Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02739g6.21ON34334313700.0
TDEL0G044806.21ON3433238941e-119
Suva_15.1826.21ON3463238701e-115
Smik_15.1766.21ON3453238621e-114
YOR007C (SGT2)6.21ON3463228581e-113
SAKL0E01210g6.21ON3233198521e-113
ZYRO0C07788g6.21ON3343148521e-113
Skud_15.1686.21ON3483248491e-112
TPHA0J003406.21ON3383298071e-106
Kwal_56.224336.21ON3223198021e-105
Kpol_1037.266.21ON3423278011e-105
NCAS0H008306.21ON3383297811e-102
KAFR0L004106.21ON3313227781e-101
KLTH0C11220g6.21ON3273207597e-99
KLLA0D01155g6.21ON3353287554e-98
TBLA0G010506.21ON3503257555e-98
KNAG0M011706.21ON3393237494e-97
Ecym_30256.21ON3183237222e-93
NDAI0D008106.21ON3493357087e-91
ACR005W6.21ON3273296781e-86
Kpol_1032.86.21ON3433284554e-53
TPHA0M002706.21ON3773673335e-35
NCAS0D026706.21ON3512313194e-33
NDAI0I022406.21ON3503293176e-33
CAGL0H08195g5.617ON583902012e-16
NDAI0F009105.617ON583912002e-16
TBLA0A072706.21ON3731941948e-16
SAKL0G07084g5.617ON5851121932e-15
AEL224W5.617ON5801121889e-15
TPHA0D028805.617ON585901852e-14
Kwal_55.199355.617ON593901825e-14
NCAS0G008105.617ON584911808e-14
Smik_15.2055.617ON589901791e-13
KAFR0C058905.617ON575931782e-13
ZYRO0A05676g5.617ON572881782e-13
YOR027W (STI1)5.617ON589901772e-13
TBLA0E033005.617ON582901763e-13
KLTH0E02178g5.617ON593891745e-13
Kpol_1018.695.617ON590901745e-13
TDEL0A048405.617ON576891745e-13
Ecym_55825.617ON584901692e-12
Suva_8.805.617ON586901631e-11
Skud_15.1925.617ON589911622e-11
NCAS0A00490singletonON620851622e-11
KLLA0A07062g5.617ON581901603e-11
KNAG0B032005.617ON579911551e-10
SAKL0F03102g3.481ON513671452e-09
Ecym_44133.481ON510671327e-08
Smik_6.2153.481ON513601328e-08
YGR123C (PPT1)3.481ON513601329e-08
KAFR0B066103.481ON5111071292e-07
TDEL0D055003.481ON5121021292e-07
Skud_7.4323.481ON513601292e-07
CAGL0D05060g3.481ON510641292e-07
TPHA0D032203.481ON513631282e-07
TBLA0C039503.481ON512621283e-07
Suva_7.4083.481ON513601273e-07
KNAG0A079003.481ON512641265e-07
AAR083C3.481ON538651212e-06
NCAS0F034903.481ON512591193e-06
NDAI0B057903.481ON5231001132e-05
KLLA0F24046g2.152ON604611123e-05
Kpol_505.413.481ON513641104e-05
ZYRO0B04224g3.481ON5131001096e-05
KNAG0A039508.506ON386811087e-05
Kwal_55.211753.481ON511851052e-04
KLTH0F14542g3.481ON513591052e-04
NCAS0B070102.152ON625941042e-04
NCAS0B024008.506ON380811023e-04
KAFR0E029808.506ON3801211024e-04
NCAS0G024802.152ON596691025e-04
Kpol_1043.605.689ON706971007e-04
Kwal_33.147672.152ON594991007e-04
YBR155W (CNS1)8.506ON38555998e-04
CAGL0H07425g8.506ON380118998e-04
Skud_8.1782.152ON638631009e-04
TBLA0C055302.152ON61091999e-04
TDEL0B051402.152ON59993990.001
KLLA0B10912g3.481ON51251980.001
ZYRO0G06512g2.152ON60488970.002
CAGL0L04048g2.152ON58756970.002
NDAI0F028102.152ON60962960.002
KLTH0B05170g2.152ON59360960.002
Skud_2.2828.506ON38555960.002
KAFR0F007202.152ON60882960.003
Suva_15.3142.152ON64463950.003
AGL268C8.506ON37981940.003
SAKL0H10934g8.506ON38099930.004
Ecym_40315.689ON688107930.005
Smik_2.2958.506ON38555920.006
Kwal_27.118908.506ON33484920.006
YHR117W (TOM71)2.152ON63963910.010
TBLA0I023106.328ON11645850.011
Suva_4.4058.506ON38555890.015
TDEL0B013108.506ON38079890.015
NDAI0B043402.152ON66490890.017
ADR230W5.689ON68599880.022
Smik_8.1952.152ON63563880.022
Ecym_82042.152ON59760870.028
Kpol_513.28.506ON37499860.029
Ecym_25598.506ON37078860.035
CAGL0L12936g2.152ON60060860.042
ZYRO0F08624g8.506ON37984850.048
Kpol_1018.1067.412ON75380850.059
TBLA0H033808.506ON375114830.068
Skud_14.2112.152ON61761840.074
NCAS0I008703.395ON58558830.085
TPHA0G004305.689ON72856830.092
Ecym_20906.328ON17284800.10
AEL062C1.456ON383114820.10
SAKL0E10956g2.152ON60060820.11
CAGL0M08030g1.456ON38798820.12
KNAG0H035302.152ON61460820.12
KLLA0E20857g7.412ON71067820.14
SAKL0A01672g6.328ON12849770.14
KLLA0B09966g8.506ON370120810.15
CAGL0K09240g6.328ON14255770.15
Suva_2.347.412ON76380810.17
YBL084C (CDC27)7.412ON75880810.18
NDAI0C051308.470ON59055800.20
SAKL0D11110g1.456ON432135800.20
NCAS0B025608.470ON57879800.20
Smik_2.367.412ON75180800.21
TPHA0I015102.152ON60367800.23
ZYRO0B03828g7.412ON72780790.26
TPHA0L014208.506ON37495780.29
SAKL0E14542g5.689ON69053790.29
Kpol_1048.212.152ON597117790.29
ABR131W2.152ON59461790.30
KNAG0B012903.395ON53763780.34
ACR173W7.458ON285107770.35
Smik_14.2072.152ON617117780.35
AGL294W7.412ON65695770.54
TPHA0D038606.328ON12084720.55
KLLA0C15455g8.470ON56688760.55
Ecym_71427.412ON67595760.60
Kwal_34.160921.456ON395101750.67
TBLA0H019705.352ON84064750.86
KAFR0J025706.328ON12176700.93
YNL121C (TOM70)2.152ON61761740.97
NCAS0A147707.458ON30083740.98
KLTH0E11748g8.506ON37859741.0
CAGL0K11209g8.470ON59064741.1
Smik_4.4918.470ON61249741.2
KNAG0H006103.367ON97340741.2
Skud_4.5068.470ON61149741.2
Suva_2.4108.470ON61149741.2
TPHA0L012108.470ON58864731.3
KNAG0I025206.328ON11776691.4
YDR244W (PEX5)8.470ON61249731.5
Suva_14.2192.152ON61761731.6
TPHA0E007407.412ON74680731.6
TDEL0B023305.689ON70254721.8
Kpol_1067.251.456ON391105721.9
Kpol_1031.648.470ON60763712.2
Kwal_27.117378.470ON57549712.3
Skud_2.247.412ON76980712.4
KLTH0E10934g8.470ON56848712.8
AAR054C6.328ON13349672.9
Ecym_13968.470ON57386703.0
SAKL0H11946g8.470ON57364703.0
NDAI0A081703.395ON53966703.1
CAGL0H07095g5.352ON66155703.4
TPHA0B039701.456ON396135694.5
Suva_16.4173.395ON53964685.5
TBLA0B079705.72ON687122685.9
TBLA0C046507.246ON1273143686.0
KAFR0L018707.412ON71254686.8
CAGL0K07392g8.792ON44734677.0
TDEL0B016608.470ON54949677.4
KLLA0A05258g5.72ON632100677.8
CAGL0C01903g7.412ON76980678.5
Kpol_1028.516.328ON11759638.5
TBLA0F012303.367ON118940678.9
SAKL0F12936g7.412ON63248669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02739g
         (343 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   532   0.0  
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   348   e-119
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   339   e-115
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   336   e-114
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   335   e-113
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   332   e-113
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   332   e-113
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   331   e-112
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   315   e-106
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   313   e-105
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   313   e-105
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   305   e-102
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   304   e-101
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   296   7e-99
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   295   4e-98
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   295   5e-98
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   293   4e-97
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   282   2e-93
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   277   7e-91
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   265   1e-86
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   179   4e-53
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   132   5e-35
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   127   4e-33
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   126   6e-33
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    82   2e-16
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     82   2e-16
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    79   8e-16
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    79   2e-15
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    77   9e-15
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    76   2e-14
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    75   5e-14
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    74   8e-14
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    74   1e-13
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    73   2e-13
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    73   2e-13
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    73   2e-13
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    72   3e-13
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    72   5e-13
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    72   5e-13
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    72   5e-13
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    70   2e-12
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    67   1e-11
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    67   2e-11
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       67   2e-11
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    66   3e-11
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    64   1e-10
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    60   2e-09
