Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0F03003g5.524ON1185118542250.0
TDEL0A038805.524ON16963503636e-34
Suva_2.5975.524ON17972293629e-34
KAFR0E033205.524ON11903343492e-32
KNAG0C032605.524ON15303503431e-31
SAKL0G04862g5.524ON24442443432e-31
Smik_4.6955.524ON15553353412e-31
ZYRO0D12496g5.524ON23852023305e-30
YDR420W (HKR1)5.524ON18023313225e-29
Skud_4.6945.524ON15042253153e-28
KLTH0G03696g5.524ON20852163153e-28
Kwal_47.186505.524ON21592202983e-26
KLLA0A01826g5.524ON14641902973e-26
ZYRO0G11242g4.150ON14872022965e-26
Ecym_73494.150ON11291982955e-26
NCAS0A052304.150ON7852952901e-25
Ecym_40605.524ON22012332903e-25
AGR019C4.150ON11053012821e-24
KNAG0D035904.150ON9941802812e-24
SAKL0H23188g4.150ON12621852769e-24
TPHA0K013904.150ON8261782759e-24
Kpol_1062.374.150ON9733072751e-23
KAFR0F034704.150ON9493492713e-23
Skud_7.2994.150ON11691782689e-23
YGR014W (MSB2)4.150ON13061842615e-22
TDEL0D030104.150ON11231772581e-21
NDAI0K025804.150ON9851862581e-21
Kwal_47.177034.150ON15682932553e-21
KLLA0C17985g4.150ON9081792525e-21
ADR200C5.524ON23383032536e-21
Smik_7.3024.150ON11891842527e-21
TBLA0G012104.150ON18253532501e-20
KLTH0E08844g4.150ON15201872482e-20
Kpol_363.145.524ON7612212444e-20
Suva_7.2964.150ON11351782382e-19
CAGL0F08833g4.150ON9363201872e-13
TPHA0L003605.524ON1161931812e-12
TBLA0G009505.524ON2253971605e-10
Suva_9.482.208ON81978910.052
KNAG0B057504.185ON84779810.86
Smik_9.292.208ON82144800.97
YGL186C (TPN1)8.147ON57944754.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0F03003g
         (1185 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...  1632   0.0  
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   144   6e-34
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   144   9e-34
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...   139   2e-32
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   136   1e-31
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   136   2e-31
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...   135   2e-31
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   131   5e-30
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   128   5e-29
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   125   3e-28
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   125   3e-28
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...   119   3e-26
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   119   3e-26
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...   118   5e-26
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...   118   5e-26
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...   116   1e-25
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   116   3e-25
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...   113   1e-24
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...   112   2e-24
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...   110   9e-24
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...   110   9e-24
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...   110   1e-23
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...   108   3e-23
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...   107   9e-23
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...   105   5e-22
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...   103   1e-21
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...   103   1e-21
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...   102   3e-21
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...   101   5e-21
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...   102   6e-21
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...   101   7e-21
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....   100   1e-20
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...   100   2e-20
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...    99   4e-20
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    96   2e-19
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    77   2e-13
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...    74   2e-12
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    66   5e-10
Suva_9.48 Chr9 (80060..82519) [2460 bp, 819 aa] {ON} YIL140W (REAL)    40   0.052
KNAG0B05750 Chr2 (1133580..1136123) [2544 bp, 847 aa] {ON} Anc_4...    36   0.86 
Smik_9.29 Chr9 (63082..65547) [2466 bp, 821 aa] {ON} YIL140W (REAL)    35   0.97 
YGL186C Chr7 complement(151037..152776) [1740 bp, 579 aa] {ON}  ...    33   4.2  

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score = 1632 bits (4225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 894/1185 (75%), Positives = 894/1185 (75%)

Query: 1    MRKXXXXXXXXXXXXXXXXXXXNDTPVPNPISEDISSVLSASIQPEIPSAQPSVQSEIQS 60
            MRK                   NDTPVPNPISEDISSVLSASIQPEIPSAQPSVQSEIQS
Sbjct: 1    MRKLLLLVRSLLLVAVTATTSANDTPVPNPISEDISSVLSASIQPEIPSAQPSVQSEIQS 60

Query: 61   IPSVQSEIQSVPSVQSEIQSVQPSEVQPSPVANSIESXXXXXXXXXXYPDAGSSIQPNSV 120
            IPSVQSEIQSVPSVQSEIQSVQPSEVQPSPVANSIES          YPDAGSSIQPNSV
Sbjct: 61   IPSVQSEIQSVPSVQSEIQSVQPSEVQPSPVANSIESNTNTNTNTNTYPDAGSSIQPNSV 120

Query: 121  SNSIVSQPSDDINTDDLNFLDDGSSQQGPSSILSINPSVQPSSIDYHXXXXXXXXXXXXV 180
            SNSIVSQPSDDINTDDLNFLDDGSSQQGPSSILSINPSVQPSSIDYH            V
Sbjct: 121  SNSIVSQPSDDINTDDLNFLDDGSSQQGPSSILSINPSVQPSSIDYHSSSKINVESSSSV 180

Query: 181  IPVFAPSEARAPAKPPAFEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            IPVFAPSEARAPAKPPAFEI                                        
Sbjct: 181  IPVFAPSEARAPAKPPAFEISSSASSVQVSSQQQQPSIQPSSVEPVQSNSPSPSSVVPSP 240

Query: 241  XXXXXXXXXXXQVSPSSAAPLXXXXXXXXXXXXXXXXXXXXXGXXXXXXXXXXXXXXXXX 300
                       QVSPSSAAPL                     G                 
Sbjct: 241  SSVIPLVPPEVQVSPSSAAPLIPPEVQVSPSSVLPSSSISQLGPSILVSPPVSSPPTSSI 300

Query: 301  XXXXXXXXEINFSEFSGSFNVXXXXXXXXXXXXXXXXXXXXXXLDYSQAIHSRVADXXXX 360
                    EINFSEFSGSFNV                      LDYSQAIHSRVAD    
Sbjct: 301  PSQQISSQEINFSEFSGSFNVPSWLLSSNAPSSSFSEQLSPSSLDYSQAIHSRVADSSTT 360

Query: 361  XXXXXXXXXXXXXXXXXXXXXXXXNFLKPSADREFSVHFPVLXXXXXXXXXXXXXXXVAS 420
                                    NFLKPSADREFSVHFPVL               VAS
Sbjct: 361  TLPLIVPPTTTTTPTLVSESSTLSNFLKPSADREFSVHFPVLSPSSIENEPPSSIQSVAS 420

Query: 421  STIXXXXXXXXXXXXXXXXXXXXEPTGSSVASEYISSNSLSQIPVEAVDAKQAPXXXXXX 480
            STI                    EPTGSSVASEYISSNSLSQIPVEAVDAKQAP      
Sbjct: 421  STILSQAAPLSPAQAASIPSSILEPTGSSVASEYISSNSLSQIPVEAVDAKQAPSSSSLS 480

Query: 481  XXXXNTDNIEAISSNLEQATPSRPVDNNATPTANSGTVLDSASQINSQSISRDDASYAEI 540
                NTDNIEAISSNLEQATPSRPVDNNATPTANSGTVLDSASQINSQSISRDDASYAEI
Sbjct: 481  SILSNTDNIEAISSNLEQATPSRPVDNNATPTANSGTVLDSASQINSQSISRDDASYAEI 540

Query: 541  XXXXXXXXXXXXXXXXXXPSADSSNTIPQPEDNTPTTSTVSEFTASNVDVSSVHIASKDA 600
                              PSADSSNTIPQPEDNTPTTSTVSEFTASNVDVSSVHIASKDA
Sbjct: 541  AQSSVNVQNSASNFANSVPSADSSNTIPQPEDNTPTTSTVSEFTASNVDVSSVHIASKDA 600

Query: 601  DSSPNSVSNHDALNSVAPXXXXXXXXXXXXPTQVLTEPSSAVPPNVGFDISSDINIPSEN 660
            DSSPNSVSNHDALNSVAP            PTQVLTEPSSAVPPNVGFDISSDINIPSEN
Sbjct: 601  DSSPNSVSNHDALNSVAPSVDVDIVSSNSIPTQVLTEPSSAVPPNVGFDISSDINIPSEN 660

