 TSTKIFVASHISDTFASMNMNQRCALSETFSVVGFGAGRERASAIDSEQTDVDEVGNEKF 460

Query: 492 LKFVQLVAQNKESTKKW--AIHKAYSDKLKEENPDLIIDLETEFLNDEYSINYLDENSSF 549
             +++ + QN+ES ++W   + +   +  K+  P  + DLE EFLNDEY + Y + N   
Sbjct: 461 --YLEQMLQNEESRERWTRVLERLQHNNDKKNGP--LTDLEREFLNDEYVLYYANRNDEM 516

Query: 550 LKN------PIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVLSP 603
           ++       P+ ++ +Q+A++EL+RI+ I Y TIYY+K K++++S DQ  NL +L +LSP
Sbjct: 517 VQQHLQLPFPLKFSFHQRAKIELIRIILIAYDTIYYDKGKRKLTSNDQVHNLAVLGILSP 576

Query: 604 ILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTAN-----IRGESFISDYYYCQLYTF 658
           ++  WY  Y  L+K +S  +P  I   ++ K KR  +     I  ES +SDYYYCQLY +
Sbjct: 577 LIEGWYATYRNLLK-ISSGQPYSI---EIRKNKRAVHELGEEINRESILSDYYYCQLYIY 632

Query: 659 SLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIV 718
           SLALQV+VK  KL +NE  KSA++VE AY AAKEIL S+ RVH++ MLKYMPVRWVMRIV
Sbjct: 633 SLALQVDVKGPKLRINEATKSAKYVELAYVAAKEILISSTRVHRLKMLKYMPVRWVMRIV 692

Query: 719 RSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLA 778
           R+ SF+VKCY+TL       NSEA++ILKL  I +D+T+H IR AA+ILKE++PDELHL 
Sbjct: 693 RAVSFLVKCYLTLTGGGGVPNSEAQTILKLCCISLDETIHTIRLAALILKEASPDELHLC 752

Query: 779 SKFSTILMFLCKEIDERKRDNENLMTGNG--LNNDPSLESQTTHKESLEASNHDTISSDA 836
            ++S IL++LCKE++ + + N+ L+  +G  +N   + +  +   ++ + S+ D  S+D 
Sbjct: 753 VRYSAILLYLCKEMNLKSKRNQKLLVSHGILINESRNRQMGSRRTKATQDSDIDLGSTDD 812

Query: 837 QEPPSENDS---SHDTTTQGTANS-----------------TRKVG---PNSIDEIG--- 870
            +    N+    ++ +TT G   S                 T  V    PN++D  G   
Sbjct: 813 SKNIQSNNELLPNNISTTNGLTTSLFNTEEMRSETPNQRIPTSAVADNTPNNLDNDGTNN 872

Query: 871 --QFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDGFQDFDQLFDE 922
              F + LP++ IDWFS S +IGLDFVEPWTEL+EQ+++Q+ DG   F++L+++
Sbjct: 873 PTNFPS-LPDEAIDWFSGSADIGLDFVEPWTELLEQRFLQSGDGNNIFEELYNQ 925

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/929 (40%), Positives = 544/929 (58%), Gaps = 95/929 (10%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDX 89
           K + +F AC+ C+ +K+KCDLGP + P  PPC  CRR    C F++        GN +  
Sbjct: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSG-------GNGM-- 76

Query: 90  XXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSP 149
                                 S  N   MNG      NN +   G+K      V  NS 
Sbjct: 77  ----------------------SSANLSTMNGK-----NNQATFTGIKRA--LSVDANST 107

Query: 150 NTALIEACDRVKSDTA--------WKLELTSMQSALEFLAKATKLRNDYKNNEPFGST-- 199
             +        K++          WKLEL SMQ++LEFLAKA        N E F  T  
Sbjct: 108 LNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAK 167

Query: 200 --RSDAASTTSET-RDLSEKDNGNEXXXXXXXXXXXXXXXXXYPSIE---AIKPEVPTPS 253
             ++ A++ TSE    + ++D+ NE                  P +E   +I+P+  + +
Sbjct: 168 LAKNGASNDTSENDTPVQQQDSPNENYLTPLTTPHNSRRSA-LPQLEKSISIRPK-SSQT 225

Query: 254 NHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAIS 313
             + + +G  KL++ +EAR L+++FF  M+PF+P+IPL LQD DEL +YP+LL  IL IS
Sbjct: 226 LSDMEFIGPSKLLSEEEARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTIS 285

Query: 314 ARYNPFDKVGFDNGIEGN--RNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFT 371
           +RY+PFD+    NG  G   RN+ +H KLW +CQ+L+SQTVW++ASTRSIGT  AF++FT
Sbjct: 286 SRYHPFDEFDGYNGTPGRQKRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFT 345

Query: 372 EWNPRAIHWEVSDTA----HYLSDNNVSSSKE---DPDGLGGIATVKRSDRMAWMFTGTA 424
           EWNPRAIHW+ SD A     Y      S S+E   D DGL GIA ++RSDRMAWM TGTA
Sbjct: 346 EWNPRAIHWKWSDYANNPEQYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTA 405

Query: 425 IRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNPKSQD 484
           +RLAQ++  +E +AK++ A +I+E   A NMN    L +S         E  +D   + +
Sbjct: 406 VRLAQDIGAIETSAKVFVATHISESYTAINMNQGLILSQSF-------NERNLDGIDNLN 458

Query: 485 DIENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDEYSINYLD 544
            ++NE L  +++ + QN ES  +W       D     + + + D+E EFLNDEY++ Y D
Sbjct: 459 GVDNERL--YLEQILQNDESKARWNGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYAD 516

Query: 545 ENSSFLKN-----PIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILD 599
            +    ++     P+ +T+ QKA+LELLRI+ + Y+TIYYEK  +R+ S DQ+ NL +L+
Sbjct: 517 HDEDTQQHTQQIIPLKFTSTQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLN 576

Query: 600 VLSPILNAWYLNYYKLMKPVSDEKPVIISLDDL----SKFKRTANIRGESFISDYYYCQL 655
           +L+P++ +WY NY  L++    E   ++SL+        F+ +  I  E+ ISDYYYCQL
Sbjct: 577 ILAPLIESWYNNYRSLLEIREGE---VLSLNQRRNKRKAFEMSRQINTETMISDYYYCQL 633

Query: 656 YTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVM 715
           Y +SLALQV+V+E+KL LNE+ + A FVE+AY AAKEIL+SA RVHK++MLKYMPVRWV+
Sbjct: 634 YIYSLALQVDVEENKLKLNEIRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVL 693

Query: 716 RIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDEL 775
           RIVRS +FIVKCY+TL    ++TN EA +IL+LS I VD+T+  I+ AA+ LKE+ PDEL
Sbjct: 694 RIVRSVAFIVKCYLTLTCSDLSTNPEANTILRLSAISVDETIQTIQTAAITLKEAAPDEL 753

Query: 776 HLASKFSTILMFLCKEIDERKRDNENLMTGNGLNNDPSLESQTTHKESLEASNHDTISSD 835
           HL +++S ILM+LC+E+  R + N N  TG        +E+         ASN   + S 
Sbjct: 754 HLCTRYSAILMYLCREMKLRDKTNNNNNTGENEEQKILIENSNPDGVEGVASNFGNVPST 813

Query: 836 AQEPPSENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFV 895
              PPS    S  TT +  ++     G +S+  + +  + L  +V DWF+   +IGLDFV
Sbjct: 814 L--PPSYAQKS--TTKEQLSDD----GAHSMSFMDEGPS-LSNNVTDWFNVGGDIGLDFV 864

Query: 896 EPWTELIEQKYIQNKDGFQDFDQLFDEFA 924
           EPWTE+IEQ+Y+Q+ D    F++L+ +  
Sbjct: 865 EPWTEMIEQRYLQSGDVNTSFEELYRQLC 893

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/958 (38%), Positives = 553/958 (57%), Gaps = 105/958 (10%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDX 89
           K + T+ AC+ C+ +K+KCDLGP D P  PPCA C+R    C F++ K     L      
Sbjct: 17  KRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIFSSNKGTSNDL------ 70

Query: 90  XXXXXXXXXXXXXXXMLNAIT-QSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNS 148
                           +NAI+  SL       G     + N S    L +  L    ++S
Sbjct: 71  ------------PPNSINAISLPSL-------GKSKQEIQNDSTSPILSDVPLSRKGISS 111

Query: 149 PNTALIEACDRVKSDTAWKLELTSMQSALEFLAKATK----------LRNDYKNNEPFGS 198
             +   E          WKLEL+SMQ+ALEFLA+A            ++      +P  S
Sbjct: 112 EKSFKSEG-------MKWKLELSSMQNALEFLAQAAGTVAKEGAKEIIKEKSTTPKPLKS 164

Query: 199 T--RSDAASTTSETRDLSEKDNGNEXXXXXXXXXXXXXXXXXYPS--IEAIKPEVPTPSN 254
           +   ++ ++T    + LS+ D+ N                    S  +E I    P P+ 
Sbjct: 165 SLDATNKSATDEGLKRLSKSDSTNTLYENTADMLNHTLNTNRKTSQLMEEIGKVRPPPTR 224

Query: 255 H--NYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAI 312
              ++D +G   L+T +EA  L+  FF  MHPF+P IPL L D  EL +YP+L   IL +
Sbjct: 225 KIDDFDYIGPDSLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTV 284

Query: 313 SARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTE 372
           SARY+PFD +G DNG +G R++ +H+KLW +CQ+L+SQT+W++ASTRSIGT LAF++FTE
Sbjct: 285 SARYHPFDTLGLDNGEDGMRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTE 344

Query: 373 WNPRAIHWEVSDTAHYLSDNNVS-------SSKEDPDGLGGIATVKRSDRMAWMFTGTAI 425
           WNPR+IH++ SD A+    NNV+       S+++D +GL G+  ++RSDRM+WM TG+A+
Sbjct: 345 WNPRSIHYKWSDYANDPELNNVNARGSKNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAV 404

Query: 426 RLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNPKSQDD 485
           RLAQ+M  +EN++K++   +I+E   A NMN +  L ES   ++  + + E D  +S +D
Sbjct: 405 RLAQDMGFIENSSKVFIVTHISETTSAMNMNQRSLLAESFSVLNLNLGKIENDGNESNED 464

Query: 486 -IENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDEYSINYLD 544
            + NE    ++  +  ++ES  +W      S+   +   + + D E EFLNDEY + Y +
Sbjct: 465 YLGNEKF--YLNEILPDEESKLRWKRVFENSENDHDNEKNFLTDWEREFLNDEYVLYYSN 522

Query: 545 --ENSSFLKNPIP-----YTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMI 597
             ++++  +N IP     ++  Q+A++E++RI++I Y+TIY EK K+++++ DQ+ NL +
Sbjct: 523 KKDDTNLAQNHIPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSV 582

Query: 598 LDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSK----FKRTANIRGESFISDYYYC 653
           L V SP++  W  NY +L+ P+SD   V  SL D       F     I GES I+D+ YC
Sbjct: 583 LSVFSPLIEGWLSNYRELLVPLSD---VPFSLADRKNKKQIFDNIDRINGESIITDFNYC 639

Query: 654 QLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRW 713
           QLY FSLALQV+ K S+L +NE++ SAR+VE AYR+AKEIL SA RV +  MLKYMPVRW
Sbjct: 640 QLYIFSLALQVDGKTSRLNMNEIVTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRW 699

Query: 714 VMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPD 773
           V+RI+RS +FIVKCY+TL    +ATN +A++ILKLS I VD+T  +IR  AV LKE+TPD
Sbjct: 700 VIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPD 759

Query: 774 ELHLASKFSTILMFLCKEIDERK----------RDNENLMTGNGLNNDPSLESQTTHKES 823
           ELHL  +++ ILM+LC E+  RK          RD    +     N + SLE Q   K+ 
Sbjct: 760 ELHLCQRYAAILMYLCTEMKLRKKSYLERPPLLRDGTTPLES---NRESSLEGQDLTKKP 816

Query: 824 LEAS----NHDTISSDAQEPP------SENDSSHDTTTQGTANSTRKVGPNSI------D 867
           + +     N    + +  E P      S + +S+DT+++G  +   +   N I      +
Sbjct: 817 IFSKRIGYNKTETTFEPSERPLTEEINSNSQNSNDTSSKGIVDPFVEQN-NDITTALLNN 875

Query: 868 EIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDG-FQDFDQLFDEFA 924
           E+ Q  + L ++V DWF AS +IGL+FVEPWTELIEQ+Y+Q  DG   +F+ L++ F 
Sbjct: 876 ELFQGPS-LSDEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFV 932

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/969 (37%), Positives = 547/969 (56%), Gaps = 128/969 (13%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDX 89
           K + T+ AC+ C+ +K+KCDLGP D P  PPCA C+R    C F++ KV           
Sbjct: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECLFSSQKV----------- 65

Query: 90  XXXXXXXXXXXXXXXMLNAITQS---LQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSL 146
                          M+N I QS   + NH     +  M L                 S 
Sbjct: 66  -------VKNSTSPHMVNTICQSKGEIPNHSRRLISSEMAL-----------------SE 101

Query: 147 NSPNTALIEACDRVKSDTAWKLELTSMQSALEFLAKAT----------KLRNDYKNNEPF 196
              N   +   D VK    WKLEL+SMQ+ALEFLA+A            +++      P 
Sbjct: 102 KGTNDETLFKSDGVK----WKLELSSMQNALEFLAQAAGTVAKEGAKETIKDRSATPRPS 157

Query: 197 GST----RSDAASTTSETRDLSEKD-------NGNEXXXXXXXXXXXXXXXXXYPSIEAI 245
            S+       AA+   +T  +SE D       + N                     I   
Sbjct: 158 ESSLDTPHQSAANKELKTLSISECDASATNTPHENITDTLAAALNSNQKMSQLIKEISRA 217

Query: 246 KPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLL 305
           +P +PT    +++ +G   L+T +EA  L+  FF  MHPF+P IPL L D  EL +YP+L
Sbjct: 218 RP-MPTRRIDDFEYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPIL 276

Query: 306 LHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTL 365
              IL +SARY+PFD +G DNG  G R++ +H+KLW +CQ+L+SQT+W++ASTRSIGT L
Sbjct: 277 FCSILTVSARYHPFDTLGLDNGENGIRHIEVHDKLWIYCQKLISQTIWAEASTRSIGTVL 336

Query: 366 AFLLFTEWNPRAIHWEVSDTAHYLSDNNVS-------SSKEDPDGLGGIATVKRSDRMAW 418
           AF++FTEWNPR+IH++ SD A+    NNV        S+K+D +GL G+  ++RSDRM+W
Sbjct: 337 AFIIFTEWNPRSIHYKWSDYANDPELNNVGVRESKNISTKKDEEGLTGVGAIRRSDRMSW 396

Query: 419 MFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEID 478
           M TG+A+RLAQ+M  +EN++KI+   +I+E   A NMN +P L ES   ++  +++F+ D
Sbjct: 397 MLTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQRPLLAESFSVLNLNVRKFDDD 456