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    55   7e-08
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    55   8e-08
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    55   9e-08
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    54   2e-07
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    54   2e-07
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    54   2e-07
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    54   2e-07
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    54   2e-07
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    54   3e-07
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    54   3e-07
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    53   5e-07
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    51   2e-06
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    50   3e-06
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    48   2e-05
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    48   3e-05
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    47   4e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    47   6e-05
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    46   7e-05
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    45   2e-04
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    45   2e-04
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    45   2e-04
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    44   3e-04
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    44   4e-04
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    44   5e-04
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    43   7e-04
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    43   7e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    43   8e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    43   8e-04
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    43   9e-04
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    43   9e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    43   0.001
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    42   0.001
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    42   0.002
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    42   0.002
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    42   0.002
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    42   0.002
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.002
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    42   0.003
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    41   0.003
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    41   0.003
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    40   0.004
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    40   0.005
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.006
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    40   0.006
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    40   0.010
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    37   0.011
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.015
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    39   0.015
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    39   0.017
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    39   0.022
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    39   0.022
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    38   0.028
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    38   0.029
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    38   0.035
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    38   0.042
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    37   0.048
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    37   0.059
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    37   0.068
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    37   0.074
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    37   0.085
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    37   0.092
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    35   0.10 
AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON} S...    36   0.10 
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    36   0.11 
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    36   0.12 
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    36   0.12 
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    36   0.14 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    34   0.14 
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    36   0.15 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    34   0.15 
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    36   0.17 
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    36   0.18 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    35   0.20 
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    35   0.20 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    35   0.20 
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    35   0.21 
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    35   0.23 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    35   0.26 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    35   0.29 
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    35   0.29 
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    35   0.29 
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    35   0.30 
KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.3...    35   0.34 
ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic hom...    34   0.35 
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    35   0.35 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    34   0.54 
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    32   0.55 
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    34   0.55 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    34   0.60 
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    33   0.67 
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    33   0.86 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    32   0.93 
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    33   0.97 
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    33   0.98 
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    33   1.0  
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    33   1.1  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    33   1.2  
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    33   1.2  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.2  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.2  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    33   1.3  
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    31   1.4  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    33   1.5  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    33   1.6  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    33   1.6  
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    32   1.8  
Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON} (57301....    32   1.9  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    32   2.2  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    32   2.3  
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    32   2.4  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    32   2.8  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    30   2.9  
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    32   3.0  
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    32   3.0  
NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa] ...    32   3.1  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    32   3.4  
TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.4...    31   4.5  
Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {...    31   5.5  
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    31   5.9  
TBLA0C04650 Chr3 complement(1128825..1132646) [3822 bp, 1273 aa]...    31   6.0  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    31   6.8  
CAGL0K07392g Chr11 (731078..732421) [1344 bp, 447 aa] {ON} simil...    30   7.0  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    30   7.4  
KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} simila...    30   7.8  
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    30   8.5  
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    29   8.5  
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    30   8.9  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    30   9.2  