Query: 661  IESDSNLVVTSTSRPSQGTFQNNPTNSRTITNQIXXXXXXXXXXXXGPKTLSSDENWLPS 720
            IESDSNLVVTSTSRPSQGTFQNNPTNSRTITNQI            GPKTLSSDENWLPS
Sbjct: 661  IESDSNLVVTSTSRPSQGTFQNNPTNSRTITNQIPSSASPPPATPTGPKTLSSDENWLPS 720

Query: 721  GIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFLIDNP 780
            GIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFLIDNP
Sbjct: 721  GIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFLIDNP 780

Query: 781  LSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGIVPLLI 840
            LSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGIVPLLI
Sbjct: 781  LSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGIVPLLI 840

Query: 841  PGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPXXXXXXX 900
            PGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP       
Sbjct: 841  PGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPLTGLISG 900

Query: 901  XXXXXXXXXDADYNSDQSGNTRQSRKGKGLPSNLSIVGSLDNYDKNPEKEEHKNRVISIV 960
                     DADYNSDQSGNTRQSRKGKGLPSNLSIVGSLDNYDKNPEKEEHKNRVISIV
Sbjct: 901  SSIESTSNSDADYNSDQSGNTRQSRKGKGLPSNLSIVGSLDNYDKNPEKEEHKNRVISIV 960

Query: 961  LPTVLPLGLLFIWCLFFILMSRTQRRRKGNATIEKSNIKVDNTSGYHDNGRSNYKDNVYD 1020
            LPTVLPLGLLFIWCLFFILMSRTQRRRKGNATIEKSNIKVDNTSGYHDNGRSNYKDNVYD
Sbjct: 961  LPTVLPLGLLFIWCLFFILMSRTQRRRKGNATIEKSNIKVDNTSGYHDNGRSNYKDNVYD 1020

Query: 1021 GILDEKHYSSSEGVSNGSTMAGLAYAFNNFVGGPNMYSSYDTGALADSTLYSSSNQLQIP 1080
            GILDEKHYSSSEGVSNGSTMAGLAYAFNNFVGGPNMYSSYDTGALADSTLYSSSNQLQIP
Sbjct: 1021 GILDEKHYSSSEGVSNGSTMAGLAYAFNNFVGGPNMYSSYDTGALADSTLYSSSNQLQIP 1080

Query: 1081 RENSSPWPAQYITAPSRKSQHSTEEVSPITLVPRIDSDVYNLQKQEMMAESVSGTFSLGS 1140
            RENSSPWPAQYITAPSRKSQHSTEEVSPITLVPRIDSDVYNLQKQEMMAESVSGTFSLGS
Sbjct: 1081 RENSSPWPAQYITAPSRKSQHSTEEVSPITLVPRIDSDVYNLQKQEMMAESVSGTFSLGS 1140

Query: 1141 DIFIDDDEDENVKDLQIEDVDEFDEELYKRLSKFTDYRDVNNISL 1185
            DIFIDDDEDENVKDLQIEDVDEFDEELYKRLSKFTDYRDVNNISL
Sbjct: 1141 DIFIDDDEDENVKDLQIEDVDEFDEELYKRLSKFTDYRDVNNISL 1185

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  144 bits (363), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 108/350 (30%), Positives = 158/350 (45%), Gaps = 53/350 (15%)

Query: 662  ESDSNLVVTSTSRPSQGTFQNNPTNSRTITNQIXXXXXXXXXXXXGPKTLSSDENWLPSG 721
            ESD +L +T T+RP+Q T       S   T Q             G +T      WLPS 
Sbjct: 1024 ESDGSLRMTLTTRPAQST------GSLLTTGQTTAANTGARSSSVGGRTT----FWLPSS 1073

Query: 722  IIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFLIDNPL 781
            I  QSD   + +SSF+P  T +LPQ IAPP       N + +T+G K+ LNY+FL+ +  
Sbjct: 1074 IQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFLVSSST 1133

Query: 782  SSAQIFNFLPSVLTYPFSSYAPNDFP--------INSLIDDNALAFL------------- 820
            ++AQIF+FLP VL++PF      DF         ++S   +N    +             
Sbjct: 1134 TAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQETVTGIS 1193

Query: 821  ---DSNL-FNASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSN 876
               DS   FNAS + V  I+P++I    +  S+  +YFP+  +  L +++ D  S L++N
Sbjct: 1194 KRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNN 1253

Query: 877  PNDSLSALARLIDPSIPXXXXXXXXXXXXXXXXDADYNSDQSGNTRQSRKGKGLP----S 932
            P+ +L ALA LIDPSIP                D    S   GN          P    S
Sbjct: 1254 PDPTLDALAALIDPSIP-----------LTGLIDGSTGSLNGGNPSTQSHSPSSPYKSQS 1302

Query: 933  NLSIVGSLDNYDKNPEKEEHKNRVISIVLPTVLPLGLLFIWCLFFILMSR 982
            +    GSL     +      K R+  ++  T L  G L +W L F+ + +
Sbjct: 1303 SDDNSGSLGTATNSGLSSAVKKRL--VIYLTCLVFGTL-LWILVFMFLYK 1349

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  144 bits (362), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 93/229 (40%), Positives = 119/229 (51%), Gaps = 46/229 (20%)

Query: 708  PKTLSSDENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGL 767
            P T S+D  WLP+ II +   + T ++SFNP+ T SLP  IAP     +  N TL+TIG 
Sbjct: 1196 PYTTSNDYAWLPTAIIVEPTKSDTSTTSFNPSITASLPNVIAPAIAVTEPANHTLITIGF 1255

Query: 768  KQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFS---------------------SY----- 801
              GLNY FL+ NPLSSAQIFNFLP VL YPFS                     SY     
Sbjct: 1256 TAGLNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTTSQQEESSTYEMGSSSFVLSYQSGSS 1315

Query: 802  -------APNDFPI----------NSLIDDNALAFLDSNLFNASTISVHGIVPLLIPGHE 844
                   + +  PI          NS++   + A LD      S+I V  IVP++     
Sbjct: 1316 TTTLSPESVSSIPIVRKKKKKGGKNSVM---STANLDLPSIGNSSIVVKQIVPMIDSSRS 1372

Query: 845  FFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
            + ++V EVYFP + + SL  LI D NS+LY+NP  SL  LA LID S+P
Sbjct: 1373 YVIAVAEVYFPTEAISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVP 1421

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 24/30 (80%)

Query: 1145 DDDEDENVKDLQIEDVDEFDEELYKRLSKF 1174
            D D++ +V D+Q+E++D  DEELYKR+SK 
Sbjct: 1762 DIDDNGSVSDIQVEELDALDEELYKRMSKI 1791

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
           Anc_5.524 YDR420W
          Length = 1190

 Score =  139 bits (349), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 111/334 (33%), Positives = 147/334 (44%), Gaps = 69/334 (20%)

Query: 716 NWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQF 775
           +WLP+ +IF SD + +  SS NP  T +LP  IA P   V+ PNTTLVTIG K+ LNY F
Sbjct: 591 DWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIF 650

Query: 776 LIDNPLSSAQIFNFLPSVLTYPF--SSYAPNDFPINSLI------DDNALAFLDSN---- 823
           LIDNPL+SAQIF FLP  L+YPF  + Y  +   I SL       +D+    L ++    
Sbjct: 651 LIDNPLASAQIFEFLPLTLSYPFLLTQYNASSEEITSLCSSSLYYEDDGRTILTTHESTT 710

Query: 824 -------------------------------------------LFNASTISVHGIVPLLI 840
                                                       FN+S + V  I+P++ 
Sbjct: 711 VDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPRESSPPPFFNSSNVVVKHILPMIS 770

Query: 841 PGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPXX-XXXX 899
              ++ VSV EVYFP D L  L   I   NS LYSNP+   S L  LIDP I        
Sbjct: 771 NQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLFQQ 830

Query: 900 XXXXXXXXXXDADYNS-DQSGNTRQSRKGKGLPSNLSIV-----GSLDNYDKNPEKEEHK 953
                     D   +S D S NT+ +      PSNL+       GSLD       K   K
Sbjct: 831 NGMNNQGNNQDGSLSSNDSSFNTKTN------PSNLTSTETERSGSLDLNSGYTSKFSSK 884

Query: 954 NRVISIVLPTVLPLGLLFIWCLFFILMSRTQRRR 987
            +    +  TV  L ++F W   F++  +   +R
Sbjct: 885 IKDRLAIFTTVF-LFVVFFWIWLFLVAFKHWNKR 917