Query: 479 NPKSQDD-IENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDE 537
             K  ++ + NE    ++  +  + ES K+W      S+   +   +++ D E EFLNDE
Sbjct: 457 GNKGNENYLGNEKF--YLNEILPDDESKKRWKKVFKDSEDDDDSEKNILTDWEREFLNDE 514

Query: 538 YSINYLD--ENSSFLKNPIP-----YTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVD 590
           Y + Y +  ++++  +NP+P     ++  Q+A++E++RI++I Y+TIY EK K+++++ D
Sbjct: 515 YVLYYSNKKDDTNLAQNPMPPSPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTD 574

Query: 591 QKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSK-FKRTANIRGESFISD 649
           Q+ NL +L V SP++  W  NY +++ P+SD   ++    +  + F     + GE+ I+D
Sbjct: 575 QRHNLSVLSVFSPLIEGWLSNYREVLVPISDVSFLLADRKNKKQVFDNINRLNGETIITD 634

Query: 650 YYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYM 709
           + YCQLY FSLALQV+ K S+L +NE++ SAR+VE AYR+AKEIL SA RV +  MLKYM
Sbjct: 635 FNYCQLYIFSLALQVDGKTSRLNMNEIMTSARYVELAYRSAKEILSSAKRVSRQGMLKYM 694

Query: 710 PVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKE 769
           PVRW +RI+RS +FIVKCY+TL    +ATN +A++ILKLS I VD+T  +IR  AV LKE
Sbjct: 695 PVRWAIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKE 754

Query: 770 STPDELHLASKFSTILMFLCKEIDERKRD--NENLMTGNGL-----NNDPSLES-----Q 817
           +TPDELHL  +++ ILM+LC E+  RK+       ++ NG      N + S E      +
Sbjct: 755 ATPDELHLCQRYAAILMYLCTEMKLRKKSYTERPPLSTNGTTPLESNCESSPEGVDFTKK 814

Query: 818 TTHKESLEASNHDTISSDAQEPPSEN---------------------DSSHDTTTQGTAN 856
            T  +++ ++  +  S  +++ P E                      + ++DTTT    N
Sbjct: 815 PTFPKNIRSNKAECNSESSKKSPMEEIDSNLNNPNNLSSKVIFNPFVEQNNDTTTTLLNN 874

Query: 857 STRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDG-FQD 915
              + GP+           L E+V DWF AS +IGL FVEPWTELIEQ+Y+Q  DG   +
Sbjct: 875 ELFQ-GPS-----------LSEEVTDWFGASEDIGLGFVEPWTELIEQRYMQCGDGDINN 922

Query: 916 FDQLFDEFA 924
           F+ L++ F 
Sbjct: 923 FENLYNLFV 931

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/961 (38%), Positives = 554/961 (57%), Gaps = 107/961 (11%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDX 89
           K + T+ AC+ C+ +K+KCDLGP D P +PPCA C+R    C F++ +  +  L      
Sbjct: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLS----- 82

Query: 90  XXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSP 149
                          M+N IT    + ++  G  N  +++  + + L  +N +  +L   
Sbjct: 83  -------------PSMIN-ITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETL--- 125

Query: 150 NTALIEACDRVKSD-TAWKLELTSMQSALEFLAKATK----------LRNDYKNNEPF-G 197
                      KS+   WKLEL+SMQ+ LEFLA+A            ++++     PF  
Sbjct: 126 ----------FKSEGMKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVN 175

Query: 198 STRSDAASTTSE-----TRDLSEKDNGNEXXXXXXXXXXXXXXXXXYPS-----IEAIKP 247
           S  S    +T E     +R LS   + N                    S     I  ++P
Sbjct: 176 SLHSSCQPSTDEGLKPLSRSLSAASDTNTPIENLTVALATTLNANRTTSQLIEEIGKVRP 235

Query: 248 EVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLH 307
            +PT    +++ +G   L+T +EA  L+  FF  MHPF+P IP  L D  EL +YP+L  
Sbjct: 236 -IPTRKIEDFEYIGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFC 294

Query: 308 CILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAF 367
            IL +SARY+PFD +G DNG  G R+V +H+KLW +CQ+L+SQT+W++ASTRSIGT LAF
Sbjct: 295 AILTVSARYHPFDTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAF 354

Query: 368 LLFTEWNPRAIHWEVSDTAHYLSDNNVS-------SSKEDPDGLGGIATVKRSDRMAWMF 420
           ++FTEWNPR+IH + SD A+    NNV+       +++ D +GL G+  ++RSDRM+WM 
Sbjct: 355 IIFTEWNPRSIHCKWSDYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWML 414

Query: 421 TGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNP 480
           TG+A+RLAQ+M  +EN+++I+   +I+E   A NMN +  L ES   ++  +  F+ D  
Sbjct: 415 TGSAVRLAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFDNDGN 474

Query: 481 KSQDD-IENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPD---LIIDLETEFLND 536
           ++ ++ + NE    ++  +  N ES ++W   K   + L+ ++ +   ++ D E EFLND
Sbjct: 475 ENNENYLGNERF--YLDEILPNDESKERW---KKVLENLEADSDNEKCVLTDWEREFLND 529

Query: 537 EYSINYLD--ENSSFLKN-----PIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSV 589
           EY + Y +  ++++  +N     P+ ++  Q+A++E++RI++I Y+TIY EK K+++++ 
Sbjct: 530 EYVLYYSNKKDDTNLAQNHMPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATT 589

Query: 590 DQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTAN----IRGES 645
           DQ+ NL +L V SP++  W  NY +++ P+SD   V  SL D    ++  N    I GES
Sbjct: 590 DQRHNLSVLSVFSPLMEGWLSNYREVLVPLSD---VPFSLADRKNKRQVLNNIDRINGES 646

Query: 646 FISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDM 705
            I+D+ YCQLY FSLALQV+ K S+L ++E++KSA++VE AY++AKEIL SA RV +  M
Sbjct: 647 IITDFNYCQLYIFSLALQVDGKISRLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCM 706

Query: 706 LKYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAV 765
           LKYMPVRWV+RI+RS +FIVKCY+TL    +ATN +A++ILKLS I VD+T  +IR  AV
Sbjct: 707 LKYMPVRWVIRIIRSIAFIVKCYLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAV 766

Query: 766 ILKESTPDELHLASKFSTILMFLCKEIDERKRDNENLMTGNGLNNDPSLESQTTHKESLE 825
            LKE+TPDELHL  +++ ILM+LC E+  RK+ +      +     P   S  +  E   
Sbjct: 767 TLKEATPDELHLCQRYAAILMYLCTEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGAN 826

Query: 826 ASNHDTISSDAQEPPSE------NDSSHDTTTQGTANSTR---KVGPNS-IDEIGQFTAY 875
                T    A    +E        +S + T+    NST    K G NS +++    TA 
Sbjct: 827 LVKGPTFDKTAGTSNAECIFDPVGKTSAEETSNNLNNSTELPFKTGLNSFVEQTNDITAM 886

Query: 876 -----------LPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDG-FQDFDQLFDEF 923
                      L E+V DWFSAS +IGL+FVEPWTELIEQ+Y+Q  DG   +F+ L++ F
Sbjct: 887 LLNNELIQGPSLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLF 946

Query: 924 A 924
           A
Sbjct: 947 A 947

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/928 (39%), Positives = 524/928 (56%), Gaps = 74/928 (7%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDX 89
           K K  + AC  CK +K+KCD+GP + P  PPCA CRR    C F   K +   LG     
Sbjct: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGT---- 74

Query: 90  XXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSP 149
                           + + T +L+     N   ++    L +   L N+    +   SP
Sbjct: 75  --------------SKIPSTTPTLKP----NSGNSVSKKRLDSSTDLVNEVPVKIPKTSP 116

Query: 150 NTALIEACDRVKSDTAWKLELTSMQSALEFLAKAT------KLRNDYKNNEPFGSTRSDA 203
           +  +        S T WK+ LTSMQ++LEFLAKA          + +   E   S     
Sbjct: 117 SNPI--------SPTKWKIGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPK 168

Query: 204 ASTTSETRDLSEKDNGNEXXXXXXXXXXXXXXXXXYPSIEAIKPEVPTPSNH--NYDLLG 261
           A++  +   L      +                   P I+ +    PTP     + D +G
Sbjct: 169 ATSLPQEESLMNM-TSSLHSDLLNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIG 227

Query: 262 DGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNPFDK 321
             +L++  +A  L+++FF  M PF+P IPL LQ+  EL +YP+LL  IL IS+RY+ FD 
Sbjct: 228 PNRLLSESDAIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDT 287

Query: 322 VG--FDNGIEGNRNVI-IHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAI 378
                +NG    R  I +H KLW +CQ+L+SQT+W++ASTRSIGT LAF++FTEWNPRAI
Sbjct: 288 FADSINNGQNNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAI 347

Query: 379 HWEVSDTAHYLSDNNVSSSKEDP-------DGLGGIATVKRSDRMAWMFTGTAIRLAQEM 431
           HW  SD A   + N++S    +P       +GL GI  ++RSDRMAWM +GTA+RLAQ+ 
Sbjct: 348 HWNWSDYASDPALNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDT 407

Query: 432 DILENNAKIYTAANIAEICYASNMNLKPTLGESLVS--IDGGMKEFEIDNPKSQDDIENE 489
            ++  N K+  A +I++   A NMN +  L  S  S   D   K   I    +Q  + NE
Sbjct: 408 GLIRTNTKVAIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQ--VVNE 465

Query: 490 DLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDEYSINYLDE-NSS 548
           +   ++  + QNKES ++W    A   K  EE    + D+E EFLNDEY++ +  E N S
Sbjct: 466 NF--YLTQILQNKESKERWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDS 523

Query: 549 FLKNPIP--YTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPILN 606
             + P+P  +T  Q+A+LELLRIVT+ Y+TIYYE  ++R+ S DQ++NL +L++LSP+++
Sbjct: 524 SQRPPLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLID 583

Query: 607 AWYLNYYKLMKPVSDEKPVIISLDDLSK--FKRTANIRGESFISDYYYCQLYTFSLALQV 664
           +WY NY  L+K     +PV   +    +  FK + NI GE+ ISDYYYCQLY FSLALQV
Sbjct: 584 SWYSNYNSLLK-TDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQV 642

Query: 665 EVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFI 724
           +V ++KL LNE+ + A +VE+AY AAKEIL+SA RVHK+ MLKYMPV+WVMRIVRS +FI
Sbjct: 643 DVGQNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFI 702

Query: 725 VKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASKFSTI 784
           VKCY+TL   S ++N EA++IL LS I VD+T+  I+  A+ILKE+ PDELHL++++S I
Sbjct: 703 VKCYLTLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAI 762

Query: 785 LMFLCKEIDERKRDNENLMTGNGLNNDPS----LESQTTHKESLEASNHDTISSDAQEPP 840
           L++LC+E+   K  +E+     G ++  S    L       +S +  + D +     E  
Sbjct: 763 LLYLCREM---KSKHESSQQSKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVA 819

Query: 841 SENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTA----YLPEDVIDWFSASNNIGLDFVE 896
           +++  +     +   N     G  + D    FT      LP DV +WF+ S NIGL+FVE
Sbjct: 820 AKDPRTSQENIELQMNKPNLDGKFASDM--DFTTDNLNELPGDVANWFTTSGNIGLEFVE 877

Query: 897 PWTELIEQKYIQNKDGFQDFDQLFDEFA 924
           PWTE+IEQ Y+Q+ D    FD L+ E  
Sbjct: 878 PWTEMIEQMYLQSGDANTTFDDLYKEIC 905

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/957 (38%), Positives = 527/957 (55%), Gaps = 121/957 (12%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDX 89
           K + T+ ACL C+ +K+KCDLGP D P  PPC  C+R R  C F     +  K G +   
Sbjct: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF----TESNKRGGLRVA 73

Query: 90  XXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSP 149
                          M  AIT   Q + +  G+Q             +  +++ + +NS 
Sbjct: 74  NVSAIAENTANATASMSKAITSVFQGNTS-EGSQQPDFK--------RENSIDPLPINS- 123

Query: 150 NTALIEACDRVKSDTAWKLELTSMQSALEFLAKATK------------LRNDYKNNEPFG 197
                              ELT+MQ ALEFLAKA                  Y+  E   
Sbjct: 124 -------------------ELTTMQDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQS 164

Query: 198 STRSDAASTTSETRDLSEKDNGNEXXXXXXXXXXXXXXXXXYPS---IEAIKPEVPTPSN 254
           ++R+D   ++   +D +   N                     P+   IE +    P PS 
Sbjct: 165 NSRTDTPISSGSAQDSTRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSR 224

Query: 255 HNYDL--LGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAI 312
              D+  +G  K+++ +EA  L+++FF  MHPF+P++PL LQ+ DEL +YP+LL  IL I
Sbjct: 225 RLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTI 284

Query: 313 SARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTE 372
           S+RY+ FD+V   NG   NRNV IH +LW +CQ+L+SQTVW++ASTRSIGT LAFLLFTE
Sbjct: 285 SSRYHSFDEVNMYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTE 344

Query: 373 WNPRAIHWEVSDTAHYLSDNNVS-----------------SSKEDPDGLGGIATVKRSDR 415
           WNPRAIHW  SD A+    N+VS                 +S++  DGL G++ ++RSDR
Sbjct: 345 WNPRAIHWRWSDYANNPDLNDVSKRDLSNVACSSSSSTACNSQQHGDGLTGLSAMRRSDR 404

Query: 416 MAWMFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEF 475
           MAWM TGTA+RLAQ+M  +  ++KI+TA +I+E   A NMN +  L +SL  I+  +  +
Sbjct: 405 MAWMLTGTAVRLAQDMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEIN--LNGY 462

Query: 476 EIDNPKSQDDIENEDLLKFVQLVAQNKESTKKWA--IHKAYSDKLKEENPDLIIDLETEF 533
           E       DD+ENE    ++  + ++  S ++W+  + K  S   +      + D+E EF
Sbjct: 463 E-------DDVENESY--YLGQILKSDGSKERWSKFLKKLGSSSTRGR----MNDIEREF 509

Query: 534 LNDEYSINYLDENSS------------------FLKNP--IPYTTYQKAQLELLRIVTIT 573
           +NDEY + Y D++ +                    + P  + ++  Q+A++ELLRI++I 
Sbjct: 510 VNDEYVLYYSDKDGAPAHADEYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIG 569

Query: 574 YQTIYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKP-VIISLDDL 632
           Y+TIY  K+K  + S  Q  NL +L +LSP++ +WY  Y  ++KP S       +  +  
Sbjct: 570 YETIYRGKLK--LYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKK 627

Query: 633 SKFKRTANIRGESFISDYYYCQLYTFSLALQVEV---KESKLTLNEMIKSARFVEQAYRA 689
             F+ T  +  ES ISDYYYCQLY +SLALQV+V   K+ KL +NE+ K AR+VE AY A
Sbjct: 628 YIFELTEKVDRESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNA 687

Query: 690 AKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLS 749
           AKEIL SAIRVHK+ MLKYMPVRWV RIVRS +F+VKCY+TL    +ATN EA +IL LS
Sbjct: 688 AKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTILTLS 747