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/343 (80%), Positives = 276/343 (80%)

Query: 1   MSKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKG 60
           MSKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKG
Sbjct: 1   MSKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKG 60

Query: 61  LEECLECMKGGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYSEAI 120
           LEECLECMKGGAVKSEDVKVNIP                    MAGKDFELAIAKYSEAI
Sbjct: 61  LEECLECMKGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAI 120

Query: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
           EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA
Sbjct: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180

Query: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXXXXXX 240
           LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDAR                 
Sbjct: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGGAGG 240

Query: 241 XXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGTP 300
                          NNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGTP
Sbjct: 241 FDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGTP 300

Query: 301 NMDDLMSNPALRNMASSMFXXXXXXXXXXXXXXXEPKGEIDEK 343
           NMDDLMSNPALRNMASSMF               EPKGEIDEK
Sbjct: 301 NMDDLMSNPALRNMASSMFGGAGAPGADADAPGAEPKGEIDEK 343

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  348 bits (894), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 221/323 (68%), Gaps = 9/323 (2%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +KEVA++I+ YL  +V +KAV E+ +DS+NVAIDCI ESFEV++GD  +V       KGL
Sbjct: 5   NKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFG----GKGL 60

Query: 62  EECLECMKGGA-----VKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKY 116
            E L+   G +      ++E +KVNIP                    MA KDF+LAI KY
Sbjct: 61  VELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKY 120

Query: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176
           S+AIEVLPTNA+YYANRAAAHSS+K Y+EA+ DAE AI+ DP YSKGYSRLG+AK+A  +
Sbjct: 121 SDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQ 180

Query: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXX 236
            E+ALEAYKKV+D+EGDKA+D+MKRDYETAKKKVEQSL+LEK P+ +             
Sbjct: 181 AEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGAGGAGG 240

Query: 237 XXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSG 296
                              NNPQ+MQAAQQMM NPQA+ QM+SMMQ+P +RQMAE F  G
Sbjct: 241 SGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMAENFAQG 300

Query: 297 NGTPNMDDLMSNPALRNMASSMF 319
           NG PNM DLM+NPALR+MA S+F
Sbjct: 301 NGMPNMGDLMNNPALRDMAGSLF 323

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  339 bits (870), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 177/323 (54%), Positives = 214/323 (66%), Gaps = 8/323 (2%)

Query: 4   EVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGLEE 63
           E+A++I+ Y   +V +K V ED  DS+NVA+DCI+E+F  ER  V S+L +S   KG   
Sbjct: 7   EIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF-KGQSL 65

Query: 64  CLECM-------KGGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKY 116
                        G    +++V+VNIP                    MA K++ELAI KY
Sbjct: 66  NNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYELAIKKY 125

Query: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176
           +EAI+VLPTNAIYYANRAAAHSSLK+YDEA+ DAE AI +DP+Y +GYSRLGFAKYAQ K
Sbjct: 126 TEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGK 185

Query: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXX 236
           PEEALEAYKKV+D+EGD ATD MKRDYE+AKK+VEQSLNLEKT   +             
Sbjct: 186 PEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGANAGQGAG 245

Query: 237 XXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSG 296
                              NNPQ+MQAAQ+MMSNP A+Q +Q+MMQDPSIRQMAE FTSG
Sbjct: 246 AGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAEGFTSG 305

Query: 297 NGTPNMDDLMSNPALRNMASSMF 319
            GTPN+ DLM NPALRNMA S+F
Sbjct: 306 GGTPNLSDLMKNPALRNMAGSLF 328

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  336 bits (862), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 174/323 (53%), Positives = 213/323 (65%), Gaps = 6/323 (1%)

Query: 3   KEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGI-SKGL 61
           +E+AA+I+ Y   +V +K + ED  DS+NVA+DCI+E+F  ER     +L +S    K L
Sbjct: 6   EEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEFKGKSL 65

Query: 62  EECLECMKGGAVKSE-----DVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKY 116
            + L      +  +E     +V+VNIP                    MA KD+ELAI KY
Sbjct: 66  ADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYELAINKY 125

Query: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176
           +EAI+VLPTNAIYYANRAAAHSSL++YDEAV DAE +I IDP+Y +GYSRLGFAKYAQ K
Sbjct: 126 TEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQGK 185

Query: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXX 236
           PEEALEAYKKV+D+EGD AT+ MKRDYE+AKKKVEQSLNLEK    +             
Sbjct: 186 PEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANASQGAG 245

Query: 237 XXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSG 296
                              NNPQ+MQAAQ+MMSNP A+Q +Q MMQDPSIRQMAE FTSG
Sbjct: 246 SSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAEGFTSG 305