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  136 bits (343), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 164/350 (46%), Gaps = 59/350 (16%)

Query: 712  SSDENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGL 771
            S+D  WLP+ II  S+  +T ++    TA  SLP  IAP +     P+  L+TIG   GL
Sbjct: 883  STDTVWLPTNIIIASNADSTHTARAESTA--SLPAAIAPAEELQSPPDFELITIGFLSGL 940

Query: 772  NYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPN--------------------------- 804
            NY FL+ NPLSSAQ+F+FLP VL +P    A                             
Sbjct: 941  NYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRKNRKTVT 1000

Query: 805  DFPINSLIDDNALAFLDSNLFNAS-------------TISVHGIVPLLIPGHEFFVSVVE 851
            D    ++++ N       NL  +S              I V  I+PL+I G+++  SV E
Sbjct: 1001 DMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAE 1060

Query: 852  VYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPXXXXXXX-XXXXXXXXXD 910
            VYFP   +DSLSALI D NS+LYSNP  + + LA LID +IP                  
Sbjct: 1061 VYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRKNDGQSNTSTDSS 1120

Query: 911  ADYNSDQSGNTRQSRKGKGLPSNLSIVGSLDNYDKNPEKEEH--KNRVISIVLPTVLPLG 968
            +D NS++S      +  +     L + G++D  +    K  H  +NR+I  +    L  G
Sbjct: 1121 SDVNSNESTGDDAFQNAEEY---LRVSGAMDLSNIKVSKVNHTIRNRIIVFLF--TLTTG 1175

Query: 969  LLFIWCLFFILMSR-TQRRRKGNATIEKSNIKVDNTSGYHDNGRSNYKDN 1017
             +F+W   F+++ R T + RK    ++ SN+K  +   Y  N    Y++N
Sbjct: 1176 -VFLWISTFLIIFRITNKSRK----LKDSNLKKGSLPLYQQNP---YREN 1217

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 1156 QIEDVDEFDEELYKRLSKFTDYRDV 1180
            ++ D+DE D ELYKRLSK   +++ 
Sbjct: 1479 RVGDIDELDVELYKRLSKIEKFKNA 1503

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/244 (36%), Positives = 121/244 (49%), Gaps = 63/244 (25%)

Query: 713  SDENWLPSGIIFQS-DFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGL 771
            S  NWLP  +I +S D +T  S++ +  AT +LPQ I PP    +    +L+TIG K+ L
Sbjct: 1470 STHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEAL 1529

Query: 772  NYQFLIDNPLSSAQIFNFLPSVLTYPFSS-------YAPNDFPINSL-----------ID 813
            NY FLI +PLSSAQIF+FLP VL YPFSS       Y   D  + +L           ID
Sbjct: 1530 NYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEID 1589

Query: 814  DNALAFL--------------------------------------------DSNLFNAST 829
              +L+F                                             DS+  + S 
Sbjct: 1590 TCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQ 1649

Query: 830  ISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLID 889
            I V  I+PL+     + VSV EVYFP+  +D+L  L++++NS LY NP +SL ALA LID
Sbjct: 1650 IVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLID 1709

Query: 890  PSIP 893
            PS+P
Sbjct: 1710 PSVP 1713

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 1159 DVDEFDEELYKRLSKFTDYRDVNNIS 1184
            ++DE DEE+Y+RLS F +   + N S
Sbjct: 2128 ELDELDEEMYRRLSNFNELHGLQNRS 2153

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score =  135 bits (341), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 109/335 (32%), Positives = 147/335 (43%), Gaps = 73/335 (21%)

Query: 717  WLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFL 776
            WLP+ II QS    T ++ FNPT T SLP  I P     +  N TL+T+G    LNY FL
Sbjct: 968  WLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFL 1027

Query: 777  IDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDS-------------- 822
            + NPLSSAQIFNFLP VL YPFS  +      N  +    L++                 
Sbjct: 1028 VQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSL 1087

Query: 823  -------------------NLF----NASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLL 859
                               +L+    NAS+I+V  IVP++     + ++V EVYFP + +
Sbjct: 1088 SIVRKKKKGDKEKPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAV 1147

Query: 860  DSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPXXXXXXXXXXXXXXXXDADYNSDQSG 919
              L  LI D NS+LY+NP   L  LA LID SIP                   Y+S   G
Sbjct: 1148 SYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTL-------------YSSGNEG 1194

Query: 920  NT----------RQSRKGKGLPSNLSIVGSLDNY-----DKNPEKEEHKNRVISIVLPTV 964
            +                 KG+ +     G+LD++     D  P    +  R  +IV   +
Sbjct: 1195 HVSSLFPSGVLDSSKENSKGIVATYK-YGALDDFTNSFTDSAP-GWSYAAR--TIVFLAI 1250

Query: 965  LPLGLLFIWCL--FFILMSR-TQRRRKGNATIEKS 996
            L +G L +W L  FF+   R    +R     IEKS
Sbjct: 1251 LTIGAL-LWLLFAFFVFHYRNILLKRYPKDCIEKS 1284

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 22/29 (75%)

Query: 1152 VKDLQIEDVDEFDEELYKRLSKFTDYRDV 1180
            V D+QIE++D  DEELYKR+SK    +++
Sbjct: 1527 VSDIQIEELDALDEELYKRISKIAKQQNL 1555

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  131 bits (330), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 111/202 (54%), Gaps = 25/202 (12%)

Query: 713  SDENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLN 772
            S+ NWLP  II QS  + + + SFNP  T +LP  IAP     + PN++ +TIG K+ ++
Sbjct: 1644 SNTNWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQID 1703

Query: 773  YQFLIDNPLSSAQIFNFLPSVLTYPF---------------SSYAPNDFPINSLIDDNAL 817
            Y FL++NPLSSAQIF FLP VL YPF               S Y      +    D    
Sbjct: 1704 YDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRD---- 1759

Query: 818  AFLDSN------LFNASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNS 871
              + +N      + + + +SV  I+P+L     + V+V E+YFP   ++ L   +K+ NS
Sbjct: 1760 VMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNS 1819

Query: 872  SLYSNPNDSLSALARLIDPSIP 893
             LY+N N +L ALA LIDPSIP
Sbjct: 1820 MLYNNTNPTLFALADLIDPSIP 1841

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  128 bits (322), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 142/331 (42%), Gaps = 70/331 (21%)

Query: 717  WLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFL 776
            WLP+ II +S      ++SFNP+ T SLP  I P     +  N TL+TIG    LNY FL
Sbjct: 1210 WLPTAIIVESSETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALNYVFL 1269

Query: 777  IDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLF----------- 825
            + NPLSSAQIFNFLP VL YP        F   S   DN++  L + +            
Sbjct: 1270 VQNPLSSAQIFNFLPLVLKYP--------FSNTSSELDNSIGELSTFILSYRSGSSTTTL 1321

Query: 826  ----------------------------------NASTISVHGIVPLLIPGHEFFVSVVE 851
                                              + S+I+V  IVP++     + VSV E
Sbjct: 1322 SPKSISSLSVVKKKKNQQKKNATKSTEDLHPPQVDTSSIAVKKIVPMVDSSKAYIVSVAE 1381

Query: 852  VYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPXXXXXXXXXXXXXXXXDA 911
            VYFP + +  L  LI D NS+LYSNP   L +LA LID  IP                D 
Sbjct: 1382 VYFPTEAVTYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIP------LGGLTLYGSGDG 1435

Query: 912  DYN-SDQSGNTRQSRKGKGLPSNLSI-VGSLDNY--DKNPEKEEHKNRVISIVLPTVLPL 967
             Y  S  S +   S KG     + +   G+LD++           K  V  I+   VL +
Sbjct: 1436 GYVPSLTSSSVLDSSKGNSQNIDGTYKYGALDDFINSFTDSASAGKYAVKIIIFLIVLTI 1495

Query: 968  G-LLFIWCLFF------ILMSRTQRRRKGNA 991
            G LL+++  FF      IL+ R  R   G +
Sbjct: 1496 GVLLWLFVAFFAFRHRNILLKRHPRNCIGKS 1526

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 1/39 (2%)

Query: 1136 FSLGSDIFIDD-DEDENVKDLQIEDVDEFDEELYKRLSK 1173
            FS   D+ I+D D++ +V D+ IE++D  DEELYKR+SK
Sbjct: 1752 FSNLEDLEIEDIDDNGSVSDVHIEELDALDEELYKRMSK 1790