Query: 750 GILVDDTVHMIRQAAVILKESTPDELHLASKFSTILMFLCKEIDERKRDNENLMTGNGLN 809
            I  ++ +  I++AA+ L+E++PDELHL +++STILM+LC E+  R R N        ++
Sbjct: 748 VIPTEEIIQTIQRAAITLREASPDELHLCTRYSTILMYLCTEMKLRSRPNPQPPVPRSIS 807

Query: 810 NDP-SLESQTTHKESLEASNHDTISSDAQE---PPSENDSSHDTTTQGTANSTRKVGPNS 865
             P  +  +TT     +   H+      Q    PP   +S  +TT     N    V  N 
Sbjct: 808 EQPEQISVETTFNFCGKNETHEKGQGSQQRGPLPPPRMNSLPETT-----NFAFNVD-NF 861

Query: 866 IDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDGFQDFDQLFDE 922
               G  T +LP  V+DWFS S+ IGLDFVEPWTE+IEQ++I N D  + F+ L+++
Sbjct: 862 FSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFISN-DNNKTFENLYNQ 917

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/960 (37%), Positives = 537/960 (55%), Gaps = 105/960 (10%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKI-GKLGNILD 88
           K + T+ AC+ C+ +K+KCDLGP D P +PPCA C+R    C F++ + +  G   N++ 
Sbjct: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMI- 75

Query: 89  XXXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNN--LSNLVGLKNQNLEGVSL 146
                            L+   Q ++N        +M L+     N    K+   EGV  
Sbjct: 76  ----------TAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKS---EGVK- 121

Query: 147 NSPNTALIEACDRVKSDTAWKLELTSMQSALEFLAKATK----------LRNDYKNNEPF 196
                              WK EL+SMQ+ALEFLA+A            + +      P 
Sbjct: 122 -------------------WKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPL 162

Query: 197 GST--RSDAASTTSETRDLSEKDNG---------NEXXXXXXXXXXXXXXXXXYPSIEAI 245
                 S  ++T    + LS  D+          N                     I  +
Sbjct: 163 VDPLDTSHQSATDGGLKRLSRGDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGV 222

Query: 246 KPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLL 305
           +P  PT    ++D +G   L+T +EA  L+  FF  MHPF+P IPL L D  EL +YP+L
Sbjct: 223 RPS-PTRKIEDFDYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPIL 281

Query: 306 LHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTL 365
              IL +SARY+ FD +G  NG  G R++ +H+KLW +CQ+L+SQT+W++ASTRSIGT L
Sbjct: 282 FCAILTVSARYHRFDTLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVL 341

Query: 366 AFLLFTEWNPRAIHWEVSDTAHYLSDNNVS-------SSKEDPDGLGGIATVKRSDRMAW 418
           AF++FTEWNPR+IH++ SD A+    NNV+        +++D +GL G+  ++RSDRM+W
Sbjct: 342 AFIIFTEWNPRSIHYKWSDYANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSW 401

Query: 419 MFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEID 478
           M TG+A+RLAQ+M  +EN++KI+   +I+E   A NMN +  L ES   ++  +++F+ D
Sbjct: 402 MLTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSD 461

Query: 479 NPKSQDD-IENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDE 537
             ++ ++   NE    ++  +  N E  K+W      S    +    L+ D E EFLNDE
Sbjct: 462 GKENNENYFGNEKF--YLDEILPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDE 519

Query: 538 YSINYLDEN--SSFLKN-----PIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVD 590
           Y + Y ++N  ++  +N     P+ ++  Q+A++E++RI++I Y+TIY EK K+++++ D
Sbjct: 520 YVLYYSNKNDDTNLAQNHTPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTD 579

Query: 591 QKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSK----FKRTANIRGESF 646
           Q+ NL +L + SP++  W  NY +++ P+SD   V  SL D       F     I GES 
Sbjct: 580 QRHNLSVLSIFSPLMEGWLSNYREVLVPLSD---VPFSLADRKNKKQVFDNIDRINGESI 636

Query: 647 ISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDML 706
           I+D+ YCQLY FSLALQV+ K S+L +NE++ SAR+VE AYR+AKEIL SA RV +  ML
Sbjct: 637 ITDFNYCQLYIFSLALQVDGKISRLNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAML 696

Query: 707 KYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVI 766
           K+MPVRWV+RI+RS +FIVKCY+TL    +ATN +A++ILKLS I VD+T  ++R  AV 
Sbjct: 697 KFMPVRWVIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDLMRDTAVT 756

Query: 767 LKESTPDELHLASKFSTILMFLCKEIDERKR---DNENLMTGNGL----NNDPSLESQTT 819
           LKE+TPDELHL  +++ ILM+LC E+  RK    +  +L+  +      N+  SLE    
Sbjct: 757 LKEATPDELHLCQRYAAILMYLCTEMKLRKSSHLERPSLLRSSTTPLESNHGFSLEGVDV 816

Query: 820 HKESLEASNHDTISSDAQ-EPPSE--NDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAY- 875
            K+S    +     +D++ E P +   D   D        S + +  + +++    TA  
Sbjct: 817 TKKSTFYRDIGGNKTDSKFETPEKLPVDEIGDNLNNSNDLSGKAIVNSFVEQNNDITAAL 876

Query: 876 ----------LPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDG-FQDFDQLFDEFA 924
                     L E+V DWF AS +IGL+FVEPWTELIEQ+Y+Q  DG   +F+ L++ F 
Sbjct: 877 LNNELFQGPSLSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFV 936

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/968 (35%), Positives = 539/968 (55%), Gaps = 121/968 (12%)

Query: 14  SRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
           S S  P+         K + ++ AC+ C+ +KIKCDLGP D P  PPC  C+R +  C F
Sbjct: 2   SLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61

Query: 74  NAPKVKIGKLGNILDXXXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNL 133
              K +        D                ++++I   + + +++NG         S  
Sbjct: 62  PVTKRR--------DVTAKINNMKGSELERSIISSILPDV-DKKSLNGGG-------SAG 105

Query: 134 VGLKNQNLEGVSLNSPNTALIEACDRVKSDTAWKLELTSMQSALEFLAKATKL--RNDYK 191
             LK  N+                 +  +D+ W+ ++++MQ+ALEFLA A  +  ++D +
Sbjct: 106 SDLKQNNIR----------------KKPTDSNWQSDISTMQTALEFLANAVGVISKSDTR 149

Query: 192 NNEPFGSTRS--------DAASTTSETRDLSEKDNG-----NEXXXXXXXXXXXXXXXXX 238
           +        +        D+      + D+S  D+      N                  
Sbjct: 150 SLLNLNQNNTLIENEDADDSNPNNDNSEDVSRSDSNTPKSRNSIFSLIHDDTASKVISPL 209

Query: 239 YPSIEAIKPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDE 298
             +IE+I+P+ PT +  + + +G  KL+T DEAR L+N+FF  MHP++PYIPL L + DE
Sbjct: 210 MGTIESIRPK-PTRNLSDIEYIGPNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDE 268

Query: 299 LFKYPLLLHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQAST 358
           L +YP+LL  IL +S+RYN F+++  +N  E +RN+++H KLW +CQ+L+S T+W++AST
Sbjct: 269 LVRYPILLCAILTVSSRYNSFNEIFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEAST 328

Query: 359 RSIGTTLAFLLFTEWNPRAIHWEVSDTAH------YLSDNNVSSSKEDPDGLGGIATVKR 412
           RSIGT LAFLLFTEWNPRAIHW  SD  +      +  +N  + S+   +   G   ++ 
Sbjct: 329 RSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTKNNENNMSEFKGEKTTGFEAMRH 388

Query: 413 SDRMAWMFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGM 472
           SDRMAWMFTG+A+RLAQ+M  ++NN KI+ A +I+E   A N+N + TL +SL +I+  +
Sbjct: 389 SDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISETFNAMNVNQRSTLSDSLSNINLSI 448

Query: 473 KEFEIDNPKSQDDIENEDLLK-------FVQLVAQNKESTKKW-AIHKAYSDKLKEENPD 524
                 + K+ DD E     +       +++ + ++ +S +KW    K  +     EN  
Sbjct: 449 TR---SHGKNNDDEEGHIFAENFGNEQYYLEQILKHDKSKEKWIKFLKEINSNKSSENST 505

Query: 525 LIIDLETEFLNDEYSINYLDEN-------------SSFLKNPIPYTTYQKAQLELLRIVT 571
           +I D E E+LNDEY + Y + N             S+ L  P+ + ++ KA++E+LRI++
Sbjct: 506 VITDAEREYLNDEYILYYQNNNPETQPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMS 565

Query: 572 ITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDD 631
           I Y+TIY  K K+ ++  +Q++NL +L + SP++ +WY N++ L+K + +  P      D
Sbjct: 566 IAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYSNHHGLLK-LFECAPC-----D 619

Query: 632 LSKFKR-------TANIRGESFISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVE 684
           +SK+K        +  I  ES I DYYYCQLY +SLAL+V++K++ L L+E+ KSA++V 
Sbjct: 620 MSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIKDNNLNLSEITKSAKYVY 679

Query: 685 QAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKS 744
            AY AAKEIL SA+RV+K+ +L+Y+PVRWV RI+RS +FIVKC++ L +   + NSE  +
Sbjct: 680 MAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKCFLLLTESETSENSEINA 739

Query: 745 ILKLSGILVDDTVHMIRQAAVILKESTPDELHLASKFSTILMFLCKEIDERKRDNENLMT 804
           I++LSGI VD+ + +I   +V L +++PDELHL  ++S+IL+++CKE+   +   +NL  
Sbjct: 740 IIRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLYMCKEL---RNKTQNLYM 796

Query: 805 GNGLNNDPSLESQTTHKESLEASNHDTISSDAQEPPSENDSSHDTTTQGTANSTRKVG-- 862
             G+             +SLE  N  +I  ++QEP      +    T+   N+T ++   
Sbjct: 797 NEGVAAKQENADVKVGNKSLE--NLSSI-ENSQEPIEPFIMNEHPQTELPINTTEQIAIV 853

Query: 863 --------------PNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQ 908
                         PNS+   G+        VIDWFS+S +IGL+FVE WTE+IEQ Y++
Sbjct: 854 GNEHHGIEQTPILNPNSMSFQGE--------VIDWFSSSADIGLEFVESWTEMIEQMYLR 905

Query: 909 NKDGFQDF 916
           + DG Q+ 
Sbjct: 906 SSDGDQNI 913

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/928 (37%), Positives = 504/928 (54%), Gaps = 117/928 (12%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDX 89
           K +  + AC+ C+ KK+KCD+GP D P  PPC  CRR    C                  
Sbjct: 17  KWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILP--------------- 61

Query: 90  XXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSN-LVGLKNQNLEGVSLNS 148
                                   +N R  N +    L  + N LVG+ N++    SL S
Sbjct: 62  ------------------------ENKRRGNTDTEFKLGKIENGLVGVMNKSESEQSLLS 97

Query: 149 ------PNTALIEACDRVKSDTAWKLELTSMQSALEFLAKATKLRNDYKNNEPF----GS 198
                 PN +     D V  D  WK E+ +M +ALEFLAKA          EP       
Sbjct: 98  QTRAPPPNGSTSNNLDLV--DPKWKFEIGTMYNALEFLAKAA---GSVSKEEPIEMKSPQ 152

Query: 199 TRSDAASTTSETRDLSE--KDN-GN----EXXXXXXXXXXXXXXXXXYPSIEAIKPEVPT 251
            RSD          L+    DN GN    +                  P IE +    P 
Sbjct: 153 NRSDLGVGNMPDTALNGVMSDNIGNLDISDESFLAPLTTANGSQRAAAPLIEKLSSMRPK 212

Query: 252 PSNH--NYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCI 309
            S    + D +G  KL++ DEA  L++IFF  MHPF+P+IPL LQD DEL +YP+LL  I
Sbjct: 213 SSKKLIDVDYIGPSKLLSEDEATRLIDIFFLTMHPFFPHIPLQLQDPDELVRYPILLCAI 272

Query: 310 LAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLL 369
           L ISARYNPF ++GF +G   NRN+ +H +LW +CQ+L+SQT+W++ASTRSIGT LAFLL
Sbjct: 273 LTISARYNPFGELGFYDGEAHNRNIEVHERLWIYCQRLISQTIWAEASTRSIGTVLAFLL 332

Query: 370 FTEWNPRAIHWEVSDTAHYLSDNNV-------SSSKEDPDGLGGIATVKRSDRMAWMFTG 422
           FTEWNPRAIHW+ SD A+    N+V       +++  D +   G+A V+RSDRMAWM  G
Sbjct: 333 FTEWNPRAIHWKWSDYANNPELNDVTKRETHGANTPRDTETFTGMAAVRRSDRMAWMLIG 392

Query: 423 TAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNPKS 482
            A+RLAQ+M  ++ ++KI+ A +IAE   A N+N K  L ESL  ++  + E        
Sbjct: 393 AAVRLAQDMSFIDTSSKIFVATHIAEAHTAMNLNQKSILSESLSEVNREVLE-------R 445

Query: 483 QDDIENEDLLKFVQLVAQNKESTKKWA-IHKAYSDKLKEENPDLIIDLETEFLNDEYSIN 541
            DDI NE+   +++ + Q  ES ++W    +  S+  + +    + D+E EFLNDEY + 
Sbjct: 446 LDDIGNENF--YLEHILQKDESKERWTNFLQNVSEGRRAKGTGPLTDMEREFLNDEYVLY 503

Query: 542 YLD-------ENSSFLKNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSV--DQK 592
           Y++       ++S  L  P+ ++  Q+A++ELLRI+TI Y++IYYE  K +   +  + K
Sbjct: 504 YVNARNDASSKSSLTLPFPLKFSHPQRAKIELLRILTIGYESIYYESEKDKTQLINGNPK 563

Query: 593 KNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKR-----TANIRGESFI 647
           +NL +L+++S ++  W+  Y  L+ P ++  P  +   D+++ KR     T  I  ES  
Sbjct: 564 RNLALLEIISTLIEKWHATYKDLLIP-ANATPCSL---DMARNKRAVHELTQQIDRESLS 619

Query: 648 SDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLK 707
            DY YCQLY +SLALQ +VK   L + E+ KSAR+VE AYRAA+ IL SA R+H + ML+
Sbjct: 620 CDYNYCQLYIYSLALQNDVKNMDLKMPEIRKSARYVELAYRAAEGILDSAERIHSLKMLR 679

Query: 708 YMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVIL 767
           YMPVRWV RIVR+ +F+VKCY+ L    +A N  A +IL+L+ I  ++TV +I +AAV L
Sbjct: 680 YMPVRWVTRIVRAVAFLVKCYLVLTKDGLAANPVAGTILRLTVIPSEETVPIIERAAVTL 739

Query: 768 KESTPDELHLASKFSTILMFLCKEIDERKRDNENLMTGNGLNNDPSLESQTTHKESLEAS 827
           +E+ PDE+HL  ++S IL FLC E+  R + +E              E +   ++ LE  
Sbjct: 740 QEAAPDEVHLGMRYSKILKFLCAEVKMRTQMSERDEE---------AEEERKQRQQLECY 790

Query: 828 NHDTISSDAQ--EPPSENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLP-EDVIDWF 884
           +        Q  +P      S  + +    +S     P++        A LP ED  D F
Sbjct: 791 HRQPRERRQQHAQPVISQSHSPPSPSVMLNSSMDPYSPSAP------PADLPFEDPFDLF 844