Query: 297 NGTPNMDDLMSNPALRNMASSMF 319
            G PN+ DLM+NPALRNMA ++F
Sbjct: 306 GGAPNLSDLMNNPALRNMAGNLF 328

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  335 bits (858), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 213/322 (66%), Gaps = 6/322 (1%)

Query: 4   EVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGI-SKGLE 62
           E+AA+I+ Y   +V +K + ED  DS+NVA+DCI+E+F  ER  V  +L +S    + L 
Sbjct: 7   EIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEFKGQHLA 66

Query: 63  ECLECMK-----GGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYS 117
           + L              +E+V++NIP                    MA KD+ELAI KY+
Sbjct: 67  DILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYT 126

Query: 118 EAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP 177
           EAI+VLPTNAIYYANRAAAHSSLK+YD+AV DAE AI IDP+Y +GYSRLGFAKYAQ KP
Sbjct: 127 EAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKP 186

Query: 178 EEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXXX 237
           EEALEAYKKV+D+EGD AT+ MKRDYE+AKKKVEQSLNLEKT   +              
Sbjct: 187 EEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDASQGASA 246

Query: 238 XXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGN 297
                             NNPQ+MQAAQ+MMSNP A+Q +Q MMQDPSIRQMAE F SG 
Sbjct: 247 GGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAEGFASGG 306

Query: 298 GTPNMDDLMSNPALRNMASSMF 319
           GTPN+ DLM+NPALRNMA ++F
Sbjct: 307 GTPNLSDLMNNPALRNMAGNLF 328

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  332 bits (852), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 217/319 (68%), Gaps = 4/319 (1%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +KE+AA+I+ +L   V + AV EDY DS+NVAIDCI+E+FE ER  V  ++K S  ++ L
Sbjct: 5   NKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFDNRKL 64

Query: 62  EECLECMKGG-AVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYSEAI 120
           +E L+        +SE VKVNIP                    MA KDFE AI KY+EAI
Sbjct: 65  DELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAI 124

Query: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
           EVLP+NA+YYANRAAA+SSLK+Y+E+V DAE AI+++P+YSKGYSRLGFAKYA  KPEEA
Sbjct: 125 EVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEA 184

Query: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXXXXXX 240
           LEAYK V+D+EGDKATD+MKRDYETAK+KVEQSLNLEK+   +                 
Sbjct: 185 LEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGF 244

Query: 241 XXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGTP 300
                          NNPQ+M AAQ++M NP A   M  MM++P++RQMAE F+SG GTP
Sbjct: 245 PDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGA---MDEMMKNPAVRQMAENFSSGGGTP 301

Query: 301 NMDDLMSNPALRNMASSMF 319
           N+ DLMSNPA+++MA ++F
Sbjct: 302 NLGDLMSNPAIKDMAKNLF 320

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  332 bits (852), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/314 (52%), Positives = 214/314 (68%), Gaps = 5/314 (1%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +K+++++I+ YL  VV +K+V ED +DS+NVAI+CI E+F +E+G   +        K L
Sbjct: 5   NKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFG----GKNL 60

Query: 62  EECLECMKGG-AVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYSEAI 120
            E L    G  + + E+VKVNIP                    MAGKD+ELAI KYSEAI
Sbjct: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAI 120

Query: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
            V+PTNA+YYANRAAAHSSLK YDEA+ DAE A+++D +YSKGYSRLG+AK+AQ K EEA
Sbjct: 121 SVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA 180

Query: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXXXXXX 240
           LEAYKKV+D+EGD ATD+MKRDYETAK+KVEQ+L L KT +                   
Sbjct: 181 LEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGANPGGG 240

Query: 241 XXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGTP 300
                          NNPQ+MQAAQQMM NPQA+ QM++MMQ+P++RQMAE+F  GNGTP
Sbjct: 241 FDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAEKFAGGNGTP 300

Query: 301 NMDDLMSNPALRNM 314
           N++D+M+NPALR+M
Sbjct: 301 NLNDIMNNPALRDM 314

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  331 bits (849), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 177/324 (54%), Positives = 216/324 (66%), Gaps = 8/324 (2%)

Query: 4   EVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGI-SKGLE 62
           E+A++I+ Y   +V +K + ED  DS+NVA+DCI+E+F  ER  V S+L+ S    + L 
Sbjct: 7   EIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEFKGQNLT 66

Query: 63  ECLECMK--GGAVKSED---VKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYS 117
           + L        + K +D   V+VNIP                    MA KD+ELAI KY+
Sbjct: 67  DLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYELAINKYT 126

Query: 118 EAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP 177
           EAI+VLPTNAIYYANRAAAHSSLK YDEAV DAE AI IDP Y +GYSRLGFAKYAQ KP
Sbjct: 127 EAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKP 186

Query: 178 EEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKT-PD-ARXXXXXXXXXXXX 235
           EEALEAYKKV+D+EGD AT+ MKRDYE+AKKKVEQSLNLEKT P+ +R            
Sbjct: 187 EEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANADASQGA 246

Query: 236 XXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTS 295
                               NNPQ+MQAAQ+MMSNP A+Q +Q MMQDP+I+QMAE FTS
Sbjct: 247 GTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQMAEGFTS 306

Query: 296 GNGTPNMDDLMSNPALRNMASSMF 319
           G G PN+ DLM+NPALR+MA ++F
Sbjct: 307 GGGAPNLSDLMNNPALRSMAGNLF 330

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  315 bits (807), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 175/329 (53%), Positives = 213/329 (64%), Gaps = 16/329 (4%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +KE+AA+I+ YL  VV +K V  D  DS+NVA+DCIAE+FE ER  V   +K +    GL
Sbjct: 5   NKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFNGNGL 64