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  125 bits (315), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 112/225 (49%), Gaps = 41/225 (18%)

Query: 708  PKTLSSDENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGL 767
            P T S+D  WLP+ II +     + ++ FNP+ T SLP  I P     +  N TL+T+G 
Sbjct: 909  PYTYSNDYAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGF 968

Query: 768  KQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFS------------------SY-------- 801
              GLNY+FL+ NPLSSAQIFNFLP VL YPFS                  SY        
Sbjct: 969  TAGLNYEFLVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGTSTTT 1028

Query: 802  -APNDFPINSLI-------DDNALA-----FLDSNLFNASTISVHGIVPLLIPGHEFFVS 848
             +P      S++         NA A     +L S     S+I V  IVP++     + ++
Sbjct: 1029 LSPKSVSSLSIVKKKKKGEKRNATASTADLYLPS--IETSSIVVKQIVPMVNSSKAYVIA 1086

Query: 849  VVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
            V EVYFP + +  L  LI D +S +Y+NP   L  LA LID  IP
Sbjct: 1087 VAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIP 1131

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 30/39 (76%), Gaps = 1/39 (2%)

Query: 1136 FSLGSDIFIDD-DEDENVKDLQIEDVDEFDEELYKRLSK 1173
            FS   ++ IDD D++ +V D+Q+E++D  DEELYKR+SK
Sbjct: 1459 FSAAEELKIDDIDDNGSVSDVQVEELDALDEELYKRMSK 1497

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  125 bits (315), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 112/216 (51%), Gaps = 38/216 (17%)

Query: 716  NWLPSGIIFQSDFATT-VSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQ 774
            +WLPS I+  S   +    SSF+  AT +LPQ I PP      PN + +TIG K+ LNY 
Sbjct: 1227 DWLPSNIVTASYTGSAHTQSSFDADATATLPQAIMPPTPVTMPPNYSQITIGFKESLNYP 1286

Query: 775  FLIDNPLSSAQIFNFLPSVLTYPFSSYA----------PNDFPINS--LIDDNALAFLDS 822
            FLI+NPL+SAQIF FLP +L YPFS  A            D   +S  L+ DN+   LD 
Sbjct: 1287 FLIENPLASAQIFGFLPEILRYPFSVRASRSNSSTSSVKRDLVGDSGNLLLDNSTLILDK 1346

Query: 823  -----------------------NLFNA--STISVHGIVPLLIPGHEFFVSVVEVYFPND 857
                                   N F A  S ++V  IVPL++ G+++  SV  VYFP +
Sbjct: 1347 LNWKTSIMNSLSSNVSVSRNGSHNAFRANFSGVAVSSIVPLIVSGNDYITSVAVVYFPTE 1406

Query: 858  LLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
             ++ L  +I +  S +Y NP+ SL  +A LID  IP
Sbjct: 1407 AVEVLQKMIINGASRIYKNPDQSLRDMALLIDSKIP 1442

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score =  119 bits (298), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 112/220 (50%), Gaps = 42/220 (19%)

Query: 716  NWLPSGIIFQSDFATT-VSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQ 774
            +WLP+ ++  S   +    SSF+  AT +LPQFI P        N + +TIG ++ LNY 
Sbjct: 1303 DWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYP 1362

Query: 775  FLIDNPLSSAQIFNFLPSVLTYPF----------SSYAP----NDFPINSLIDDNALA-- 818
            FLI NPL+SAQIF FLP VL YPF          S   P     +FP +  +++  L+  
Sbjct: 1363 FLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGHLENTNLSED 1422

Query: 819  ------FLDSNLF-------------------NASTISVHGIVPLLIPGHEFFVSVVEVY 853
                   L +++F                   N S + V  I+PL+I G+++  SV  VY
Sbjct: 1423 ERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFSEVVVSSIIPLIISGNDYIASVAIVY 1482

Query: 854  FPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
            FP   ++ L  +I +  S LYSNP+ +  +LA LIDP IP
Sbjct: 1483 FPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIP 1522

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 1152 VKDLQIEDVDEFDEELYKRLS 1172
            V D+ I + DE DEE+Y+RLS
Sbjct: 1916 VNDIHIGEFDELDEEMYRRLS 1936

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa]
           {ON} some similarities with uniprot|P41809 Saccharomyces
           cerevisiae YDR420W HKR1 Serine/threonine rich cell
           surface protein that contains an EF hand motif involved
           in the regulation of cell wall beta-1 3 glucan synthesis
           and bud site selection overexpression confers resistance
           to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  119 bits (297), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 108/190 (56%), Gaps = 7/190 (3%)

Query: 711 LSSDENWLPSGIIFQ--SDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLK 768
           L+S+ NWLP+ ++ +  +  AT+ ++S +  AT +LPQ I P          T++T+G K
Sbjct: 716 LTSNNNWLPTTLVIEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVGFK 775

Query: 769 QGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPI-----NSLIDDNALAFLDSN 823
           + LNY FLI NPL+SAQIFNFLP VL  PF        P+     N          L S+
Sbjct: 776 EPLNYPFLIANPLASAQIFNFLPKVLVRPFQLTTTGAAPVYRRSWNIFKKGINTHLLSSS 835

Query: 824 LFNASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSA 883
           L     + V  IVPL+I    + VS+ EVYFP + + +L  L+ D +S LYSNP   L+ 
Sbjct: 836 LPTYDDVQVKSIVPLVIQNVSYIVSIAEVYFPTESVHTLQELVLDSSSILYSNPVSYLAD 895

Query: 884 LARLIDPSIP 893
           LA LI+P+IP
Sbjct: 896 LASLINPAIP 905

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 17/22 (77%)

Query: 1152 VKDLQIEDVDEFDEELYKRLSK 1173
            V D+ + D DEFDEE+Y+ LS+
Sbjct: 1291 VSDVNVGDYDEFDEEMYRHLSR 1312

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score =  118 bits (296), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 104/202 (51%), Gaps = 26/202 (12%)

Query: 714  DENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNY 773
            D  W+P+ II Q    TT SS+ +  AT +LPQ IA     V+    +L+TIG K  LNY
Sbjct: 1156 DNWWVPTKIITQPAPNTTASST-SSQATATLPQAIAAATQQVRPKGYSLLTIGFKSALNY 1214

Query: 774  QFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVH 833
             FLI +PLSSAQIF FLPS+L  PF                        N FN   +S++
Sbjct: 1215 NFLISSPLSSAQIFAFLPSILNDPF-----------------------QNQFN--NVSIY 1249

Query: 834  GIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
             IVPL     ++  +V EVYFP   +  L++LI +  SSLY++ + S   LA LIDP+IP
Sbjct: 1250 QIVPLKSESLDYLATVAEVYFPTKHISDLNSLITNNASSLYTDAHGSAKYLAELIDPTIP 1309

Query: 894  XXXXXXXXXXXXXXXXDADYNS 915
                            D++Y+S
Sbjct: 1310 LTGLVPTGDKSQGFGSDSNYDS 1331

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
           similar to Ashbya gossypii AGR019C
          Length = 1129

 Score =  118 bits (295), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 106/198 (53%), Gaps = 38/198 (19%)

Query: 707 GPKTLSSDENWLPSGIIFQSDF-----------ATTVSSSFNPTATKSLPQFIAPPKMTV 755
           GP T +S   WLP+ I+ +SD             T  ++S   TA ++LP+FI+     +
Sbjct: 768 GPHTPTS--TWLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLPKFISSANGKI 825

Query: 756 KSPNTTLVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDN 815
              N TL+T+G K+ LNY F++ NP+SSAQIF+FLP+VL YP+                 
Sbjct: 826 PEGNYTLITVGFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPYG---------------- 869

Query: 816 ALAFLDSNLFNASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYS 875
                    F  + +SV  ++PL     ++ V+V  V+FP + LD L+ L+ D  SSLYS
Sbjct: 870 ---------FRCANVSVWRLLPLKSGSRDYLVTVAAVFFPTEHLDELARLVADNTSSLYS 920

Query: 876 NPNDSLSALARLIDPSIP 893
           + +++   +A LIDP IP
Sbjct: 921 SYDETGKTMASLIDPMIP 938

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON}
           Anc_4.150
          Length = 785