Query: 885 SASNNIGLDFVEPWTELIEQKYIQNKDG 912
           +AS++IGLDFV+ WTE+IE +Y+Q++ G
Sbjct: 845 AASDDIGLDFVDTWTEMIENRYMQDELG 872

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/952 (35%), Positives = 508/952 (53%), Gaps = 104/952 (10%)

Query: 35  FGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDXXXXXX 94
           F AC  C+ KK++CD GP+D P  PPCA C+R   +C F A   K GK            
Sbjct: 23  FKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTA---KTGK------------ 67

Query: 95  XXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLN-SPNTAL 153
                           Q +    A NG   +      + V +K   L   +L  + +  L
Sbjct: 68  ---------------EQDMVTGEATNGIPTV------DTVPVKKNELALPALAVTVSPGL 106

Query: 154 I----EACDRVKSDTAWKLELTSMQSALEFLAKATKLRNDYKNNEPFGSTR-SDAASTTS 208
           I    E  +    +T WKLELTSM + L FLA+A    ++  N      T  SD ++ + 
Sbjct: 107 IQNRSEMGNEANPNTGWKLELTSMHNTLAFLAQAAGTVSNTLNKGLMKKTLPSDRSTPSL 166

Query: 209 ETRDLSEKDNGNEXXXXXXXXXXXXXXXXXYPSIEA------------IKPEVPTPSNHN 256
           E   L  K                         IE              K +VP  +  +
Sbjct: 167 EISRLGSK-TPTGFASSLGLGMPSNPTKTLLQEIETQNKVQLIEKSKNTKSKVPK-TLKD 224

Query: 257 YDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARY 316
              +G+  L++  EA   ++ FF  MHPF+PYIPL LQD  EL +YP+LL  IL IS RY
Sbjct: 225 IKCIGENGLLSEQEATAFIDAFFCTMHPFFPYIPLQLQDPLELLEYPILLCAILTISTRY 284

Query: 317 NPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPR 376
           + F + GFDNG    RN  +H KLW +CQ +LS+T+W +ASTRSIGT LAF+LFTEWNPR
Sbjct: 285 HSFSEFGFDNGDYNKRNFEVHEKLWDNCQVMLSKTIWGEASTRSIGTVLAFILFTEWNPR 344

Query: 377 AIHWEVSDTAHYLSDNNVSSSKEDPDGLGGIATVKRSDRMAWMFTGTAIRLAQEMDILEN 436
            IHW+ SD A+   +     S ++ + L G   ++RSDRMAWM TG+A+RLAQ+M  +E 
Sbjct: 345 QIHWKKSDYANDDDEAVSELSNDEAEELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMET 404

Query: 437 NAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNPKSQDDIENEDLLK--- 493
           NAK+  A +I++   + NMN KP L  +   + GG   +  D P +     +E       
Sbjct: 405 NAKVCVATHISDAFASMNMNQKPVLSGNFNVLQGGTNNYTSD-PLNSSGSSHESTCSEQA 463

Query: 494 FVQLVAQNKESTKKW-------AIHKAYSDKLKEENPDLIIDLETEFLNDE----YSINY 542
           F++ + +N  S  +W        +   +  +  E + DL  DLE EFLNDE    YS+  
Sbjct: 464 FMKQMLENTNSHTRWRHILSSLQMEDLFQRQRNEYSNDL-SDLEREFLNDEFILYYSLER 522

Query: 543 LDENSSFLKNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVLS 602
             +N      P+ ++  QKA++EL  I+ + Y TIYY++ +K+++S +Q  NL +L +LS
Sbjct: 523 RSDNQETPPFPLQFSYAQKAKIELTNIMLLGYDTIYYDRGRKKLASNNQLHNLSVLSILS 582

Query: 603 PILNAWYLNYYK--LMKPVSDEKPVIISLDDLSKFKRTANIRGESFISDYYYCQLYTFSL 660
           P++  W+ N YK  L+ P ++        D  + ++ + NI  ES I DY Y QLY +SL
Sbjct: 583 PLMEGWH-NVYKNLLIAPSANPYTTTTRGDKRAMYELSKNIDSESIICDYRYSQLYIYSL 641

Query: 661 ALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRS 720
           ALQ + K ++LT++E+ ++A++VE A+ AAKEI+ SA RVHK+++LKYMPVRWVMR+VR+
Sbjct: 642 ALQADFKRAELTVSEITQNAKYVEIAFNAAKEIIFSAFRVHKLNLLKYMPVRWVMRLVRA 701

Query: 721 ASFIVKCYITLCDHSMA----TNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELH 776
            SF+VKC + L   S+     + +E ++ILKL  I V DT + I+ AA+ LKE+TPDELH
Sbjct: 702 VSFLVKCCLILNATSIGGGGSSEAEVRTILKLCSISVKDTANTIKMAAMTLKEATPDELH 761

Query: 777 LASKFSTILMFLCKEIDERKRDNENLMTGNGLNN----DPSLESQTTHKESLEASN---- 828
           L+ ++S IL++LC+E++  K  ++ +   N         P+ E +     +  A      
Sbjct: 762 LSMRYSAILLYLCRELESEKDSSKKIPFPNNATTKYAISPTYEGRDGEIAAGSAGGCANT 821

Query: 829 -HDTIS-------SDAQEPPSEN--DSSHDTTTQGTAN-------STRKVGPNSIDEIGQ 871
            H T +       SD  E    N  D++++    G+ N       +T   G  S     +
Sbjct: 822 AHITANRLRTVPLSDINETTGRNTEDTANNNIVNGSLNGDRNHLGTTEGTGAASQSTTDR 881

Query: 872 FTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDGFQDFDQLFDEF 923
            T  LP++V +WFS +  IGL+FVEPWT++IEQ+++Q+  G   F++L+  F
Sbjct: 882 LTGSLPDEVTNWFSGNAEIGLEFVEPWTDMIEQRFLQSGTGNDVFEELYQYF 933

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/918 (37%), Positives = 519/918 (56%), Gaps = 102/918 (11%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLG----N 85
           K K +F AC  C+ +KIKC+LGP D P  PPC  C+R +  C F  P  K   L     N
Sbjct: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDIN 71

Query: 86  ILDXXXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQN----MHLNNLSNLVGLKNQNL 141
             D                               +G+ N    +H     N  G  N+ +
Sbjct: 72  YGD-------------------------------DGDDNKLKFIHYQQGDN-KGANNKEI 99

Query: 142 EGVSLNSPNTALIEACDRVKSDTAWKLELTSMQSALEFLAKATKLRNDYKNNEPFGSTRS 201
           + ++L                D+AW+ +++SMQ+ALE+LA A K  + ++N++P  S  S
Sbjct: 100 QNMAL---------------EDSAWESDVSSMQNALEYLASAAKSVSQFENHKP-TSKLS 143

Query: 202 DAASTTSETRDLSEKDNGNEXXXXXXXXXXXXXXXXXYPSIEAIKPEVPTPSNHNYDLLG 261
           D  ++ S+  D+++++   E                    I       P     +   +G
Sbjct: 144 DMVNSYSKD-DMTQENIIKELFEKTELKNPASSLIAQLSRIRT----KPHKKLSDIVYIG 198

Query: 262 DGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNPFDK 321
           D KL+T +EAR L+ +FF  +HPF+PYIPL L + ++L +YP+LL  ++ ISARYN F  
Sbjct: 199 DDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGD 258

Query: 322 VGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAIHWE 381
           +        + N+ IH KLW +CQ+L+S+T+W++ASTRSIGT LAFLLFTEWNPRAIHW 
Sbjct: 259 LDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWN 318

Query: 382 VSDTAHYLSDNNVSSSKE-DP------DGLGGIATVKRSDRMAWMFTGTAIRLAQEMDIL 434
            SD A+     N +   E DP      + + G   ++ SDRMAWM TG+A+RLAQ+M  +
Sbjct: 319 WSDYANDSETINFNELNEFDPINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFI 378

Query: 435 ENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFE----IDNPKSQDDIENED 490
           + + KI+ A +IAE   A N+NL+ +L ESL +++   K+ +    ID  KS+    NE 
Sbjct: 379 DTSNKIFLATHIAETYNAMNVNLRSSLSESLSNVNIHSKKIDPVKIIDGKKSERYFGNEK 438

Query: 491 L-LKFVQLVAQNKESTKKWAIHKAYSDKLKEE-NPDLIIDLETEFLNDEYSINYLDENSS 548
             L+ +   A+++ES+     +    + L+E  N     D E +FLNDEY + Y + + +
Sbjct: 439 YYLEQIFKNAKDRESS-----YDLLENILRERRNAKAFPDNERDFLNDEYILFYSNPDDA 493

Query: 549 F----LKNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPI 604
                L  P+ +T  Q+A++ELL+I++I Y+TIY EK ++  ++ +QK+NL +L++ S +
Sbjct: 494 TQNDELDTPLDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSAL 553

Query: 605 LNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTANIRGESFISDYYYCQLYTFSLALQV 664
           +++WY+NY +L+ P     PV+ +   +     T  I  ES I DYYYCQLY +SL+LQV
Sbjct: 554 IDSWYVNYNELLSPEETLDPVL-NASKMGLQSMTQIIENESLICDYYYCQLYIYSLSLQV 612

Query: 665 EVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFI 724
           E +ESKL L E+ +SA++V  AY +AKEIL SA R+ +V MLK++PVRWV+RIVR+ SFI
Sbjct: 613 EDEESKLKLKELSQSAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFI 672

Query: 725 VKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASKFSTI 784
           VKCY+T  D       E  S+L LSGI VD+++ +I  AAV+LKESTPDELHL +++S I
Sbjct: 673 VKCYVTATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKI 732

Query: 785 LMFLCKEIDERKRDNENLMTGNGLNNDPS-LESQTTHKESLEASNHDTISSDAQEPPSEN 843
           L+ L +E+   K D  +    +G ++ P  L + TT + ++      T +S +Q      
Sbjct: 733 LLCLYREL---KMDTLSTQQAHGNDSMPERLTADTTLENAIRTEFTTTSNSGSQV----- 784

Query: 844 DSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIE 903
               + T      +T  +  N+      F    P +V+DWFS S +IGL+FVEPWTE+IE
Sbjct: 785 ----ELTPLSNKLATLPIDRNTTPPYASF----PTEVVDWFSTSADIGLEFVEPWTEMIE 836

Query: 904 QKYIQNKDGF-QDFDQLF 920
           Q+YI++ +   +DFD L 
Sbjct: 837 QRYIKSGNTQNKDFDDLL 854

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  533 bits (1374), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 337/919 (36%), Positives = 495/919 (53%), Gaps = 131/919 (14%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC-FFNAPKVKIGKLGNILD 88
           K + ++ ACL C+ +KIKCD+GP D+P  PPC  C+R    C F  + K  + K      
Sbjct: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFK------ 67

Query: 89  XXXXXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNS 148
                                    + HR  NG +      L + V         V +  
Sbjct: 68  -------------------------RQHRT-NGLE------LQDEVEKHVVITHEVDVGG 95

Query: 149 PNTALIEACDRVKSDTAWKLELTSMQSALEFLAKATK--LRNDYKNNEPFGSTRSDAAST 206
           P+   IE   R K D  W+ E++SMQ+ALEFLAKA     + D + +E      S  +  
Sbjct: 96  PSDR-IERHSRNKIDGKWRFEISSMQNALEFLAKAAGSVAKEDNQLHEIKQIDPSQVSRD 154

Query: 207 TSETRDLSEKD-NGNEXXXXXXXXXXXXXXXXXYPSIEAIKPEVPTPSNH--NYDLLGDG 263
            S  +DL+      +                   P I+ +    P P     N + +G  
Sbjct: 155 DSSWKDLTPTSFEASRAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGS 214

Query: 264 KLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNPFDKVG 323
             +T +E   LV++FF  M+PF+P+IPL LQD +EL +YPLLL  I+ +SARY+ F  +G
Sbjct: 215 DQLTEEEVIKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIG 274

Query: 324 FDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAIHWEVS 383
             + ++ NRN+ +H +LW +CQ+L+SQT+W++ASTRSIGT LAFLLFTEWNPRAIHW+ S
Sbjct: 275 LKDNMQNNRNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWS 334

Query: 384 DTAHYLSDNNVS---SSKEDPDGLGGIATVKRSDRMAWMFTGTAIRLAQEMDILENNAKI 440
           D A+     + S   S   D + L G+A ++RSDRMAWM TG A+RLAQ+M   E ++KI
Sbjct: 335 DYANSGDSKDRSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKI 394

Query: 441 YTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNPKSQDDIENEDLLKFVQLVAQ 500
           +TA +I+E   A N+  + TL ESL  I+ G  +F  +N      + NE    +++ + +
Sbjct: 395 FTATHISETHTAMNVGQRSTLTESLNEINLGSIKFPRNN-----SVGNEQF--YLEKILE 447

Query: 501 NKESTKKWA--IHKAYSDKLK-EENPDLIIDLETEFLNDEYSINYL-------DENSSFL 550
           N +S  +W   +H    D    +E P  + D+E EFLNDEY + Y         ++S+ L
Sbjct: 448 NDDSKDRWTRFLHDIRDDYAHHDEGP--LTDIEREFLNDEYVLYYTADGDSKHRDSSNLL 505

Query: 551 KNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYL 610
             P+ ++  Q+A++ELLRI+T+ ++ IY  K K++    D  +NL +L ++SP++ +WY 
Sbjct: 506 PFPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYK 565

Query: 611 NYYKLMKPVSDEKPVIISLDDLSKFKRTAN-----IRGESFISDYYYCQLYTFSLALQVE 665
           +Y+ L++P ++ KP  +   DL + KR  +     I  ES I +YYYCQLY +S ALQV+
Sbjct: 566 SYHDLLEP-AEGKPCTV---DLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVD 621

Query: 666 VKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFIV 725
           VKE +L L+E+ +SA++VE AY AAK +L SA R+H++++LK MPVRWV RIV+S +FIV
Sbjct: 622 VKEGQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIV 681

Query: 726 KCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASKFSTIL 785
           KCY+TL  +++  N  A +ILKL+ I  +D +  I  AA+ILKE++PDELHL  ++STIL
Sbjct: 682 KCYLTLMGNAVVNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTIL 741

Query: 786 MFLCKEIDERK---RDNENLMTGNGLNNDPSLESQTTHKESLEASNHDTISSDAQEPPSE 842
           M LC E+ E +    D+    T  G +NDPS                  I       P  
Sbjct: 742 MSLCSEMRESEDYTTDSPTPGTTFGQDNDPS-----------------PIQPLDTAIPLP 784

Query: 843 NDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELI 902
           ND     +T               DEIG                     L+FVE W E+I
Sbjct: 785 NDVVDWFSTS--------------DEIG---------------------LEFVESWAEMI 809

Query: 903 EQKYIQNKDGFQDFDQLFD 921
           EQ+Y+Q     Q+     D
Sbjct: 810 EQRYLQGSSYSQNLGNAAD 828

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  535 bits (1377), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 350/985 (35%), Positives = 516/985 (52%), Gaps = 147/985 (14%)