Query: 62  EECLECMKGGAVKSEDVKVNIPXXXXXXXXXXXXX--XXXXXXXMAGKDFELAIAKYSEA 119
              L    G A  + D++VNI                       MA KD+E AI KYSEA
Sbjct: 65  TSFLS---GSA--TNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEA 119

Query: 120 IEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEE 179
           IEVLPTNA+YYANRAAA+SSLK+YD+AV DAE AI+++P YSKGYSRLGFAK+AQ K E+
Sbjct: 120 IEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVED 179

Query: 180 ALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEK-TPDARXXXXXXXXXXXXXXX 238
           AL+AYKKV+D+EGDKATDIMKRDYETAKKKVEQSLNLEK TP                  
Sbjct: 180 ALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADAGTGAAGM 239

Query: 239 X--------XXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMA 290
                                     NPQIMQAAQQMM NP A+QQM+SMMQ+P++RQMA
Sbjct: 240 GGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQNPAVRQMA 299

Query: 291 EQFTSGNGTPNMDDLMSNPALRNMASSMF 319
           E F SG GTP++  +M+NP L++MA +MF
Sbjct: 300 ENFASGEGTPDLSAMMNNPDLKDMAKNMF 328

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  313 bits (802), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 165/319 (51%), Positives = 212/319 (66%), Gaps = 7/319 (2%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +K++A +I+ +L   V  K V EDY+DS+NVAIDCI E+FE +R  V + L+++   + L
Sbjct: 5   NKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFAGRSL 64

Query: 62  EECLECMK-GGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYSEAI 120
           ++ +E    G +   E VKVNIP                    MA KDFE A+ KYSEAI
Sbjct: 65  KQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAI 124

Query: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
           +VLPTNA+YYANRAAAHSSLK+Y+EAV DAE AI+++P+YSKGYSRLGFA+YA  KPEEA
Sbjct: 125 QVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEA 184

Query: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXXXXXX 240
           L+AYKKV+D+EG+ ATD MKRDY+TA KKV QSLN+EK+  A                  
Sbjct: 185 LDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPA---ATRDGAGSATGSGGL 241

Query: 241 XXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGTP 300
                          NNPQ+MQAAQQMM NP A   MQ +M +P+++QMAE+F SG GTP
Sbjct: 242 PDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNA---MQEVMNNPAVKQMAEKFQSGGGTP 298

Query: 301 NMDDLMSNPALRNMASSMF 319
           +M DLM+NPAL +MA +MF
Sbjct: 299 SMADLMNNPALMDMAKNMF 317

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  313 bits (801), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 169/327 (51%), Positives = 215/327 (65%), Gaps = 9/327 (2%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQS----GI 57
           +K++AA+II +L  VV +  V ED  DS+NVA+DCIAE+FE ER  V  V+K S     +
Sbjct: 5   NKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQGNSL 64

Query: 58  SKGLEECLECMKGGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYS 117
           S  L              E VKVN+                     MAGKD+ELAI KY+
Sbjct: 65  SSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAIKKYT 124

Query: 118 EAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP 177
           EAI  LPTNA+Y+ANRAAA+SSLK+YDEAV DA  AI+I+P YSKGYSRLGFAK+AQ K 
Sbjct: 125 EAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKA 184

Query: 178 EEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTP-----DARXXXXXXXXX 232
           E+ALEAYKKV+D+EGDKAT++MKRDYETAKKKVEQSLNLEK+       A          
Sbjct: 185 EDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSASAADP 244

Query: 233 XXXXXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQ 292
                                  NNPQ+MQAAQQMM +P+A++Q++SMMQ+PS++QMA+Q
Sbjct: 245 FAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSVKQMADQ 304

Query: 293 FTSGNGTPNMDDLMSNPALRNMASSMF 319
           F+SGNGTP+   LM++P++R+MA +MF
Sbjct: 305 FSSGNGTPDFSALMNDPSIRDMAKNMF 331

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  305 bits (781), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 166/329 (50%), Positives = 209/329 (63%), Gaps = 13/329 (3%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +KEV ++I+ +L  V+  K + ED  DS+NVAIDCI ESFE ER  V   L+     K L
Sbjct: 5   NKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFSGKTL 64

Query: 62  EECLECMKGGAV---KSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYSE 118
           +E L      +    K E VKVNIP                    MA KD+ LAI KYSE
Sbjct: 65  KEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSE 124

Query: 119 AIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPE 178
           AI+ LPTN IYYANRAAA+SS+K+YD A+ DAEKAIEIDPAYSKGYSRL FAKYA NKPE
Sbjct: 125 AIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPE 184

Query: 179 EALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEK----TPD----ARXXXXXXX 230
           EALE YKKV+D+EGDKAT  MKRD+E AK +VE S+NLEK    TP+    A        
Sbjct: 185 EALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQPANPF 244

Query: 231 XXXXXXXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMA 290
                                    NNPQ+MQAAQQMMS+P ++Q+MQ MMQ+P++R+MA
Sbjct: 245 AGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNPNLREMA 304

Query: 291 EQFTSGNGTPNMDDLMSNPALRNMASSMF 319
           +   SG+   N+DDLM+NP++++MA+++F
Sbjct: 305 QNLASGDA--NLDDLMNNPSVKDMANNLF 331

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  304 bits (778), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 167/322 (51%), Positives = 205/322 (63%), Gaps = 6/322 (1%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +KE++ +I+ YL  V  +  V ED  DS+NVAIDCI +SFE ER     ++K    +  L
Sbjct: 5   NKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFYNLSL 64

Query: 62  EECLECMKGGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXX----XXMAGKDFELAIAKYS 117
            E LE     + K E+V VN+P                        MA KDF+LAIAKYS
Sbjct: 65  PELLEVAMENSAK-ENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYS 123