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 96/295 (32%), Positives = 142/295 (48%), Gaps = 46/295 (15%)

Query: 714 DENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNY 773
           D  W+P+ +I  S    T S+  +  ATK+LPQ I            T++TIG K+ LNY
Sbjct: 449 DNWWIPTQLITAST-QVTGSAMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNY 507

Query: 774 QFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVH 833
           +F++ +P SSAQIF+FLP VL  PF             I DN              I+V 
Sbjct: 508 EFIVSSPKSSAQIFSFLPYVLNTPFDD-----------IYDN--------------ITVS 542

Query: 834 GIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
            +VPL      +F++V EV FP   + +LS  IKD NSSLY+  +D+L +LA LIDPSIP
Sbjct: 543 RLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTNSSLYTKNDDALRSLALLIDPSIP 602

Query: 894 XXXXXXXXXXXXXXXXDADY---------NSD-QSGNTRQSRKGKGLPSNLSIVGSLDNY 943
                            +           NSD +SG+T +        S+   +G+L+  
Sbjct: 603 LTGLVTSANSADTSSSSSSTDSSSSSSKGNSDHKSGSTSEDDD-----SSSEDMGTLEYS 657

Query: 944 DK---NPEKE-EHKNRVISIVLPTVLPLGLLFIWCLFFILMSRTQRRRKGNATIE 994
            K   NP    ++K  ++ +V+ TV   G+L+I  + FI+    +R R+    I+
Sbjct: 658 GKSSSNPTGSIKNKKTLVPLVVCTV-GGGILYICLMTFIVRFFVRRHRERQVAIK 711

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  116 bits (290), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 114/233 (48%), Gaps = 54/233 (23%)

Query: 708  PKTLSSDE--NWLPSGIIFQS-----DFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNT 760
            P + S DE   WLP+ I+  S       +TTV S+    AT +LP+ I P     K  N 
Sbjct: 1316 PSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSA----ATYTLPRAITPATPVAKPDNY 1371

Query: 761  TLVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPI----------NS 810
             L+TIG  QGLNY FL+ NP++SAQIF+FLP +L YP   Y  N   +          N 
Sbjct: 1372 DLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYP---YIENKEALLLRHINESNNNI 1428

Query: 811  LIDDNALAFLDSNLFN------------------------------ASTISVHGIVPLLI 840
            L +  +++    N++                                S I V  IVP L+
Sbjct: 1429 LGNRGSVSGSYFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLL 1488

Query: 841  PGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
             G ++  SV EVYFP++ + SL  ++ D+NS LY NP  +L+ LA L+DP IP
Sbjct: 1489 QGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIP 1541

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR014W
            (MSB2)
          Length = 1105

 Score =  113 bits (282), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 88/301 (29%), Positives = 141/301 (46%), Gaps = 57/301 (18%)

Query: 716  NWLPSGIIF--QSDFATTVS-----SSFNPTAT---KSLPQFIAPPKMTVKSPNTTLVTI 765
            NWLP+ II   + +  +T S     S   PTAT   ++LPQ IA P       + TL+TI
Sbjct: 756  NWLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTLITI 815

Query: 766  GLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLF 825
            G K+ LNY F+  NP ++AQIF++LP +L YPF+                         F
Sbjct: 816  GFKKQLNYPFIAMNPFANAQIFDYLPGILNYPFN-------------------------F 850

Query: 826  NASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALA 885
              + ISV  +VPL     ++  ++ +VYFP++ +D L+ L+ D NS LYS+ + ++   A
Sbjct: 851  EYADISVIQLVPLKANSKDYIATIAQVYFPSEKVDELAKLVVDTNSELYSSYDANMKVFA 910

Query: 886  RLIDPSIPXXXXXXXXXXXXXXXXDADYNSDQSGNTRQSRKGKGLPSNLSIVGSLDN-YD 944
             LIDP +P                 A      SG+T Q++      +++   G+L   Y+
Sbjct: 911  SLIDPQLPLTGL-------------AGKGFSSSGSTTQNKPHPDADNSIGRSGALGGPYN 957

Query: 945  KNPEKEE----HKNRVISIVLPTV----LPLGLLFIWCLFFILMSRTQRRRKGNATIEKS 996
                K       K ++  IV+ ++    L + L+ +   +F+L SR     + N +   S
Sbjct: 958  PTNSKSAAVPMSKAKLTGIVVGSICGVTLYIALMIVGVRYFLLRSRGGVELQDNHSFYSS 1017

Query: 997  N 997
            N
Sbjct: 1018 N 1018

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
           YGR014W
          Length = 994

 Score =  112 bits (281), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 101/180 (56%), Gaps = 28/180 (15%)

Query: 717 WLPSGIIFQSDFATTVS---SSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNY 773
           W+P+ ++ ++    T S   S+ +P+ATK +PQ I  P     +   TL+TIG K+ L+Y
Sbjct: 646 WIPTRLLTETAAVETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIGFKKPLHY 705

Query: 774 QFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVH 833
           +F++  P SSAQI +FLP++L  P+                        N+F  S ISV 
Sbjct: 706 EFVVTQPKSSAQIISFLPNLLNQPY-----------------------GNIF--SNISVL 740

Query: 834 GIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
            +VPL      ++V+V EVYFP   + +LS L+KD +S LY+  ++SL  LA +IDPSIP
Sbjct: 741 QLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVKDTSSILYTEVSESLKTLADMIDPSIP 800

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score =  110 bits (276), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 100/185 (54%), Gaps = 32/185 (17%)

Query: 716  NWLPSGIIFQSDF-------ATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLK 768
            NWLP+ ++ +S         A    +  +  AT++LPQ IA      +    TL+TIG K
Sbjct: 901  NWLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFK 960

Query: 769  QGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNAS 828
            + LNY F++ +P+SSAQ+F++LP+VL YPF+                         +  S
Sbjct: 961  KSLNYPFVVSHPVSSAQLFSYLPNVLNYPFN-------------------------YTFS 995

Query: 829  TISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLI 888
             + V+ +VPL     ++ ++V +VYFP++ ++ L  LI +  ++LY N N +  +LA LI
Sbjct: 996  DVQVYQLVPLKSSSRDYLITVAKVYFPSEQVEVLQKLISNTAANLYFNSNPTEKSLASLI 1055

Query: 889  DPSIP 893
            DP+IP
Sbjct: 1056 DPTIP 1060

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
           Anc_4.150 YGR014W
          Length = 826

 Score =  110 bits (275), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 96/178 (53%), Gaps = 25/178 (14%)

Query: 717 WLPSGIIFQSDFA-TTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQF 775
           W+P+ II +SD    +VSS+   + T+  P+ IA P         TL+TIG K+ LNY F
Sbjct: 488 WVPTRIITESDKTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGFKEALNYDF 547

Query: 776 LIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGI 835
           ++DNP+SSAQIF FLP  L  PF                           N S++S+  +
Sbjct: 548 VLDNPVSSAQIFAFLPEALDLPF------------------------QFANDSSVSILKL 583

Query: 836 VPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
           VP  +  + + V V EVYFP+D +D LS+LIKD +S LY+    S  AL  LID +IP
Sbjct: 584 VPYSLSNYNYTVLVAEVYFPSDSIDELSSLIKDSDSPLYTLNTGSRLALVNLIDQNIP 641

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
            complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score =  110 bits (275), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/307 (28%), Positives = 132/307 (42%), Gaps = 47/307 (15%)

Query: 717  WLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFL 776
            W+P+ +I +SD   +  ++   +ATKS+P  IA    T      +LVTIG K+ LNYQF+
Sbjct: 643  WVPTSLITESDVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQFV 702

Query: 777  IDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGIV 836
            + + ++ AQIF FLP  L  PF     N                         ++V+ + 
Sbjct: 703  LSSSVTVAQIFAFLPGGLIAPFEEQLAN-------------------------VTVYRLS 737

Query: 837  PLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPXXX 896
            PL      + ++V EVYFP   +D L+A + D  S+LY N + +   L  LIDP IP   
Sbjct: 738  PLNYGNFNYTLTVAEVYFPTSKIDELAAFVADSESALYVNASGTEEELVSLIDPRIPITG 797

Query: 897  XXXXXXXXXXXXXDADYNSDQSGNTRQSRKGKGLPSNLSIVGSLDNYDKN-------PEK 949
                          +  N + S +   S             G+LD+Y KN         K
Sbjct: 798  LLNSLSSSSSSSSSSSSNDESSSDGNSSSNSNNY-------GTLDSYSKNVGNTTTSKGK 850