Query: 32  KNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDXXX 91
           K  + ACL CK +K+KCDLGP D P  PPC  C+R    C F        K G       
Sbjct: 18  KRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTE-----TKRGGFRVAKQ 72

Query: 92  XXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSPNT 151
                        M + IT  +Q        Q +     ++L  L+    + +S+N+   
Sbjct: 73  SLVSLKEESAGKSMADVITSVIQG-------QTLKKELDTDLDRLQTHTKDDISINT--- 122

Query: 152 ALIEACDRVKSDTAWKLELTSMQSALEFLAKATK--LRNDYKNNEPFGSTRSDAASTTSE 209
                            +  ++Q+A  FLAKA     + D ++     +   +   T + 
Sbjct: 123 -----------------DPPTLQNAFYFLAKAAGSVAKEDLRDQVDAATKYDEIEPTDAV 165

Query: 210 TRDLSEKDNGNEXXXXXXXXXX----------------XXXXXXXYPSIEAIKPEVPTPS 253
           +R  S    GN+                                  P IE +    P PS
Sbjct: 166 SRQPSVSSYGNKQATGSMEPSSIPKMLTDSYVTSFVEPEGQKPGTIPLIEKLSSVRPKPS 225

Query: 254 NHNYDL--LGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILA 311
               D+  +G  +L+T  EAR  ++ FF  MHPF PYIPL LQD DEL +YPLLL  IL 
Sbjct: 226 MKLGDIEYIGPYQLLTEAEARKRIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTILT 285

Query: 312 ISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFT 371
           ISARY+    +G  N I+   +V +H +LW +CQ+L+SQTVW++ASTRSIGT LAFL+FT
Sbjct: 286 ISARYHTLHDLGL-NEIDNTVHVELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLIFT 344

Query: 372 EWNPRAIHWEVSDTAHY--LSD-----NNVSSSKEDPDGLGGIATVKRSDRMAWMFTGTA 424
           EWNPRAIHW+ SD A+Y  +SD     ++ +S  +  D L G+A ++RSDRM+W+ TG A
Sbjct: 345 EWNPRAIHWKGSDYANYPDISDLPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTGNA 404

Query: 425 IRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNPKSQD 484
           +RLAQ+++++E ++KI+   +I E   A N+N + +L ESL  +   +  FE DN     
Sbjct: 405 VRLAQDLNVIEFSSKIFVMTHICETHTAMNLNKRSSLSESLSEVR--LNGFE-DN----- 456

Query: 485 DIENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENP-DLIIDLETEFLNDEYSI-NY 542
           D++NE    F++ + QN +S ++WA    + +++ E +    + D+E EFLNDEY + +Y
Sbjct: 457 DLDNEQF--FLERILQNDKSKERWA---RFLERVGERSKKGSLTDIEREFLNDEYLLYHY 511

Query: 543 LDENSSFLKNP---IPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILD 599
             EN +   +P   + ++  Q+ ++ELL+IV++ Y+ +Y  K+    SS D+ + L +L 
Sbjct: 512 NTENPNTQSDPEFRLKFSKIQRGKVELLKIVSLGYENVYNGKL----SSHDRHQRLSMLS 567

Query: 600 VLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLS-KFKRTANIRGESFISDYYYCQLYTF 658
           VLSP++  WY  Y  L+ P       I    + S  F+ T  +  ES ISDYYYCQLY +
Sbjct: 568 VLSPLIEGWYNIYKSLLVPCGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIY 627

Query: 659 SLALQVEVKE---SKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVM 715
           SLALQ + ++   SKL LNE+ KSAR+VE AY AAKEIL SA RVHK+ MLKYMPVRWVM
Sbjct: 628 SLALQWDHQDTSTSKLRLNEITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVM 687

Query: 716 RIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDEL 775
           RIVRS  F++KCY+TL  + +  N EA +IL +S +  D+ +  I++ A+IL+ + PDEL
Sbjct: 688 RIVRSIVFMIKCYLTLTGNGITQNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDEL 747

Query: 776 HLASKFSTILMFLCKEIDERKRDNENLMTGNGLNNDPSLESQTTHKESL----------- 824
           HL S++STILM+LC E+  R + N        ++ND  L+  +   E++           
Sbjct: 748 HLCSRYSTILMYLCTEMKHRCKPNMQPPVPRSISND-YLDKTSNRSENVADNSARHFSVG 806

Query: 825 --EASNHDTISSDA-----------------QEPPSENDSSHDTTTQGTA---------- 855
             + S+   +SS                   QE  ++     DT T  +A          
Sbjct: 807 GYQVSDTANVSSSPFINKGTNVRFGSTEYKQQETTNDEQQRPDTFTVDSALGVASINSAP 866

Query: 856 -------------NSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELI 902
                         S    GPNS         YLP  ++DWF+ +N IGLDFV PWTE++
Sbjct: 867 PAPVPEPAPDTNPASAINTGPNSSG------GYLPPQLVDWFNDNNEIGLDFVGPWTEMV 920

Query: 903 EQKYIQNKDGFQDFDQLFDEFAIRP 927
           E++++ NK     ++  F++F   P
Sbjct: 921 EKQFV-NKVDDSSYENWFNDFYTPP 944

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  495 bits (1274), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 295/791 (37%), Positives = 451/791 (57%), Gaps = 93/791 (11%)

Query: 169 ELTSMQSALEFLAKATKLRNDYKNNEPFGSTRSDAASTTSETRDLSEKDNGNEXXXXXXX 228
           EL SM +ALEFLAKA         +     +RS   S   + + + EK    E       
Sbjct: 113 ELNSMHNALEFLAKAA-------GSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHA 165

Query: 229 XXXXXXXXXXYPS--IEAIKPEVPTPSNHNYDL-----LGDGKLVTMDEARMLVNIFFNF 281
                      P   IE +    P      YDL     +G  KL+T  EA  L+++FF  
Sbjct: 166 SGSKRASLAT-PGKLIEKLSDWKP---GSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLN 221

Query: 282 MHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLW 341
           MHPF+PYIP  L+   EL +YP+LL  IL ISARY+ F +     G   +RN+ +H++LW
Sbjct: 222 MHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLW 281

Query: 342 THCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAIHWEVSDTAHYLSDNNVS------ 395
            +CQ+L+SQ+VW++ASTRS+GT LAFLLFTEWNPRAIHW  +D A+  S +++S      
Sbjct: 282 IYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHS 341

Query: 396 -SSKEDPDGLGGIATVKRSDRMAWMFTGTAIRLAQEMDILENNAKIYTAANIAEICYASN 454
            + + D   L G+  ++RSDRMAWM TGTA+RLAQ+M  + N+ KI+TA +I E   A N
Sbjct: 342 EAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMN 401

Query: 455 MNLKPTLGESL--VSIDGGMKEFEIDNPKSQDDIENEDLLKFVQLVAQNKESTKKWAIHK 512
           MN +  L +SL  VS++G     + D+  S   IE          + +N++S ++W  + 
Sbjct: 402 MNQRSILSQSLAEVSLNG----HDGDSGLSSACIEE---------IFRNEDSKRRWKSYT 448

Query: 513 AYSDKLKEENPDLIIDLETEFLNDEYSINYLDENSSF---------------LKNPIPYT 557
              D ++ ++     D E EFL DEY+  + +++ ++                 + + +T
Sbjct: 449 QQRDSVEGKSVGF-CDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFT 507

Query: 558 TYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMK 617
             Q+A++ELLRI++I Y+ IYY+  K  ++ +D K  L +L +L+P++  W+  Y  L+ 
Sbjct: 508 PRQRAKVELLRIMSIGYEAIYYKDTK--LTLIDHKHKLAVLGILAPMIKGWHNTYKHLLV 565

Query: 618 PVSDEK-PVIISLDDLSKFKRTANIRGESFISDYYYCQLYTFSLALQVEV---KESKLTL 673
           P +  + P     +  + +   + I  ES ISDY+YCQLY +SLALQ+E    K+ K  +
Sbjct: 566 PFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNI 625

Query: 674 NEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLCD 733
           NE+ KSA++VE AY AAKE+L SAIRVHK+  LKYMPVRW  RI+R+ +F+V+CY+TL  
Sbjct: 626 NELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPVRWAARIIRAVAFVVRCYMTLTG 685

Query: 734 HSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASKFSTILMFLCKEID 793
             + ++  A +IL +  I  ++ + MI++AA+ L+E++PDELHL S+FST+LMFLC E+ 
Sbjct: 686 SGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEM- 744

Query: 794 ERKRDNENLMTGNGLNNDPSLESQTTHKESLEASNHDTISSDAQEP--PSENDSSHDTTT 851
           +RK+ +E          +  L   ++H      S H+   + A+ P  P+EN ++ D   
Sbjct: 745 KRKQHSE--------PQNSELRRSSSH------SLHNPTDAPARMPTTPAENYAATDFAI 790

Query: 852 QGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKD 911
                +                ++LP ++ DWF  S+++GLDFVEPW E++EQ++I N D
Sbjct: 791 PAFLETPH-------------PSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINN-D 836

Query: 912 GFQDFDQLFDE 922
               F+ L++E
Sbjct: 837 KNMTFENLYNE 847

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
          K++  + ACL C+ +K +CDLGP D P  PPC  C+R R  C F
Sbjct: 16 KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVF 59

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  471 bits (1211), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 280/814 (34%), Positives = 451/814 (55%), Gaps = 71/814 (8%)

Query: 32  KNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDXXX 91
           + ++ AC+ C+ KK+KCDLGP + P SPPC  C+R    C F+ P  K+G + N  D   
Sbjct: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSID 84

Query: 92  XXXXXXXXXXXXXMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSPNT 151
                        + N+    +Q       N ++    +S++V            NS   
Sbjct: 85  DNQR---------VPNSPEDEIQQ------NTDIIQERISSIVATNESRFNNDISNSQKH 129

Query: 152 ALIEACDRVKSDTAWKLELTSMQSALEFLAKAT-------------KLRNDYKN--NEPF 196
              +     KS+   K+  T+M++ALEFLA A              +L N ++   N+  
Sbjct: 130 ERKDKPSERKSNL--KVNFTNMRNALEFLANAAGQAAEERLSEEEEELNNKFEKELNDDH 187

Query: 197 GSTRSDAASTTSETRDLSEKDNGNEXXXXXXXXXXXXXXXXXYPSIEAIKPEVPTPSNH- 255
            S  S A  +T+ T  +   D  +E                    IEA+    P  +   
Sbjct: 188 ISIDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKL 247

Query: 256 -NYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISA 314
            +YD +G  K+++  EA  L+N FF  MHPFYPY+P  LQD  EL +YP+LL  IL IS+
Sbjct: 248 TDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISS 307

Query: 315 RYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWN 374
           R++ F+++G  NG+   R++ +H KLW +CQ+++SQTVW++ASTRS+GT LAFLLFTEWN
Sbjct: 308 RHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWN 367

Query: 375 PRAIHWEVSDTAHYLSDNNVSSSK---EDPDGLG----GIATVKRSDRMAWMFTGTAIRL 427
           PRAIHW+ +D A+    N+ S+S     D   +G    G+  ++RSDRMAWM  GT++R+
Sbjct: 368 PRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRI 427

Query: 428 AQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSI---DGGMKEFEIDNPKSQD 484
           AQ+M  +EN++ ++ A + +E  +A N+  + +L ESL       G M  +     K Q 
Sbjct: 428 AQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYR---NKQQQ 484

Query: 485 DIENEDLLKFVQLVAQNKESTKK--W--AIHKAYSDKLKEENPDLIIDLETEFLNDEYSI 540
            ++NE +     + ++N + T++  W   + +   +K+  ++   + D    FLNDE+++
Sbjct: 485 TLKNE-IFYIENIFSENFKITERNYWKSQLQENIENKIDIDDKIALSDKVRGFLNDEFAL 543

Query: 541 NYLDEN-------------SSFLKNPIP--YTTYQKAQLELLRIVTITYQTIYYEKMKKR 585
            Y + N             SSF   P+P   +  Q+A +ELLRI +  Y+TIY     ++
Sbjct: 544 FYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRNQNQK 603

Query: 586 VSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTAN--IRG 643
           +SS +Q  N+ +LD+ +P+L+ W + +  L++P    +P+ ++  +  +  +  N  I G
Sbjct: 604 LSSNNQSHNISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLNNRNNKRVVKEFNKIIEG 663

Query: 644 ESFISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKV 703
           ES I DY YCQLY FSLALQ+ +    LT+NE+ KS+ ++  AY++AKE + S  RV  +
Sbjct: 664 ESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTL 723

Query: 704 DMLKYMPVRWVMRIVRSASFIVKCYITLC--DHSMATNSEAKSILKLSGILVDDTVHMIR 761
            MLKYMPVRW+ R++R+ +F+VKCY+++   D  + + SE   I KL G   ++ + +I+
Sbjct: 724 KMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIK 783

Query: 762 QAAVILKESTPDELHLASKFSTILMFLCKEIDER 795
           ++A++L  S+PDELHL S++S+I+M   KE+ E+
Sbjct: 784 KSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEK 817

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 858  TRKVGPNS--IDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDGF 913
            TR+  PN+      G+ T     + +DWFSAS +IGL+FVE WTE++EQ+Y+++ D  
Sbjct: 957  TRETSPNTGHTGVTGEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNL 1014

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  431 bits (1108), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 257/699 (36%), Positives = 389/699 (55%), Gaps = 69/699 (9%)

Query: 256 NYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISAR 315
           N + +G    +T++E   L  +FF   +PF+P+IPLH+QD +EL +YP+LL  +L+ISAR
Sbjct: 250 NIEYVGPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELARYPILLCGVLSISAR 309

Query: 316 YNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNP 375
           Y+ F+ +G  N     RN+ +H  LW +CQQ++SQTVW++ASTRSIGT L FL+FTEWNP
Sbjct: 310 YHKFEDIGLSNRGSPTRNIDVHEYLWRYCQQMISQTVWTEASTRSIGTVLVFLIFTEWNP 369

Query: 376 RAIHWEVSDTAHYLSDNNVSSSKEDPD------------------------GLGGIATVK 411
           RAIH + +D A+     N  S  E  +                        G  G++ ++
Sbjct: 370 RAIHRKCNDYANATDRQNEQSHSEKANTAHCGSGIPATERNGPRRFVLADQGSSGLSAMR 429

Query: 412 RSDRMAWMFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLV--SID 469
           RS RMAWM  G A+RLAQ+MD +  ++KI+ A + +E   A NM    TL  SL+  +I 
Sbjct: 430 RSKRMAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQNSTLSHSLMNANII 489

Query: 470 GGMKEFEIDNPKSQDDIENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDL 529
           G      I NP      E E+  K V L    K   +   + + Y++ L++E     +  
Sbjct: 490 GSESSTAISNPPMPS--ETEERYKSV-LQRLGKHVPRGRGLSQLYNEFLEDERILYGLGG 546

Query: 530 ETEFLNDEYSINYLDEN-----------SSFLK---NPIPYTTYQKAQLELLRIVTITYQ 575
            +E++  E   + LD+            SS L+     +  +  Q+A++ELLRI+++ Y+
Sbjct: 547 GSEYV--EAYCDSLDQTKNNVSIETAYESSLLERGGQQVFLSFAQRAKIELLRIMSVGYE 604