Query: 118 EAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP 177
           EAI + P NAIYYANRAAA+SSLK +++A  DAE AI +DP YSKGYSRLGFAKYA NKP
Sbjct: 124 EAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKP 183

Query: 178 EEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXXX 237
           EEALEAYKKV+DLEGDKAT+IMKRDYETAKK+VEQSLNLEK                   
Sbjct: 184 EEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAANAAA 243

Query: 238 XXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGN 297
                             NNPQ+MQAAQQMMS+P A+ ++QSMMQ+PSIRQMAE F +GN
Sbjct: 244 GGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAENFQNGN 303

Query: 298 GTPNMDDLMSNPALRNMASSMF 319
            TP+   LM++P +++MA + F
Sbjct: 304 -TPDFSQLMNDPNIKDMAKNFF 324

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  296 bits (759), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 166/320 (51%), Positives = 211/320 (65%), Gaps = 6/320 (1%)

Query: 3   KEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGLE 62
           KE+A++II YL      K +GEDY+DS+NVAIDC+ E+FEVE+    SV+++S   + LE
Sbjct: 6   KELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFGGQSLE 65

Query: 63  ECLECMKGG--AVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYSEAI 120
           + +     G  A + E VKVNIP                    MA KDFE AI+KYSEAI
Sbjct: 66  QIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISKYSEAI 125

Query: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
             LP+NA+Y+ANRAAA+SSLK+Y EAV DAE AI+++P+YSKGYSRLGFA+YA  +PEEA
Sbjct: 126 RTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEA 185

Query: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKT-PDARXXXXXXXXXXXXXXXX 239
           L+AYKKV+D+EG  ATD MKRDY+TA KKVEQSLN+E++ P A                 
Sbjct: 186 LDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGSGFPDI 245

Query: 240 XXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGT 299
                            NPQ+MQAAQQMM NP A   MQ MM +P+I+QMA++F SG GT
Sbjct: 246 ASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNA---MQEMMSNPAIKQMADKFQSGGGT 302

Query: 300 PNMDDLMSNPALRNMASSMF 319
           P+M DLM+NPAL +MA +MF
Sbjct: 303 PSMADLMNNPALMDMAKNMF 322

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  295 bits (755), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 209/328 (63%), Gaps = 15/328 (4%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +KE+AA+I+ +L    +  +V EDY+DS+NVAIDCI E+F+ ER + DS++      K L
Sbjct: 5   NKEIAALIVDFLS--SSSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGKKL 62

Query: 62  EECLECM-KGGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYSEAI 120
            E L      G V  E VKV+IP                    MA K F+ AI KY+ AI
Sbjct: 63  PELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEKYTAAI 122

Query: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
           EV P+NA+YY+NRAAA+SSLKQY++AV DAE+AIE+DP YSKG+SRLGFAKYA NKPEEA
Sbjct: 123 EVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEA 182

Query: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTP---------DARXXXXXXXX 231
           L+AYKKV+D+EG+KATD+MKRDYETAKKKVE S+NLEK+          D          
Sbjct: 183 LDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKSATEGPGAG 242

Query: 232 XXXXXXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAE 291
                                   NNPQ+MQAA++MM NP     MQ MM +P+++QMA 
Sbjct: 243 AGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGL---MQDMMSNPAMKQMAN 299

Query: 292 QFTSGNGTPNMDDLMSNPALRNMASSMF 319
           QF+SG G P++  +M++P++R+MA +MF
Sbjct: 300 QFSSGGGMPDLSQMMNDPSIRDMAKNMF 327

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  295 bits (755), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 211/325 (64%), Gaps = 13/325 (4%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +K++A +++ +L   + +KAV  D  DS+NVAIDCI E+FE E+ DV S L      K L
Sbjct: 5   NKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFGGKSL 64

Query: 62  EECLECM---KGGAVKSEDVKVNIPXXXXXXXXXXXXXXXX----XXXXMAGKDFELAIA 114
            E L+     KG +   ED+KV+I                         MA KD+ LA+ 
Sbjct: 65  TELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYNLAVE 124

Query: 115 KYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQ 174
           KY+ AI+++PT A+YYANRAAA+SS ++YDEA+ DAE AI+++P +SKGYSRLGFAK+AQ
Sbjct: 125 KYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQ 184

Query: 175 NKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXX 234
            K +EALEAYKK ++++GDKATDIMKRDYETAKKKVEQSLN+EK+               
Sbjct: 185 GKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKS-----ATPSASASAS 239

Query: 235 XXXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFT 294
                                NNPQIMQAAQQMMSNP+A++QM+SMMQ+PSIRQMAE  +
Sbjct: 240 ASAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAENLS 299

Query: 295 SGNGTPNMDDLMSNPALRNMASSMF 319
           SG+ +  M D M+NPA+R MAS++F
Sbjct: 300 SGS-SEGMGDFMNNPAIREMASNLF 323

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  293 bits (749), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 212/323 (65%), Gaps = 9/323 (2%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +KEV+++II YL  VV++  V  D +DS+NVAIDC+ E F VE+  + + ++     K L
Sbjct: 5   NKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFNGKSL 64

Query: 62  EECLECMKGGA-----VKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKY 116
            E L+     A      K+E VK+NIP                    +A KD++LA+ KY
Sbjct: 65  TELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLAVEKY 124

Query: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176
           +EAI++LPTNA+Y+ANRAAA+++ + YDEAV DAE+AI++DPAYSKGYSRL +AKY Q  
Sbjct: 125 TEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQEN 184