Query: 950  EEHKNRVISIVLPTVLPLGLLFIWCLFFILMSRTQRRRKGNATIEKSNIKVDNTSGYHDN 1009
             +    +I IV    L + ++ +   FFI+    + RRK +      N    ++    +N
Sbjct: 851  AKLTIFIIGIVAAGSLYIAVMILLVRFFII----RHRRKADIL----NDSDSSSISSSEN 902

Query: 1010 GRSNYKD 1016
            G  NYKD
Sbjct: 903  GHVNYKD 909

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
            YGR014W
          Length = 949

 Score =  108 bits (271), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 160/349 (45%), Gaps = 47/349 (13%)

Query: 717  WLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFL 776
            W+ S ++  S+ A+T + +   TAT SLPQ IA P       + +L+TIG K+ LNY+F+
Sbjct: 591  WVASDLMTASEEASTTTRASATTATGSLPQAIAAPTEVTAPDDYSLITIGFKKALNYEFV 650

Query: 777  IDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGIV 836
            ++ P SSAQ+F++LP  L  PF+    N F                     + ISV+ IV
Sbjct: 651  VNTPESSAQLFSYLPIALNTPFN----NSF---------------------TNISVYQIV 685

Query: 837  PLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPXX- 895
            PL+     ++++V EVYFP   + SL  +IKD +S+L++    +   L  LIDPSIP   
Sbjct: 686  PLVESSLNYYITVAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVSLIDPSIPLVG 745

Query: 896  ---XXXXXXXXXXXXXXDADYNSDQSGNTRQSRKGKGLPSNLSI---VGSLDNYDKNPEK 949
                              +  NS Q  +   S               +GSLD  +K+   
Sbjct: 746  LLSSTTSNSSTSATGSSASTTNSGQVNSGSNSDSDSSSGKGSVSSNDIGSLDYSEKSTSA 805

Query: 950  EEHK---NRVISIVLPTVLPLGLLFIWCLFFILMSRT-----QRRRKGNATIEKSNIKVD 1001
               K   NR + I++  V+  GLLFI    +IL  R      Q+R+  N + +  +   D
Sbjct: 806  AAGKTTSNRKLIILIVCVVIGGLLFITLTAYILHVRITVFKDQKRKAANMSFDVLS-TTD 864

Query: 1002 NTSGYHDNGRSNYKDN---VYDGI---LDEKHYSSSEGVSNGSTMAGLA 1044
            ++ G   N +    DN   V D I   ++  H+ ++   +N +   G A
Sbjct: 865  SSGGSVYNEKEKLNDNESVVSDKINAWMNNAHFENAAYYANNTNNDGAA 913

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
           (REAL)
          Length = 1169

 Score =  107 bits (268), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 99/178 (55%), Gaps = 26/178 (14%)

Query: 717 WLPSGIIFQS-DFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQF 775
           W+P+ +I Q+ + A+T+SS+   T T +LPQ +A      +S   +L+T+G K+ LNY+F
Sbjct: 823 WIPTELITQAPETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITVGFKKPLNYEF 882

Query: 776 LIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGI 835
           ++  P SSAQIF +LP+ L  PF                        N+F  + I+V  I
Sbjct: 883 VVSEPKSSAQIFGYLPAALNTPF-----------------------KNVF--TNITVLQI 917

Query: 836 VPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
           VPL      + +SV EVYFP   ++ LS LI + +S+ Y++   +  ++A ++DPSIP
Sbjct: 918 VPLQDDSLNYLISVAEVYFPTAEVEELSNLIMNTSSTFYTDGTGTAKSMAAMVDPSIP 975

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score =  105 bits (261), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 98/184 (53%), Gaps = 27/184 (14%)

Query: 712  SSDENW-LPSGIIFQS-DFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQ 769
            SSD NW +P+ +I Q+ + A+T SS+   T T +LP  IA      +    TL+TIG K+
Sbjct: 955  SSDNNWWIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKK 1014

Query: 770  GLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNAST 829
             LNY+F++  P SSAQIF +LP  L  PF                        N+F  + 
Sbjct: 1015 ALNYEFVVSEPKSSAQIFGYLPEALNTPF-----------------------KNVF--TN 1049

Query: 830  ISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLID 889
            I+V  IVPL      + VSV EVYFP   ++ LS LI + +S+ Y++   +  ++A ++D
Sbjct: 1050 ITVLQIVPLQDDSLNYLVSVAEVYFPTAEIEELSNLITNSSSAFYTDGMGTAKSMAAMVD 1109

Query: 890  PSIP 893
             SIP
Sbjct: 1110 SSIP 1113

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
           Anc_4.150 YGR014W
          Length = 1123

 Score =  103 bits (258), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 90/177 (50%), Gaps = 27/177 (15%)

Query: 717 WLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFL 776
           W+P+ I+ Q+  + T SS     AT +LPQ IA      +    TL+T+G K+ LNY F+
Sbjct: 796 WVPTQIVTQT--SQTTSSGTVGQATATLPQAIAAATQVARPDGYTLITLGFKRALNYNFV 853

Query: 777 IDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGIV 836
           + NP+SSAQIF FLP +L  PF +   N                         I+V  +V
Sbjct: 854 VSNPISSAQIFAFLPEMLRTPFENSYEN-------------------------ITVQQLV 888

Query: 837 PLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
           PL      +  +V EVYFP   + +LS LI + +S+LY++       LA LID SIP
Sbjct: 889 PLQSKAVSYLATVAEVYFPTSEISALSKLISNTSSNLYTDVEGPAKYLAYLIDASIP 945

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
           Anc_4.150
          Length = 985

 Score =  103 bits (258), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 104/186 (55%), Gaps = 29/186 (15%)

Query: 712 SSDENW-LPSGIIFQSDF-ATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQ 769
           SSD NW +P+ +I QS+  + + S   + TATK+LPQ IA      +    +L+TIG K+
Sbjct: 600 SSDTNWWIPTVLITQSNQPSESASVPTSNTATKTLPQVIAVGTTIPEPEGYSLITIGFKK 659

Query: 770 GLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNAST 829
            LNY+F++ NP SSAQIF+FLP VL  PF                       +N FN   
Sbjct: 660 PLNYEFIVANPKSSAQIFSFLPDVLNAPF-----------------------NNTFN--N 694

Query: 830 ISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRN--SSLYSNPNDSLSALARL 887
           I+V  +VPL  P   + V+V +VYFP D++D+LS+LI+D    S +Y+    +  +LA L
Sbjct: 695 ITVLQLVPLQNPSLNYLVTVAKVYFPTDMIDTLSSLIEDYTTPSLIYTINQGAKGSLANL 754

Query: 888 IDPSIP 893
           I   IP
Sbjct: 755 ISSDIP 760

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score =  102 bits (255), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 126/293 (43%), Gaps = 46/293 (15%)

Query: 716  NWLPSGIIFQSDFATTVSSSFNPT----------ATKSLPQFIAPPKMTVKSPNTTLVTI 765
            NWLP+ +I     A   + S +PT          ATK+LPQ I  P   V+    TL+T+
Sbjct: 1223 NWLPTAMIT----ANANTESASPTDSSDPKDAQQATKTLPQAIGAPTEVVQPEGYTLITV 1278

Query: 766  GLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLF 825
            G K+ LNY F++ NP++SAQIF FLP  L  PF               DNA         
Sbjct: 1279 GFKKALNYPFVVGNPVTSAQIFAFLPDTLNSPF---------------DNAF-------- 1315

Query: 826  NASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALA 885
              + I+V  + PL +   ++ ++V EVYFP+  +++L  LI++  S  Y     S + +A
Sbjct: 1316 --TNITVARLGPLKVSSRDYLLTVAEVYFPSAQVENLQKLIQNDASKFYFVNGTSRNVVA 1373

Query: 886  RLIDPSIPXXXXXX---XXXXXXXXXXDADYNSDQSGNTRQSRKGKGLPSNLSIVGSLDN 942
             L+D +IP                    +  N+  S N       +    NL  +GS   
Sbjct: 1374 SLVDATIPLTGLLQDDGSTTSETGSESGSPSNTGSSSNEGTDSSEQSSHGNLGTLGSSQY 1433