Query: 576 TIYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLD--DLS 633
           TIY    K  +   ++   L +L +LSP +  WY  Y  L+ P     P   + D   ++
Sbjct: 605 TIYSNHAKLVLR--EKHHILSVLGLLSPQIENWYTQYNSLLVPAGG-APFNPTADFSRIN 661

Query: 634 KFKRTANIRGESFISDYYYCQLYTFSLALQVEVKESKLT----LNEMIKSARFVEQAYRA 689
                  I  ES I DYYYCQLY +SLAL V+ ++ +      L+ ++KSAR+VE AY A
Sbjct: 662 PLDLVRRIDAESIICDYYYCQLYIYSLALTVDFRKPRHPNASWLDRLMKSARYVELAYNA 721

Query: 690 AKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLS 749
           A+E+L+SAIRVH++ MLKYMP RWV RIV + +FIVKCY+T+  H  A++ EA +IL LS
Sbjct: 722 AREVLRSAIRVHRIRMLKYMPTRWVERIVGAVAFIVKCYLTMAAHLTASH-EASAILTLS 780

Query: 750 GILVDDTVHMIRQAAVILKESTPDELHLASKFSTILMFLCKEIDERKRDNENLMTGNGLN 809
            I  D+ V+ I++AA+ L+E++PD++HL +K+STILM+LC E+  R            ++
Sbjct: 781 AIPPDEVVNTIQRAAITLREASPDDVHLCNKYSTILMYLCSEMKLRNWPTPTPPLPRSVS 840

Query: 810 ND----PSLESQTTHKESLEASNHDTISSDAQEPPSENDSSHDTTTQGTANSTRKVGPNS 865
            +    P  E   T    + +  H          P+E+ ++  T      + T    P+S
Sbjct: 841 GEPIRVPVFECSATPAARIFSPPHH---------PAESQTTGGTDPPPLPDHT-LAAPSS 890

Query: 866 IDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQ 904
                  T++LP ++IDW   S+ IGLDFVEPWT++IE+
Sbjct: 891 DPAPFDTTSHLPWELIDWLHTSDEIGLDFVEPWTDVIER 929

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
          K +  + ACL C+ +K++CDLGP D+P  PPC  C R R  C F
Sbjct: 24 KWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIF 67

>NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa]
          {ON} 
          Length = 704

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          K K    AC +C +++IKCD  P  R     C+ C ++   C FN   +K G
Sbjct: 36 KRKKASRACDQCHHRRIKCDFNPETR----NCSGCEKTEEKCLFNRIPMKRG 83

>CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa]
          {ON} some similarities with uniprot|P25502
          Saccharomyces cerevisiae YKL015w PUT3 positive
          activator of the proline utilisation pathway
          Length = 824

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          ACLRC+ K IKC       P   PCA C  S + C + AP  KI 
Sbjct: 27 ACLRCRQKHIKC-------PGGNPCAKCVISSATCEYLAPTKKIA 64

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 6/38 (15%)

Query: 34 TFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          T+  C  C+ +K+KCDL      V P C  CRRS+  C
Sbjct: 11 TYSGCWTCRARKVKCDL------VRPSCLRCRRSKVQC 42

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 12/59 (20%)

Query: 34 TFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC------FFNAPKVKIGKLGNI 86
          TF  C  C+ +K+KCDLG       P C  C +S   C         +P +K  K G +
Sbjct: 19 TFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLECGGYDIKLRWSPSIKFNKFGQV 71

>YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON}
          Putative protein of unknown function with similarity to
          Pip2p, an oleate-specific transcriptional activator of
          peroxisome proliferation; YLL054C is not an essential
          gene
          Length = 843

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGK 82
           CLRCK +KIKCD       + P C+ C+ S S C +     +I K
Sbjct: 14 VCLRCKQRKIKCD------KLWPTCSKCKASSSICSYEVEPGRINK 53

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 6/42 (14%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          +   TF  C  C+ +K+KCDLG       P C  C RS   C
Sbjct: 12 RRAKTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 9   VPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSR 68
            P K+SRS++             K    AC +C+ +KIKCD    D+ V   C++C R+ 
Sbjct: 49  APGKRSRSSS---TGSAKGSIGGKKATRACDQCRKRKIKCDYD-NDKNV---CSSCNRNG 101

Query: 69  SHCFFNAPKVKIG 81
             C FN  ++K G
Sbjct: 102 DRCQFNRVQLKRG 114

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa]
          {OFF} YJL089W (SIP4) - shows homology to DNA binding
          domain of Gal4p, has a leucine zipper motif and acidic
          region; lexA-Sip4p activates transcription [contig 304]
          PARTIAL
          Length = 201

 Score = 37.7 bits (86), Expect = 0.062,   Method: Composition-based stats.
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 6/35 (17%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          AC RC+ KKIKCD       V P C  C + + HC
Sbjct: 28 ACDRCRLKKIKCD------GVKPTCGPCSKIKFHC 56

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
          uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 6/35 (17%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          AC RC+ KKIKCD       + P C+ C++   HC
Sbjct: 62 ACDRCRLKKIKCD------GIKPSCSNCKKIGYHC 90

>NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423
          Length = 949

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 33/87 (37%), Gaps = 13/87 (14%)

Query: 3   NKIVKPVPKKKSRST-------TPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADR 55
           N I KP PK++ ++          V          H  +   C  CK +++KCD      
Sbjct: 22  NSITKPKPKRREKNIELIEVGGKKVSKTSTGKRKFHNKSKNGCDNCKRRRVKCDES---- 77

Query: 56  PVSPPCAACRRSRSHCFFNAPKVKIGK 82
              P C  C   + HC +  P+ +  K
Sbjct: 78  --KPHCQKCVNMQLHCVYTPPQPRRSK 102

>KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON}
          Anc_5.322 YHR056C
          Length = 827

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 7/38 (18%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRS-RSHCFF 73
          AC++C+ +KI CD       V P C  CR+S R  CF+
Sbjct: 13 ACVQCRKRKIGCD------RVKPMCGNCRKSNRGDCFY 44

>TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {ON}
           Anc_8.423 YLR228C
          Length = 886

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 14/66 (21%)

Query: 31  HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKV--------KIGK 82
           HK +   C  CK +++KCD         P CA C+  +  CF++  K         KI K
Sbjct: 47  HKKSKSGCDHCKRRRVKCD------EAKPFCANCQHMKLDCFYSPIKPRKKKTVSKKISK 100

Query: 83  LGNILD 88
           + N+ D
Sbjct: 101 INNVQD 106

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
           AC +C+ KK+KCD G  DR V   C  C+R+   C F    +K G
Sbjct: 62  ACDQCRKKKVKCDNG-DDRSV---CTNCQRNGEKCTFERVPLKRG 102

>Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON}
          (12074..14566) [2493 nt, 831 aa]
          Length = 830

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 6/42 (14%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          K   TF  C  C+ +KIKCDL        P C  C  SR  C
Sbjct: 18 KRIKTFTGCWTCRSRKIKCDL------TKPSCRKCTNSRIEC 53

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 38.9 bits (89), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 6/54 (11%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKL 83
          +   TF  C  C+ +K+KCDL        P C+ C RS   C     K++  KL
Sbjct: 4  RRAKTFTGCWTCRSRKVKCDLR------RPNCSRCERSELQCGGYDIKLRWSKL 51

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 38.5 bits (88), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 6/42 (14%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          K   TF  C  C+ +KIKCDL        P C  CR S   C
Sbjct: 15 KRAKTFEGCWTCRLRKIKCDLK------KPKCDKCRSSAISC 50

>Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}
          YLL054C (REAL)
          Length = 842

 Score = 38.5 bits (88), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 6/35 (17%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
           CLRCK +KIKCD       + P C+ C+ S S C
Sbjct: 14 VCLRCKQRKIKCD------KLWPTCSKCKASSSAC 42

>KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa]
          {ON} Anc_7.389 YBL066C
          Length = 1067

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 3/35 (8%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          +C  C+  KIKCD   A++    PC+ CR+ + HC
Sbjct: 62 SCSHCRQHKIKCD---ANQSFPAPCSRCRKYQLHC 93

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 89/228 (39%), Gaps = 37/228 (16%)

Query: 240 PSIEAIKPEVPTPSNHNYDL-------LGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLH 292
           P+I       P PS H  +L       +GD + + +D+A  L ++F     PF P   + 
Sbjct: 304 PNIVTTTTTQPLPSPHEINLENIDEFVIGDVR-IPIDQANELHSVFVRDYLPFLPI--MF 360

Query: 293 LQDFDELFKYPLLLHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTV 352
                EL+    LL   + ++A  +             +    ++ KL +  +QL  +T 
Sbjct: 361 TNSATELYSQSQLLFWTVMLTACLS-------------DSEPSLYVKLSSLIKQLAVETC 407

Query: 353 WSQASTRSIGTTLAFLLFTEWNPRAIHWEVSDTAHYLSDNNVSSSKEDPDGLGGIATVKR 412
           W + + RS   + A L+ + W P      + D ++     N++ S     GL        
Sbjct: 408 WIR-TPRSTHISQALLVLSMW-PLPNQKVLDDCSYRFV--NLAKSLSYQLGL-------H 456

Query: 413 SDRMAWMFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPT 460
                W FT T   +    +  +   + +     AEIC+AS + L PT
Sbjct: 457 RGEFIWEFTRTQTSMP---NAEKWRTRTWLGVYFAEICWASILGLPPT 501

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNA 75
          K K T   C+ CK +K++C+     RP+   C+ C+R   HC + A
Sbjct: 27 KSKRTVSVCIPCKSQKLRCNKA---RPI---CSRCQRLGKHCHYGA 66

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON}
          similar to uniprot|P32862 Saccharomyces cerevisiae
          YKL038w RGT1
          Length = 1287

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          K  N   AC +C+ KKIKCD    +R +   C +C+R+   C F    +K G
Sbjct: 8  KRTNVSRACDQCRRKKIKCDRN-QERNI---CTSCQRNGERCKFERVPLKRG 55

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
          similar to uniprot|P46954 Saccharomyces cerevisiae
          YJL089W SIP4 Possibly involved in Snf1p regulated
          transcriptional activation shows homology to DNA
          binding domain of Gal4p has a leucine zipper motif and
          acidic region lexA-Sip4p activates transcription
          Length = 862

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 6/42 (14%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          KH     AC RC+ KKIKCD       + P C  C +   HC
Sbjct: 21 KHARMSQACDRCRLKKIKCD------GIKPTCTPCTKIGFHC 56

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1020

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          AC +C+ KKIKCD+   D PV   C+ C +    C F    +K G
Sbjct: 35 ACDQCRKKKIKCDVS-EDNPV---CSGCFKVGDRCTFERVPLKRG 75

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 1/73 (1%)

Query: 5   IVKPVPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAAC 64
           ++  V     R + P          + +NTF AC+ C   K KC     D     PC  C
Sbjct: 35  VITGVNSDDPRLSVPTRINSSEWEKRKRNTF-ACISCHASKQKCVPSDLDDIFLKPCQRC 93

Query: 65  RRSRSHCFFNAPK 77
            RS+  C F+  K
Sbjct: 94  FRSKKICAFDLSK 106

>NCAS0F02700 Chr6 complement(547682..550189) [2508 bp, 835 aa]
          {ON} Anc_5.322 YDR303C
          Length = 835

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 7/38 (18%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRS-RSHCFF 73
          AC++C+ +KI CD       V P C  CR++ +  CFF
Sbjct: 13 ACVQCRKRKIGCD------RVKPICGNCRKTNKGDCFF 44

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 29/76 (38%)

Query: 5  IVKPVPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAAC 64
          IV P+P+K +                      AC++C+ + +KC       P   PC  C
Sbjct: 29 IVPPIPRKSN----------------------ACIQCRRRHVKC-------PNGNPCLRC 59

Query: 65 RRSRSHCFFNAPKVKI 80
           +S+  C ++ P  KI
Sbjct: 60 VKSKLQCEYSEPSRKI 75

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 8/59 (13%)

Query: 31 HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNA--PKVKIGKLGNIL 87
          H  +   C  CK +++KCD G       P C  C   R  C F    P+ K  K+ N L
Sbjct: 27 HNKSKNGCDNCKRRRVKCDEG------KPFCQKCANMRLECVFTPPQPRRKKSKVSNTL 79

>KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON}
          conserved hypothetical protein
          Length = 597

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 32 KNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF-NAPKVKIGKLG 84
          K +   CL C+ +K KCD       V P C AC+R+   C + N+   K GK+G
Sbjct: 5  KRSSTGCLICRRRKKKCD------EVKPTCTACKRNFLECIWPNSSNTKDGKVG 52

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          +   T  AC +C+ KK +CD    +RP+   C+AC+R    C F    +K G
Sbjct: 27 RRSKTSRACDQCREKKTRCDFS-DERPI---CSACQRMGKTCTFERVPMKRG 74

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKI 80
          AC+RC+ + IKC       P + PC  C  +   C F+ P  K+
Sbjct: 58 ACIRCRERHIKC-------PGNDPCQKCLEANHICKFSEPNKKV 94

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 838

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKI 80
          AC+RC+ K +KC       P   PC+ C  +R  C +  P  K+
Sbjct: 41 ACVRCRRKHVKC-------PGGDPCSKCSAARIACEYLEPNKKL 77

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 6/38 (15%)

Query: 34 TFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          TF  C  C+ +K+KCDLG       P C  C +S   C
Sbjct: 19 TFTGCWTCRSRKVKCDLG------KPTCQRCDKSGLEC 50

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 6/38 (15%)

Query: 34 TFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          TF  C  C+ +K+KCDL        P C  C RS   C
Sbjct: 18 TFTGCWTCRARKVKCDL------TRPSCTRCERSGLKC 49

>KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa]
          {ON} Anc_8.423 YLR228C
          Length = 794

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 34/84 (40%), Gaps = 13/84 (15%)

Query: 3  NKIVKPVPKKKSRS-------TTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADR 55
          N I+KP+ KK+  S       +  V          H  +   C  CK +++KCD      
Sbjct: 14 NSIMKPLTKKRESSVDLTSLDSNKVSKTSTGKRKFHNKSKTGCDNCKRRRVKCD------ 67

Query: 56 PVSPPCAACRRSRSHCFFNAPKVK 79
             P CA C   +  C ++ P+ +
Sbjct: 68 ETKPMCAKCCNMKLTCVYSPPQPR 91

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 6/38 (15%)

Query: 34 TFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          TF  C  C+ +K+KCDLG       P C  C +S   C
Sbjct: 40 TFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71

>TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa]
          {ON}
          Length = 812

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 37 ACLRCKYKKIKC---DLGPADRPVSPPCAACRRSRSHCFFNAPKVK 79
          AC+RC   K KC   DL    R    PC+ C+R R  C F+  K K
Sbjct: 48 ACVRCHRLKQKCLPSDLADIYRK---PCSKCKRMRLKCVFDLTKRK 90

>SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON}
          conserved hypothetical protein
          Length = 1061

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 9/52 (17%)

Query: 30 KHKNTFGACLRCKYKKIKCD------LGPADRPVSPPCAACRRSRSHCFFNA 75
          K K    ACL C+ KKIKCD      LG +D  +   C+ C  S S C F A
Sbjct: 11 KRKVARRACLTCREKKIKCDGEVRASLGGSDPGI---CSNCAASGSKCVFVA 59