Query: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXX 236
            EE+LEAYKKV+++EGD AT++ KR YETAKK+VE+SLNLEK+                 
Sbjct: 185 FEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTE---SAGGQTNPAA 241

Query: 237 XXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSG 296
                              NNPQ+MQAAQ MMSNP A++++QSMMQ+P+I+QMAEQF  G
Sbjct: 242 GGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAEQFKGG 301

Query: 297 NGTPNMDDLMSNPALRNMASSMF 319
           N TP+  ++M+NPA+RNMASS+F
Sbjct: 302 N-TPDFSEMMNNPAVRNMASSLF 323

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  282 bits (722), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 204/323 (63%), Gaps = 17/323 (5%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +KE+AA+I+++L    + K V E+Y+DS+NVAIDCIAE+FE+ER D + ++ ++   +GL
Sbjct: 5   NKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGRGL 62

Query: 62  EECLECMKGGAVK-----SEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKY 116
              ++ +K GA +     SE    N                       A KDFE A+ KY
Sbjct: 63  ---VDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKY 119

Query: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176
           +EAIE++P NA++Y NRAAA+SS K+++EAV DAE A+ I+P+YS+GYSRLG AKYA  K
Sbjct: 120 TEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGK 179

Query: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXX 236
           PEEA+EAYKKV+D+EGD AT+ MKRDYE+AKKKVE+SLNLE  P                
Sbjct: 180 PEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGE----EQQTSEGSS 235

Query: 237 XXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSG 296
                              NNPQ+MQAAQ+MM NP A   MQ MM +P+I+QMA+ F SG
Sbjct: 236 AGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSA---MQEMMNNPAIKQMAQNFASG 292

Query: 297 NGTPNMDDLMSNPALRNMASSMF 319
            GTPN+ D+M +P +++MA   F
Sbjct: 293 GGTPNLGDMMKDPNIKDMAGKFF 315

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  277 bits (708), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 152/335 (45%), Positives = 203/335 (60%), Gaps = 19/335 (5%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +K++ A+I+ +L  ++ +  V ED  DS+NVA+DCI+E+ E +R  V   +K     K L
Sbjct: 5   NKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFNGKTL 64

Query: 62  EECLECMKGGAV-----KSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKY 116
            + L             K E V+VNIP                    MA KDF LA+ KY
Sbjct: 65  VDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKY 124

Query: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176
           +EAI++LPTNAIYYANRAAAHSSLK+++EA+ DAE AI+IDP+YSKGYSRL FAKY   K
Sbjct: 125 TEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGK 184

Query: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLE--KTPDARXXXXXXXXXXX 234
            EEALE+YKKV+D+EGD AT  MKRDYETAKK+VE+S+N+E  KTP+             
Sbjct: 185 HEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQ 244

Query: 235 XXX----------XXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDP 284
                                          +NP  M  AQ++MS+P A+QQ+QSMM DP
Sbjct: 245 GNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQSMMSDP 304

Query: 285 SIRQMAEQFTSGNGTPNMDDLMSNPALRNMASSMF 319
           S+R +A  F +GN   +M+D+M+NPA+RNMAS++F
Sbjct: 305 SMRDLANNFKNGN--TDMNDIMNNPAIRNMASNLF 337

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  265 bits (678), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 202/329 (61%), Gaps = 20/329 (6%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61
           +K++AA+I+ +L    + K VGEDY DS+ VAIDCI E+FE+  G+ D+++ +    + L
Sbjct: 5   NKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGRSL 62

Query: 62  EECLECMKGGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYSEAIE 121
            + L         + + KV                       MA KD+E AI KY+ AIE
Sbjct: 63  SQLLTTGMAHTSDAGEPKV----AAEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIE 118

Query: 122 VLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEAL 181
           VLPT+A+YYANRAAA+SSL+QY++AV DAEKA ++D +YSKG+SRLG+AKYA  + EEAL
Sbjct: 119 VLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEAL 178

Query: 182 EAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXX----------- 230
           EAYK+V+D+EGD AT+ M+RDYE+AK+KVE+S+N+++  +                    
Sbjct: 179 EAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAAGSAGGSGLPDL 238

Query: 231 XXXXXXXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMA 290
                                    NNPQ+MQAAQ+MM NP A+Q+   MM +P+I++MA
Sbjct: 239 ASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQE---MMSNPAIKKMA 295

Query: 291 EQFTSGNGTPNMDDLMSNPALRNMASSMF 319
           E F SGNG+  + DLM++PA+RNMAS  F
Sbjct: 296 ENFASGNGSSGLGDLMADPAVRNMASKFF 324

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  179 bits (455), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 108/328 (32%), Positives = 174/328 (53%), Gaps = 23/328 (7%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEV----ERGDVDSVLKQSGI 57
           +K+  A+I+ YL  ++  K V ED  +S+NVAIDCI++ FE+    E   ++ V  +S +
Sbjct: 5   NKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFNKSDL 64

Query: 58  SK------GLEECLECMKGGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFEL 111
                   GL+   + ++   VK+E++                         M+ K+++ 
Sbjct: 65  KTITLKGLGLQNVSDVVEL-EVKNEEI-------SEDKKKEAEALKLEGNKQMSLKNYKS 116

Query: 112 AIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAK 171
           AI KYS+AIE+ P+N  YY+NRAAA+  ++ +  AV+DA  AI++DP YSK YSRLG AK
Sbjct: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAK 176

Query: 172 YAQNKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKT-PDARXXXXXXX 230
            A+   E+A+ A+KKV++LEGDK+T++MK DYE AKK V+  + L K  PD         
Sbjct: 177 LAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNT 236

Query: 231 XXXXXXXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMA 290
                                                  NP+ +QQ++ +MQ+P +RQ A
Sbjct: 237 TDVLTDIATVLGSSFGSLMNNTQM----MQRAQQMMQTQNPEMMQQVEGLMQNPVVRQFA 292