Query: 943  YDKNPE--KEEHKNRVISIVLPTVLPLGLLFIWCLFFILMSRTQRRRKGNATI 993
                    K   K ++I +V+  V   G L    +  I+     ++R+  A+ 
Sbjct: 1434 SSSASGFFKSGGKGKLIGLVVGVV--CGALVYVAIMVIVFRFVVKKRQLKASF 1484

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]
           {ON} some similarities with uniprot|P32334 Saccharomyces
           cerevisiae YGR014W MSB2 Mucin family member at the head
           of the Cdc42p- and MAP kinase-dependent filamentous
           growth signaling pathway also functions as an osmosensor
           in parallel to the Sho1p-mediated pathway potential
           Cdc28p substrate
          Length = 908

 Score =  101 bits (252), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 97/179 (54%), Gaps = 25/179 (13%)

Query: 717 WLPSGII--FQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQ 774
           WLP+ ++  F++    + S++ +  AT++LPQ I      V+    TL+T+G K+ LNY 
Sbjct: 535 WLPTTMVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQPAGYTLITVGFKKELNYP 594

Query: 775 FLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHG 834
           F ++NP+S+AQIF FLP VL YPF                N     D+        SV  
Sbjct: 595 FTVNNPVSNAQIFEFLPKVLNYPF----------------NGAQKFDNT-------SVLE 631

Query: 835 IVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
           +VPL +   ++ V+V +VYFP D + +L A I + +S +Y+N   +L  L+  ID SIP
Sbjct: 632 LVPLKVTSLDYLVTVAKVYFPEDSVSTLQAQILNSSSVIYNNDVTALKQLSSYIDASIP 690

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score =  102 bits (253), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 88/303 (29%), Positives = 127/303 (41%), Gaps = 44/303 (14%)

Query: 716  NWLPSGIIFQS--DFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNY 773
            +WLP+ II +S        +S+    +T  LP  I P  +   S    L++IG  +GLNY
Sbjct: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556

Query: 774  QFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNAL---------------- 817
             F+    LSSAQIF FLP VLTYPF S+      I+   +   L                
Sbjct: 1557 VFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDT 1616

Query: 818  ----AFLDSNLF----------NASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLS 863
                +F  S +           + S + V  + P +     +  ++  VYFP+ L+  L 
Sbjct: 1617 TTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQ 1676

Query: 864  ALIKDRNSSLYSNPNDSLSALARLIDPSIPXXXXXXXXXXXXXXXXDADYNSDQSGNTRQ 923
             LI D  S LY+NP+ +L   A LIDP+I                      SD    +  
Sbjct: 1677 ELILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHDRSNPRPAQGGGTSGSDGYSPSGY 1736

Query: 924  SRKGKGLPSNLSIVGSLDNYDKNPEKEEHKNRVISIVLPTVLPLGLLFIWCLFFILMSRT 983
            +  G          GSLDN  K+P+      + + I L TVL  G +F+W L F+ + R 
Sbjct: 1737 ANHGD---------GSLDN-SKSPKITFKITKRLLIFL-TVLTFG-VFLWRLVFLYLFRR 1784

Query: 984  QRR 986
              R
Sbjct: 1785 LYR 1787

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
           (REAL)
          Length = 1189

 Score =  101 bits (252), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 100/184 (54%), Gaps = 27/184 (14%)

Query: 712 SSDENW-LPSGIIFQS-DFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQ 769
           SSD NW +P+ +I Q+ + A+T SS+ + T T +LP  IA       S   +L+T+G K+
Sbjct: 836 SSDNNWWIPTELITQAPEAASTASSTASGTQTMTLPHAIAAATQIPASEGYSLITVGFKR 895

Query: 770 GLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNAST 829
            LNY+F++  P SSAQIF +LP  L  PF                        N+F  + 
Sbjct: 896 ALNYEFVVSEPKSSAQIFGYLPEALNTPF-----------------------KNVF--TN 930

Query: 830 ISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLID 889
           ISV  IVPL      + VSV EVYFP   L+ LS LI + +S+ Y++   +  ++A ++D
Sbjct: 931 ISVLQIVPLQDDSLSYLVSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMAAMVD 990

Query: 890 PSIP 893
           PSIP
Sbjct: 991 PSIP 994

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 154/353 (43%), Gaps = 73/353 (20%)

Query: 717  WLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKM-TVKSP----NTTLVTIGLKQGL 771
            W+P+ +         V+S+ N T T +LP    P  + +V+ P    N +L+TIG K+ L
Sbjct: 1498 WIPTSLA--------VASTMNSTDTSTLPTQAIPQAIGSVEQPPAPENHSLITIGFKKEL 1549

Query: 772  NYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTIS 831
            NY+F++ +P+S AQI N+LP                 N+L++    AF      N + IS
Sbjct: 1550 NYEFVVSHPMSGAQIINYLP-----------------NTLVN----AFFG----NVTNIS 1584

Query: 832  VHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPS 891
            V+ +VP      ++ +++  VYFP D +  L  LI D++SS Y+   D    LA L+DPS
Sbjct: 1585 VNNLVPYNDTKSDYLITIATVYFPTDEIKHLRELIHDKSSSFYTASQDVARQLANLVDPS 1644

Query: 892  IPXXXXXXXXXXXXXXXXDADYNSDQSGNTR----QSRKGKGLPS-NLSIVGSLDNYDKN 946
            IP                +   NSD + N       +   +G+ + ++S +  +     N
Sbjct: 1645 IP------------LTGLNLFGNSDDTNNNNPYSPDNSNSEGIGTLDVSPINKVSVLKNN 1692

Query: 947  PEKEEHKNRVISIVLPTVLPLGLLFIWCLFFILMSRTQRRRKGNATIEKSNI-------K 999
                  K +V  +++  V+  G   I    F +     +R   N T E++NI       K
Sbjct: 1693 SGALNTKGKVTGLIIGVVIG-GCCLIALSIFSIGHFIMKRHNANVT-EETNIVDHFNFTK 1750

Query: 1000 VDNTSGYHDN------GRSNYKDNVYDGI---LDEKHYSSSEGVSNGSTMAGL 1043
              N S  H N       RS+  D+  + I   +D  ++   E    G+   G+
Sbjct: 1751 KSNISTLHSNLTEKFSRRSHNFDDPNERINSWMDNNYFGDVEDTYTGTAEIGM 1803

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 98/187 (52%), Gaps = 31/187 (16%)

Query: 712  SSDENWLPSGII-FQSDFATTVSSSFNPT----ATKSLPQFIAPPKMTVKSPNTTLVTIG 766
            +S  NWLP+ ++   SD   T S S +      AT++LPQ I  P    +    TL+TIG
Sbjct: 1174 TSTSNWLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIG 1233

Query: 767  LKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFN 826
             KQ LNY F++ N ++SAQIF +LP  L +PF              DD   AF D     
Sbjct: 1234 FKQALNYPFVVTNAVTSAQIFAYLPETLNFPF--------------DD---AFSD----- 1271

Query: 827  ASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALAR 886
               I+V  + PL +   ++ +++ EVYFP+  +++L  LI++  S  Y+  N + + LA 
Sbjct: 1272 ---ITVARLGPLKVSNRDYLLTIAEVYFPSAQVENLQTLIQNDESKFYAK-NATKNLLAA 1327

Query: 887  LIDPSIP 893
             +D +IP
Sbjct: 1328 FVDATIP 1334

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
           (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score = 98.6 bits (244), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/221 (32%), Positives = 103/221 (46%), Gaps = 45/221 (20%)

Query: 717 WLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFL 776
           WLP+ I+ QS      +S    T T  LP  IAP  +T +  ++ L++IG K  LNY FL
Sbjct: 520 WLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVT-QPADSILISIGFKIELNYPFL 578

Query: 777 IDNPLSSAQIFNFLPSVLTYPFSSYAPND-------------------------FPINSL 811
           I    +SAQIFNFLP +LTYPF   + N                          F   + 
Sbjct: 579 IKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIFSYETT 638

Query: 812 IDDNALAFLD-----SNLFNA--------------STISVHGIVPLLIPGHEFFVSVVEV 852
           + +  L   D     +++  A              S+ISV  I+P+LIPG+ +  S+ E 
Sbjct: 639 LSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLYITSLAEG 698

Query: 853 YFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
            FP + +D L   I +  S +Y NP+  L  +A LID +IP
Sbjct: 699 LFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIP 739