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 6/38 (15%)

Query: 34 TFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          TF  C  C+ +K+KCDLG       P C  C +S   C
Sbjct: 42 TFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSC 73

>Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON}
          YLL054C (REAL)
          Length = 845

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGK 82
           CLRCK +K KCD       + P C+ C+ S S C +   + +  K
Sbjct: 14 VCLRCKQRKTKCD------KLWPTCSKCKASSSICTYEVERERSNK 53

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
          similar to uniprot|P46954 Saccharomyces cerevisiae
          YJL089W SIP4 Possibly involved in Snf1p regulated
          transcriptional activation shows homology to DNA
          binding domain of Gal4p has a leucine zipper motif and
          acidic region lexA-Sip4p activates transcription
          Length = 919

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 6/35 (17%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          AC RC+ KKIKCD       + P C +C++   HC
Sbjct: 28 ACDRCRLKKIKCD------GLKPNCTSCKKVGFHC 56

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFN-------APKVKIGKLGNILD 88
          AC  C+ +KIKC     +R    PCA C+     C F+       A KVK  K+  I++
Sbjct: 16 ACDNCRRRKIKCS---GER----PCAGCKTYNCECIFSVSAPTPRASKVKKNKIAGIVN 67

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPP--CAACRRSRSHCFFNA 75
          K K    ACL C+ +KIKCD      P   P  C  C RS   C F A
Sbjct: 19 KRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVFVA 66

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
           AC +C+ KKIKCD   A       C+ C+R+   C F    +K G
Sbjct: 90  ACDQCRKKKIKCDFTEAKN----ICSNCQRNAEKCTFERVPLKRG 130

>ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON}
          NOHBY314; No homolog in Saccharomyces cerevisiae
          Length = 109

 Score = 33.9 bits (76), Expect = 0.45,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          K K    +C+RC+  KIKCD     RP   PC++C +    C
Sbjct: 23 KMKKPLRSCVRCRKNKIKCD-SATRRP--KPCSSCLKKGVGC 61

>NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON}
          Anc_2.547
          Length = 924

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          AC +C  ++I+C+       V+  CA C+R   HC F    +K G
Sbjct: 50 ACDQCHKRRIRCNYNK----VTNMCAGCKRIGEHCLFTRIPLKRG 90

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 36.2 bits (82), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVK 79
           AC  C+ +KIKCD  P D P++  C+ C +    C F+  K K
Sbjct: 140 ACESCRKRKIKCD--PVD-PITNKCSNCTKFHMICVFDNRKRK 179

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 6/37 (16%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
           CL C+ KK+KCD         P C  CR++   C +
Sbjct: 14 VCLVCRSKKVKCD------KARPSCGRCRKTNKLCVY 44

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
          similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 32 KNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          K +  AC RC+ KKIKCD       V P C +C++    C
Sbjct: 24 KRSSQACDRCRLKKIKCD------GVRPSCTSCKKIGYQC 57

>Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON}
          similar to Ashbya gossypii ACL195C
          Length = 114

 Score = 33.5 bits (75), Expect = 0.59,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          K K    +C+RC+  K+KCD     RP   PC++C +    C
Sbjct: 28 KMKKPLRSCVRCRKNKVKCD-SAIRRP--KPCSSCLKKGVSC 66

>SAKL0H14014g Chr8 complement(1196584..1198659) [2076 bp, 691 aa]
          {ON} conserved hypothetical protein
          Length = 691

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          +H+N+   C  CK ++IKCD         P C  C++ R+ C
Sbjct: 39 RHRNSRWGCKECKRRRIKCD------ETLPECLNCQKKRNKC 74

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 6/35 (17%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
           AC RC+ KKIKCD       + P C+ C ++   C
Sbjct: 121 ACDRCRLKKIKCD------DLKPSCSQCLKADFQC 149

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 35.8 bits (81), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 7/37 (18%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
          ACL C++K+ KC++         PC+ C+R+   C F
Sbjct: 20 ACLHCRHKRKKCNM-------KSPCSNCQRAGMKCIF 49

>TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {ON}
           Anc_3.264 YDR034C
          Length = 770

 Score = 35.8 bits (81), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 6/44 (13%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
           K K +   C  CK +++KCD         P C  C R   HC +
Sbjct: 132 KRKYSRNGCTECKRRRMKCD------ETKPTCWQCSRLNRHCVY 169

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 35.8 bits (81), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAP 76
           C+ CK +K++CD    +R   P C+ CRR    C + +P
Sbjct: 30 VCITCKNQKLRCD---RER---PSCSRCRRIGRDCVYESP 63

>CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa]
          {ON} weakly similar to uniprot|Q03631 Saccharomyces
          cerevisiae YML076c
          Length = 945

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 32 KNTFGACLRCKYKKIKC---DLGPADRPVSPPCAACRRSRSHCFFN 74
          +NTF AC++C   K KC   D+G   R    PC  C RSR  C F+
Sbjct: 57 RNTF-ACVKCHDLKQKCRPSDVGDIYRN---PCVRCLRSRDPCIFD 98

>Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON}
          YER184C (REAL)
          Length = 793

 Score = 35.4 bits (80), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 8/41 (19%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF-NAP 76
          AC RC  KKIKCD          PC  C  SRS C + N P
Sbjct: 17 ACERCHRKKIKCD-------SKKPCFGCAGSRSKCTYKNQP 50

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON}
          Anc_8.423
          Length = 775

 Score = 35.4 bits (80), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 32/88 (36%), Gaps = 13/88 (14%)

Query: 2  DNKIVKPVPKKKSRST-------TPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPAD 54
          D+ I KP  KKK R           V          H  +   C  CK +++KCD     
Sbjct: 15 DHHISKPSRKKKDRVVELVEVDGKKVSKTSTGKRKFHNKSKNGCDNCKRRRVKCD----- 69

Query: 55 RPVSPPCAACRRSRSHCFFNAPKVKIGK 82
            + P C  C      C ++ PK +  K
Sbjct: 70 -ELKPTCQKCINMNLECVYSMPKPRKAK 96

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 6/35 (17%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
           AC RC+ KKIKCD       + P C  CR+   +C
Sbjct: 100 ACDRCRLKKIKCD------GLIPHCTNCRKINFNC 128

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 35.4 bits (80), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 6/42 (14%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          K   TF  C  C+ +K+KCDL        P C  C +S   C
Sbjct: 20 KRAKTFTGCWTCRSRKVKCDLQ------RPNCGRCEKSGLDC 55

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 32 KNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          K +  AC RC+ KKIKCD       + P C +C++    C
Sbjct: 23 KRSSQACDRCRLKKIKCD------GLRPSCTSCKKIGYQC 56

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 35.0 bits (79), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 6/54 (11%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKL 83
          +   TF  C  C+ +K+KCDL        P C  C +S   C     K++  KL
Sbjct: 13 RRAKTFTGCWTCRSRKVKCDLR------RPGCVRCDKSGLECGGYDIKLRWSKL 60

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
          Anc_4.344 YML076C
          Length = 936

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 29/73 (39%), Gaps = 1/73 (1%)

Query: 5  IVKPVPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAAC 64
          +++ VP    R   P            ++ F AC+RC   K KC    ++     PC  C
Sbjct: 22 VIEGVPSDDPRMREPTKLETKKDGKTKRHAF-ACVRCHSLKQKCVPSDSNDIYRKPCQRC 80

Query: 65 RRSRSHCFFNAPK 77
           R +  C F+  K
Sbjct: 81 LRQKIVCKFDLSK 93

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          AC +C+ KKIKCD    +R V   C+ C+R+   C F    +K G
Sbjct: 46 ACDQCRKKKIKCDYK-DERGV---CSNCQRNGDRCSFERVPLKRG 86

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 7/44 (15%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKI 80
           AC+RC+ + +KC       P   PCA C  +   C +  P  K+
Sbjct: 75  ACVRCRRRHVKC-------PGGQPCAKCASANIACEYLEPNKKL 111

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON}
          Anc_1.277 YJL089W
          Length = 945

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 6/35 (17%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          AC RC+ KK++CD       + P C+ C R+   C
Sbjct: 58 ACDRCRLKKVRCD------GLKPSCSQCSRANFRC 86

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 12/63 (19%)

Query: 32 KNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPK------VKIGKLGN 85
          + +F  C  C+ +K+KCDL        P C  C R    C   + K      VK  K G+
Sbjct: 11 RKSFNGCWTCRSRKVKCDLN------RPKCQRCDRLGIICEGYSVKLHWSKPVKFDKFGD 64

Query: 86 ILD 88
           +D
Sbjct: 65 FVD 67

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 7/38 (18%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFN 74
          AC  C+ ++ KCDL       S PCA+C R R  C  N
Sbjct: 58 ACTNCRKRRKKCDL-------SYPCASCVRLRIDCNVN 88

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
          YML099C
          Length = 861

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 6/42 (14%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          +   TF  C  C+ +K+KCDL        P C  C +S   C
Sbjct: 15 RRAKTFTGCWTCRSRKVKCDLR------RPGCLRCEKSSLEC 50

>CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} similar
           to uniprot|P34228 Saccharomyces cerevisiae YBL066c SEF1
          Length = 1098

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFN 74
           +C  C+  KIKCD   A +    PC  C ++  HC  N
Sbjct: 86  SCTHCRQHKIKCD---ASQNFPAPCTRCAKNGFHCEIN 120

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 6/44 (13%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
           K K +   CL CK +++KCD G       P C  C R    C +
Sbjct: 147 KRKYSRNGCLECKKRRMKCDEG------KPTCWQCARLNRKCVY 184

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 12/85 (14%)

Query: 267 TMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNPFDKVGFDN 326
           T++E    VN++ +  HP++P+I LH  +  ++  YPLLL  I  I A Y          
Sbjct: 654 TLEELNSYVNLYQDEFHPYFPFIHLHSIE-PKIEIYPLLL-SIAVIGALY---------- 701

Query: 327 GIEGNRNVIIHNKLWTHCQQLLSQT 351
           G   +  +++ N    H +++L +T
Sbjct: 702 GFHSSHAMLLSNISRFHIREILERT 726

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 12/54 (22%)

Query: 31  HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF------NAPKV 78
           H  +   C  CK +++KCD G       P C  C   +  C +      N PK+
Sbjct: 99  HNKSKNGCANCKRRRVKCDEG------KPTCQKCLNMKLQCVYLPVTARNKPKI 146

>AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YML076C (WAR1)
          Length = 748

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 7/76 (9%)

Query: 5  IVKPVPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKC---DLGPADRPVSPPC 61
          I+  +P    R  TP+           +NTF AC  C   K +C   D+G   R    PC
Sbjct: 9  IIVGIPADDPRHHTPISQEIGSNGKPKRNTF-ACTSCHAVKQRCIPTDMGDIYRK---PC 64

Query: 62 AACRRSRSHCFFNAPK 77
          + C + R  C F+  K
Sbjct: 65 SRCVKLRKPCEFDLSK 80

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 32  KNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPK 77
           +NTF AC+ C   K+KC     D     PC  C ++   C F+  K
Sbjct: 117 RNTF-ACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTFDLSK 161

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
           AC +C+ KKIKCD    ++ +   C+ C+R+   C F    +K G
Sbjct: 74  ACDQCRKKKIKCDFS-EEKTL---CSNCQRNGEKCTFERVPLKRG 114

>Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}
          similar to Ashbya gossypii AER153W
          Length = 822

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 26/66 (39%), Gaps = 1/66 (1%)

Query: 9  VPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSR 68
          +P    R T PV           +NTF AC  C   K +C    A+     PC  C + +
Sbjct: 15 IPADDPRYTNPVSQEIGSNGKPKRNTF-ACSSCHAVKQRCIPTDANDIYRKPCTRCLKFK 73

Query: 69 SHCFFN 74
            C F+
Sbjct: 74 KLCVFD 79

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON}
          YKL038W (REAL)
          Length = 1169

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          AC +C+ KKIKCD    +R V   C  C+R+   C F    +K G
Sbjct: 46 ACDQCRKKKIKCDYK-DERGV---CTNCQRNGDRCSFERVPLKRG 86

>Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}
          similar to Ashbya gossypii AGL091W
          Length = 840

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 6/47 (12%)

Query: 31 HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPK 77
          HK +   C  CK +++KCD         P C  C + + HC +   K
Sbjct: 50 HKKSKNGCDNCKRRRVKCDEN------KPCCQKCFKMKLHCIYTPAK 90

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 1148

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 32 KNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFN 74
          K    AC RC+ +KIKCD      PVS  C+ C + +  C F+
Sbjct: 28 KRVSKACDRCRRRKIKCD---DLDPVSGKCSNCIKYKVPCTFH 67

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 6/43 (13%)

Query: 31  HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
           H  +   C+ CK +++KCD G       P C  C   +  C +
Sbjct: 196 HNKSKNGCVNCKRRRVKCDEG------KPTCKKCLNMKLDCVY 232

>Skud_9.204 Chr9 (367291..370320) [3030 bp, 1009 aa] {ON} YIR023W
           (REAL)
          Length = 1009

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 13/49 (26%)

Query: 33  NTFGACLRCKYKKIKC----DLGPADRPVSPPCAACRRSRSHCFF-NAP 76
           N  G+C +CK +K KC    DLG         C  C  SR+ C F N P
Sbjct: 174 NMMGSCNQCKLRKTKCNYFPDLG--------NCLECETSRTKCTFSNTP 214

>AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR228C (ECM22) and
           YDR213W (UPC2)
          Length = 866

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 6/49 (12%)

Query: 31  HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVK 79
           H  +   C  CK +++KCD G       P C  C + R  C +   K +
Sbjct: 82  HNKSKNGCDNCKRRRVKCDEG------KPGCQKCLKMRLSCVYTPAKPR 124

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 4/52 (7%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          +   T  AC +C+ KK +CD    +    P C +C+R    C F    +K G
Sbjct: 31 RRSKTSRACDQCRGKKTRCDFSDEN----PVCTSCQRMSKTCTFERVPMKRG 78

>NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.344
           YML076C
          Length = 989

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 1/73 (1%)

Query: 5   IVKPVPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAAC 64
           +++ + +   R +TP            +NTF AC+RC   K KC     +     PC  C
Sbjct: 54  LIEGIDENDPRHSTPSKMETTENGKIKRNTF-ACVRCHSLKQKCVPSDTNDIYRRPCERC 112

Query: 65  RRSRSHCFFNAPK 77
            R+   C F+  K
Sbjct: 113 LRTGKLCKFDLSK 125

>Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON}
          YBL066C (REAL)
          Length = 1159

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 3/38 (7%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFN 74
          +C  C+  KIKCD   A +    PC+ C++   HC  N
Sbjct: 52 SCTHCRQHKIKCD---ASQNFPHPCSRCQKIGLHCEIN 86

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/57 (22%), Positives = 24/57 (42%), Gaps = 6/57 (10%)

Query: 31 HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNIL 87
          H  +   C  CK +++KCD G       P C  C   +  C +    ++ G+   ++
Sbjct: 44 HNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKGRGATVV 94

>Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON}
           YDR034C (REAL)
          Length = 778

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 6/44 (13%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
           K K +   C  CK +++KCD         P C  C R   HC +
Sbjct: 139 KRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRHCIY 176

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
          (REAL)
          Length = 913

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/57 (22%), Positives = 24/57 (42%), Gaps = 6/57 (10%)

Query: 31 HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNIL 87
          H  +   C  CK +++KCD G       P C  C   +  C +    ++ G+   ++
Sbjct: 44 HNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKGRGATVV 94

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
          RGT1Glucose-responsive transcription factor that
          regulates expression of several glucose transporter
          (HXT) genes in response to glucose; binds to promoters
          and acts both as a transcriptional activator and
          repressor
          Length = 1170

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          AC +C+ KKIKCD    ++ V   C+ C+R+   C F+   +K G
Sbjct: 46 ACDQCRKKKIKCDYK-DEKGV---CSNCQRNGDRCSFDRVPLKRG 86

>SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]
          {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
          AFR171Wp and some similarites with YDR034C
          uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
          Transcriptional activator involved in regulation of
          genes of the lysine biosynthesis pathway requires
          2-aminoadipate semialdehyde as co-inducer
          Length = 645

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 6/51 (11%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKI 80
          K K +   C  CK +K+KCD         P C  C     +C +++P  +I
Sbjct: 13 KRKYSKLGCTECKRRKVKCD------ETKPMCWQCSHLGKNCVYSSPSTRI 57

>Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa]
           {ON} YIR023W (REAL)
          Length = 971

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 13/49 (26%)

Query: 33  NTFGACLRCKYKKIKC----DLGPADRPVSPPCAACRRSRSHCFF-NAP 76
           N  G+C +CK KK+KC    DLG         C  C  +R+ C F N P
Sbjct: 148 NLMGSCNQCKSKKLKCNYFPDLG--------NCLECETNRTKCTFSNTP 188

>ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1066

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
           AC +C+ +KI+CD    D+ V   C +CR++   C F   ++K G
Sbjct: 67  ACDQCRKRKIRCDYD-DDKGV---CTSCRKNGESCAFERIQLKRG 107

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 9/55 (16%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF---NAPKVKIGKLGNILD 88
          ACL C+ KK KCD         P C  CR  ++ C +    A K  I    +ILD
Sbjct: 15 ACLNCRRKKQKCD------QARPQCYQCRIRKTECVYLGEKADKNSISIPNSILD 63

>YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Positive
           regulator of genes in multiple nitrogen degradation
           pathways; contains DNA binding domain but does not
           appear to bind the dodecanucleotide sequence present in
           the promoter region of many genes involved in allantoin
           catabolism
          Length = 970

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 12/45 (26%)

Query: 33  NTFGACLRCKYKKIKC----DLGPADRPVSPPCAACRRSRSHCFF 73
           N  G+C +C+ KK KC    DLG         C  C  SR+ C F
Sbjct: 145 NLMGSCNQCRLKKTKCNYFPDLG--------NCLECETSRTKCTF 181

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 7/51 (13%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKI 80
          K K    ACL C+ + IKC       P   PC  C ++   C +  P  KI
Sbjct: 26 KQKRQQIACLECRKRHIKC-------PNGNPCFKCLKNNLKCEYIEPSRKI 69

>Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON}
          YBL066C (REAL)
          Length = 1155

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFN 74
          +C  C+  KIKCD   A +    PC+ C +   HC  N
Sbjct: 57 SCTHCRQHKIKCD---ASQNFPHPCSRCEKIGLHCEIN 91

>ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]
          {ON} similar to gnl|GLV|KLLA0D10153g Kluyveromyces
          lactis KLLA0D10153g and weakly similar to
          uniprot|P35995 Saccharomyces cerevisiae YKL222C
          Hypothetical ORF
          Length = 648

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
           C  C+ KK++C     DR V P C AC     +C +N   VKIG
Sbjct: 10 TCTNCQRKKVRC-----DRKV-PACTACSERGYNCIYN---VKIG 45

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON}
          Anc_5.235
          Length = 889

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 6/35 (17%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          AC RC+ KKIKCD         P C+ C + R  C
Sbjct: 21 ACKRCRLKKIKCDNN------VPSCSRCAKLRVPC 49

>YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}
          SEF1Putative transcription factor, has homolog in
          Kluyveromyces lactis
          Length = 1148

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFN 74
          +C  C+  KIKCD   A +    PC+ C +   HC  N
Sbjct: 56 SCTHCRQHKIKCD---ASQNFPHPCSRCEKIGLHCEIN 90

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 604 ILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRT---ANIRGESFISDYY 651
           ILN W LN+ +   P   EK  ++ L  L+K + +    N+R     SDYY
Sbjct: 189 ILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRRKVFSDYY 239

>Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON}
          YBL066C (REAL)
          Length = 1150

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFN 74
          +C  C+  KIKCD   A +    PC+ C +   HC  N
Sbjct: 60 SCTHCRQHKIKCD---ASQNFPHPCSRCEKIGLHCEIN 94

>SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]
          {ON} conserved hypothetical protein
          Length = 632

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 6/40 (15%)

Query: 32 KNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          K T   CL C+ +K KCD       V P C  C+R+   C
Sbjct: 6  KRTITGCLTCRKRKKKCD------EVKPVCTGCQRNFLQC 39

>SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1009

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 27/66 (40%), Gaps = 6/66 (9%)

Query: 12  KKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
           KK+R+T  V          +     AC  C  KKIKCD G       P C  C +  + C
Sbjct: 50  KKARTTFCVRPMVDRPRSFNIKVSPACEACNVKKIKCDRG------FPVCNTCLKRGTQC 103

Query: 72  FFNAPK 77
            +N  K
Sbjct: 104 KYNFEK 109

>KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON}
          Anc_7.389 YBL066C
          Length = 941

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 3/35 (8%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          +C  C+ +KIKC+   A++    PC+ C++ + HC
Sbjct: 58 SCSHCRQQKIKCN---ANQNYPNPCSRCQKYKLHC 89

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
           Anc_4.344 YML076C
          Length = 894

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 1/73 (1%)

Query: 5   IVKPVPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAAC 64
           I++ V     R   P            +NTF AC+RC   K KC     +     PC  C
Sbjct: 30  IIEGVEPNDVRRLYPTKMEVNEVGKLKRNTF-ACVRCHSLKQKCVPSDVNDIYLKPCQRC 88

Query: 65  RRSRSHCFFNAPK 77
            R++  C F+  K
Sbjct: 89  SRNKQVCKFDLSK 101

>Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106W
          (REAL)
          Length = 867

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 7/43 (16%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF-NAPKV 78
           C+ CK +K+KCD       + P C  CR++   C + N P +
Sbjct: 15 VCIPCKSRKLKCD------RLRPVCTRCRKTSKQCTYENEPSL 51

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 855

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 6/38 (15%)

Query: 34 TFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71
          +  AC RC+ KKIKCD         P C  C R+   C
Sbjct: 29 SISACKRCRTKKIKCDHE------FPSCKKCARANKPC 60

>Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa]
          {ON} KLLA0D00396g homolog - hypothetical protein
          [contig MAT] FULL
          Length = 519

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 31 HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCF--FNAPKVKIGKLGNI 86
          +K    +C+RC+  KIKCDL    RP    C  C++    C+  F  P  +  +L N+
Sbjct: 11 NKKALRSCVRCRKNKIKCDLQET-RP--DCCTPCKKKGHECYVDFVVPHQRSQELLNL 65

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 7/50 (14%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVK 79
           K +    AC  C+ KK+KCD          PC  C      C +N P  +
Sbjct: 58  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSTR 100

>Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C
          (REAL)
          Length = 785

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 7/37 (18%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
          AC RCK +KIKCD          PC  C  S+S C +
Sbjct: 16 ACERCKKRKIKCD-------TLKPCFNCVGSQSKCTY 45

>KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} similar
          to uniprot|P53749 Saccharomyces cerevisiae YNR063W
          Hypothetical ORF
          Length = 612

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 9/51 (17%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSR--SHCFFNAPKVKIGKLGN 85
          AC+ CK KK+KCD        + PC  C +S   S C + A + K    G+
Sbjct: 15 ACMLCKLKKLKCD-------GNYPCGRCAKSGVPSECGYEADRRKCRAYGS 58

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 3/47 (6%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSP--PCAACRRSRSHCFFNAPKVKIG 81
           AC +C+ KKIKCD       ++P   C  CR+    C F    +K G
Sbjct: 116 ACDQCRKKKIKCDFIEG-HDINPDQSCTGCRKIGEKCSFERIPLKRG 161

>Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON}
          YDR034C (LYS14) - transcription factor involved in
          lysine biosynthesis [contig 358] FULL
          Length = 598

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 5/44 (11%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
          K++ + G C+ CK  KIKCD     +P+   CA  ++ R  C +
Sbjct: 6  KNQRSRGGCINCKKSKIKCD---EKKPMCGQCA--KKGRDDCAY 44

>TPHA0J01030 Chr10 (239778..240974) [1197 bp, 398 aa] {ON} Anc_7.267
           YIL071C
          Length = 398

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 9/44 (20%)

Query: 288 YIP-------LHLQDFDELFK-YPLLLHCI-LAISARYNPFDKV 322
           YIP       L+L+D +ELFK +PLL  C+ L +  R+N F K+
Sbjct: 216 YIPINKYDVFLYLEDINELFKVFPLLRTCLQLLVKTRFNEFLKI 259

>TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.264
           YDR034C
          Length = 724

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 18/44 (40%), Gaps = 6/44 (13%)

Query: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73
           K K +   C  CK ++IKCD         P C  C R    C +
Sbjct: 115 KRKYSRNGCTECKRRRIKCD------ETKPTCWQCARLNRECIY 152

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 267 TMDEARMLVNIFFNFMHPFYPYIPLHLQDFD-ELFKYPLLLHCILAISARYNPFDKVGFD 325
           T DE    +N++ +  H F+P++  HLQ     L  YP LL  I  I A Y         
Sbjct: 519 TTDELNHYINLYRDEFHNFFPFV--HLQTLKPTLGNYPFLL-SIAMIGALY--------- 566

Query: 326 NGIEGNRNVIIHNKLWTHCQQLLSQ 350
            G     ++++ N  W   ++LL +
Sbjct: 567 -GFHSTHSMLLSNIAWFQIKELLER 590

>KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa]
          {ON} conserved hypothetical protein
          Length = 518

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCF 72
          +C+RC+  KIKCDL    RP S  C  C R    C+
Sbjct: 13 SCVRCRKNKIKCDL-QEKRPGS--CTPCSRRGIECY 45

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 583 KKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRT---A 639
           KK+VS  +++ NL     +  ILN W LN+ +   P S EK  ++    L+K + +    
Sbjct: 121 KKQVSHNNRRSNLP--KEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFI 178

Query: 640 NIRGESFISDYY 651
           N+R      DYY
Sbjct: 179 NVRRRKIFHDYY 190

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 809

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 27/73 (36%), Gaps = 1/73 (1%)

Query: 2   DNKIVKPVPKKKSRSTTPVXXXXXXXXXKHKNTFGACLRCKYKKIKCDLGPADRPVSPPC 61
           +N  +  VP    R  +PV           +NTF AC  C   K KC     +     PC
Sbjct: 29  ENAYIIGVPPDDPRLHSPVSLSKNDGGKPKRNTF-ACTNCHSLKQKCVPSDINNIYGRPC 87

Query: 62  AACRRSRSHCFFN 74
             C +    C F+
Sbjct: 88  QRCMKCNRTCKFD 100

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 6/48 (12%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLG 84
           C  CK +KIKCD         P C  C +    C ++  + K G+ G
Sbjct: 29 VCRNCKKRKIKCD------KARPSCGRCSKLELECVYDFQENKDGRRG 70

>Kwal_56.22327 s56 complement(48538..50220) [1683 bp, 560 aa] {ON}
           YPL269W (KAR9) - Component of cortical adaptor complex
           that orients microtubules [contig 186] FULL
          Length = 560

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 22/107 (20%)

Query: 414 DRMAWM-------------FTGTAIRLAQEMDILENNAKIYTAANIAEI-------CYAS 453
           DR  WM             F+    RL++ +D +E +   Y  +   E+       C+  
Sbjct: 70  DRFKWMRHCKNGFYMLCQKFSEIESRLSEMLDTIEGDMAEYMHSEQMEVFMEVFESCWYG 129

Query: 454 NMNLKPTLGESLVSIDGGMKEFEI--DNPKSQDDIENEDLLKFVQLV 498
             NLKP L  S    + G++  EI  D+  S D + +E+  K VQ++
Sbjct: 130 MSNLKPILRSSKAVFEAGLEYNEIMSDHLGSLDTLIDENTEKCVQIM 176

>Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar to
           Ashbya gossypii AGL083W
          Length = 1064

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 37  ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
           AC +C+ KKIKC+     R  S  C  C ++   C F    +K G
Sbjct: 81  ACDQCRRKKIKCEY----REDSQSCTGCNKNNEKCAFERVPLKRG 121

>Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON}
          (44110..46518) [2409 nt, 803 aa]
          Length = 802

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 12/63 (19%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRR--SRSHCFF--NAPKVKIGKLGN 85
          +H+ T   C  CK +K KCD G        PC+ C R    + C +  + P + I  +G+
Sbjct: 12 RHRITV-VCTNCKKRKSKCDRG-------KPCSNCTRIGIENSCLYIKDTPSLPIDSIGS 63

Query: 86 ILD 88
          + D
Sbjct: 64 VAD 66

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 651 YYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILK 695
           +YC L+  S+ + +EVKE   T +E +    FV  A  A KE+ +
Sbjct: 437 HYCLLHFLSVTMALEVKELLETGDEAVSRVSFVTPANSADKEMRR 481

>KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa]
          {ON} weakly similar to uniprot|P39529 Saccharomyces
          cerevisiae YJL206C Hypothetical ORF
          Length = 674

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 8/56 (14%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSH--CFFNAPKVKIGKL 83
          + K +  AC RC  +K+KC LG       PPC AC  S++   C F     KI  L
Sbjct: 9  ERKRSKKACQRCSAQKVKC-LGE-----KPPCRACVLSKNQDNCIFPVKPRKITVL 58

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 32.0 bits (71), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIG 81
          AC +C+ KKIKCD     +     C+ C+R+   C F    +K G
Sbjct: 46 ACDQCRKKKIKCDY----KDEKGLCSNCQRNGDRCSFERVPLKRG 86

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
          YER184C (REAL)
          Length = 170

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 8/41 (19%)

Query: 37 ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF-NAP 76
          AC RC+ KK+KCD          PC  C  S+S C + N P
Sbjct: 17 ACERCRRKKVKCD-------SKKPCFGCIGSQSKCRYKNQP 50

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 32.0 bits (71), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 20/48 (41%)

Query: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPK 77
          K K    AC+ C   K KC     +     PC  C +S+  C F+  K
Sbjct: 34 KRKRNTVACITCHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTFDLSK 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,997,996
Number of extensions: 4558061
Number of successful extensions: 22078
Number of sequences better than 10.0: 261
Number of HSP's gapped: 22876
Number of HSP's successfully gapped: 291
Length of query: 928
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 809
Effective length of database: 39,836,145
Effective search space: 32227441305
Effective search space used: 32227441305
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)