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
           (REAL)
          Length = 1135

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 93/178 (52%), Gaps = 26/178 (14%)

Query: 717 WLPSGIIFQ-SDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQF 775
           W+P+ +I Q ++ A++ S++   T T +LP  IA      +    +L+TIG K+ LNY+F
Sbjct: 790 WIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALNYEF 849

Query: 776 LIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGI 835
           ++  P SSAQIF +LP  L  PF     N                         ISV  I
Sbjct: 850 VVSEPKSSAQIFAYLPEALNTPFKDVFTN-------------------------ISVLQI 884

Query: 836 VPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIP 893
           VPL      + VSV EVYFP   +++LS+LI + +SS Y++   +  ++A ++D SIP
Sbjct: 885 VPLQDDLFSYLVSVAEVYFPTAEIETLSSLITNTSSSFYTDGMGTAKSMAAMVDASIP 942

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 multicopy suppressor of a CDC24 bud
            emergence defect
          Length = 936

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 141/320 (44%), Gaps = 44/320 (13%)

Query: 717  WLPSGIIF---QSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSP-NTTLVTIGLKQGLN 772
            W+P+ +I    +++  +T + S + T   SLP+ I     +   P   +++TIG K+ LN
Sbjct: 591  WIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESVPEGYSVITIGFKKPLN 650

Query: 773  YQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNALAFLDSNLFNASTISV 832
            Y F++    SSAQI  +LP +L   F S                       +F  S I  
Sbjct: 651  YPFVVSESKSSAQIMYYLPKLLNANFES-----------------------IF--SDIKT 685

Query: 833  HGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLS-ALARLIDPS 891
              ++PL I    +  +V  ++FP   + SLS ++K+ +SSLYS   ++++ +L+ LIDP 
Sbjct: 686  VQLMPLEIQDSGYLSTVALLFFPTSEIQSLSNMVKNTSSSLYSTQYETITQSLSALIDPR 745

Query: 892  IPXXXXXXXXXXXXXXXXDADYNSDQSG-----NTRQSRKGKGLPS-NLSIVGSLDNYDK 945
            IP                 +  NS+        +T  S     + S +L  + S  +   
Sbjct: 746  IPVTGLTDTKTNNAGSSSSSSSNSNGRSSNSNQDTEHSSSFGNINSGSLDYIPSSKSASS 805

Query: 946  NPEKEEHKNRVISIVLPTVLPLGLLFIWCLFFILMSRTQRRRK-------GNATIEKSNI 998
            +  + + K R+I I++ T+   G+  I  LF        +RR+            E+++ 
Sbjct: 806  DGTQSKTKKRIIPIIVGTIAG-GMAVIIMLFLFFRYHAMKRREQLNQERLARLNFERASS 864

Query: 999  KVDNTSGYHDNGRSNYKDNV 1018
              D++   ++N +  Y D+V
Sbjct: 865  CSDDSIERYNNEKQQYSDDV 884

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 6/93 (6%)

Query: 711 LSSDENWLPSGIIFQSDFATTVSSSFNPTA---TKSLPQFIAPPKMTVKSPNTTLVTIGL 767
           L+   +WLPS I  QSD   + + S  P+    T  LP  I  P       NTTL+T+  
Sbjct: 510 LTRSFDWLPSEIAIQSD---STAESMEPSFLIDTSGLPNIITAPTAITIPSNTTLITVAF 566

Query: 768 KQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSS 800
           K+ LNY FL++N  SSAQIFNFLP ++ +PF++
Sbjct: 567 KRELNYAFLVNNFYSSAQIFNFLPIIIKHPFTA 599

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 45/64 (70%)

Query: 830 ISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLID 889
           I+V  I+P ++  +++ +S+ EVY PN+++++L  LI +  SS Y++ + SL  LA LID
Sbjct: 700 ITVARIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFYNSESSSLKTLAFLID 759

Query: 890 PSIP 893
           P+IP
Sbjct: 760 PNIP 763

 Score = 39.3 bits (90), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 23/30 (76%)

Query: 1144 IDDDEDENVKDLQIEDVDEFDEELYKRLSK 1173
            + D ED+ V D+ + ++DE DEE+YKR+++
Sbjct: 1110 VSDIEDDEVNDVHVGELDELDEEIYKRITR 1139

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 62/97 (63%), Gaps = 2/97 (2%)

Query: 709  KTLSSDENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVK-SP-NTTLVTIG 766
            K++S+  NWLPS ++ +++ + + +  FNP+ T   P+ I P     K +P ++ L+ + 
Sbjct: 1548 KSVSNGSNWLPSTLVVENNPSGSANMQFNPSETFKWPRAITPENQNEKPAPVDSQLILVA 1607

Query: 767  LKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAP 803
            L + LNY FLI+N +SSAQ+ N++P +L+Y    ++P
Sbjct: 1608 LDRPLNYPFLIENLVSSAQVMNYIPFILSYSLIDFSP 1644

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%)

Query: 830  ISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLID 889
            I V  I+PLLI   +++V+ V+VY PN+++D L A I D +S LY NP      L+  ID
Sbjct: 1777 IEVKQIIPLLIEDRDYWVAGVQVYVPNNVVDQLQAYIYDLDSILYHNPVYIARELSNFID 1836

Query: 890  PSIP 893
             SIP
Sbjct: 1837 SSIP 1840

>Suva_9.48 Chr9 (80060..82519) [2460 bp, 819 aa] {ON} YIL140W (REAL)
          Length = 819

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 948  EKEEHKNRVISIVLPTVLPLGLLFIWCLFFILMSRTQRRRKGNATIEK-----SNIKVDN 1002
            +K  H  + ++IV   V+PLG++ I  + F++     RRRK ++  EK     S   +DN
Sbjct: 493  KKSSHSKKTVAIVCGVVIPLGVILIAVILFLVF---WRRRKESSDDEKSPNAISGPDLDN 549

Query: 1003 TSGYHDNGRSNYKDNVYD 1020
             +   + G +   DN +D
Sbjct: 550  AANKPNQGNATSLDNPFD 567

>KNAG0B05750 Chr2 (1133580..1136123) [2544 bp, 847 aa] {ON}
           Anc_4.185 YLR352W
          Length = 847

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 793 VLTYPFSSYAPNDFPINS-LIDDNALAFLDSNLFNASTISVHGIVPLLIPGHEFFVSVVE 851
           VLTY F  Y  ND+P  S   ++N   FL SNL    T   + I  +LI  H  F +   
Sbjct: 23  VLTYQFKDYMSNDYPPTSEKFNENLRNFLKSNLTVNKTF--YHICRVLIYKHCNFTTAKR 80

Query: 852 VYFPNDLLDSLSALIKDRN 870
            Y   +LL+SL    + RN
Sbjct: 81  FY---NLLESLEKQEQLRN 96

>Smik_9.29 Chr9 (63082..65547) [2466 bp, 821 aa] {ON} YIL140W (REAL)
          Length = 821

 Score = 35.4 bits (80), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 952 HKNRVISIVLPTVLPLGLLFIWCLFFILMSRTQRRRKGNATIEK 995
           HK + ++I     +PLG++ I  + F++     RRRK N+  EK
Sbjct: 499 HKKKAVAIACGVAIPLGVILIAIICFLIF---WRRRKENSDNEK 539

>YGL186C Chr7 complement(151037..152776) [1740 bp, 579 aa] {ON}
           TPN1Plasma membrane pyridoxine (vitamin B6) transporter;
           member of the purine-cytosine permease subfamily within
           the major facilitator superfamily; proton symporter with
           similarity to Fcy21p, Fcy2p, and Fcy22p
          Length = 579

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 28/44 (63%)

Query: 562 DSSNTIPQPEDNTPTTSTVSEFTASNVDVSSVHIASKDADSSPN 605
           D+ +T  + ED+T  T+ V EF       SS++IA++ A+SSP+
Sbjct: 4   DNMDTTKRKEDHTKHTTDVIEFYEEGTAASSLNIATEKANSSPS 47

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.126    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,188,392
Number of extensions: 4447475
Number of successful extensions: 21027
Number of sequences better than 10.0: 250
Number of HSP's gapped: 21370
Number of HSP's successfully gapped: 428
Length of query: 1185
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1064
Effective length of database: 39,606,813
Effective search space: 42141649032
Effective search space used: 42141649032
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 72 (32.3 bits)