Query: 291 EQFTSGNGTPNMDDLMSNPALRNMASSM 318
           E   +GNG   + D+++NP+++ +A+ +
Sbjct: 293 ENVANGNGPGGLSDVLNNPSVKEVANGL 320

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  132 bits (333), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 104/367 (28%), Positives = 163/367 (44%), Gaps = 58/367 (15%)

Query: 3   KEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGLE 62
           +E+A++I+ Y    +    + +D +DS+NVAIDCIA+ F+V++  + ++LK +  S  L 
Sbjct: 6   QEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYRSNDLL 65

Query: 63  ECLECMKGGA-------------VKSEDV------------KVNIPXXXXXXXXXXXXXX 97
             L   K  A             V+++D              +N+P              
Sbjct: 66  TYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEETKETK 125

Query: 98  XXX-------------XXXMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYD 144
                              M  K +  AI  YS+AI++ PTN  YY NRA A+     +D
Sbjct: 126 VSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFD 185

Query: 145 EAVVDAEKAIEID----PAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDL-----EGDKA 195
            A++DA K+IEID    P   K Y RLG AKY     E +L A+K+++++     +GD+ 
Sbjct: 186 HAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEI 245

Query: 196 TDIMKRDYETAKKKVEQSLNLEKTPDA-RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 254
           T  M  DYE AK+KV++   ++ T    +                               
Sbjct: 246 TKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGNNLNII 305

Query: 255 XNNPQIMQAAQQMM-SNPQALQQMQSMMQDPSIRQMAEQFTSGNGTPNMDDLMSN-PALR 312
            +NP   +  +Q++ SNPQA QQ  ++M DP +RQM E   S        D MSN P L+
Sbjct: 306 MSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNS--------DSMSNIPILK 357

Query: 313 NMASSMF 319
           ++  S+ 
Sbjct: 358 DLFYSLL 364

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  127 bits (319), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 132/231 (57%), Gaps = 28/231 (12%)

Query: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVER-----GDVDSVLKQSG 56
           +KE+A+ I+ YL  ++    V EDY +S++VAI+CI +SF+++       D+ +VL  + 
Sbjct: 5   NKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL-LAN 63

Query: 57  ISKGLEECLECMKGGAVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKY 116
           ++   E  L   +   V  + +K+ +                     +  ++++ AI KY
Sbjct: 64  LNLEPEPKLSEKERELVNEQAIKLKL----------------EGNKAVERENYKDAIDKY 107

Query: 117 SEAIEVLPTNAI-----YYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAK 171
           + AI++L  N +     Y +N++ A +   +Y+EA  DA   I+IDP +SKGYSRL  AK
Sbjct: 108 TRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAK 167

Query: 172 YAQNKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDA 222
             QNK E+A+ AYK+V+DLEG+KATD MKRD+E  K+K E +LN     D+
Sbjct: 168 IGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHIDS 217

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  126 bits (317), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 95/329 (28%), Positives = 152/329 (46%), Gaps = 32/329 (9%)

Query: 4   EVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGLEE 63
           + A++II YL  +     + ED  +S+ VAI CI ESF ++   + + LK+  +   L+E
Sbjct: 7   QTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTLKTILQE 66

Query: 64  CLECMKGG-AVKSEDVKVNIPXXXXXXXXXXXXXXXXXXXXMAGKDFELAIAKYSEAIEV 122
            L  ++    + +E+ +                        M    +E AI KY+EAI+ 
Sbjct: 67  NLNTLEATQKIHNEEAEA---------------LKKEGNEAMIEGQYEEAIKKYTEAIQ- 110

Query: 123 LPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALE 182
              N  YY+NR+ A+S L +Y++AV DA  AI IDP++SK YSRLG+AK  Q+K E+ + 
Sbjct: 111 FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMT 170

Query: 183 AYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXXXXXXXXXXX 242
           AYK+ +DLEG  A+  +  DYE A+ K EQ   L+K  D+                    
Sbjct: 171 AYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEVTSEECPEKNNN 227

Query: 243 XXXXXXXXXXXXXNNPQIMQAAQQMMSNPQAL----------QQMQSMMQDPSIRQMAEQ 292
                        NN    +   +  +  QA             +  +M +P ++QM  Q
Sbjct: 228 QDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQMVFQ 287

Query: 293 FTSGN--GTPNMDDLMSNPALRNMASSMF 319
             + N   +  + D+++NP LR   S + 
Sbjct: 288 AINDNPDASRQVKDVLNNPLLRTTLSELM 316

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 64/90 (71%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KD+E AI  +S+AIEV  T N ++Y+NR+A ++SLK++ EA+ DAE+ ++I+P +SK
Sbjct: 15  FVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKINPTWSK 74

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           GY+RLG A       +EA  +YKK ++L+G
Sbjct: 75  GYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA S L  + EA+ D  KAIE DP + + Y R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRK 464

Query: 168 GFAKYA 173
             A+ A
Sbjct: 465 ATAQIA 470

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 66/132 (50%), Gaps = 20/132 (15%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAH-------SSLKQYDEAVVDAEKAIEIDP 158
            + F+ AIA Y  A   L  +  Y  NR+AA        ++LK  DEAV   EK  E+  
Sbjct: 269 ARQFDEAIAHYDAAWN-LHQDITYLNNRSAAEFEKGDAETALKTLDEAV---EKGREMRT 324

Query: 159 AY---SKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKR----DYETAKKKVE 211
            Y   +K ++R+G   +  N  ++A+E Y+K   L   +  +I+ +    + E  K++ E
Sbjct: 325 DYKLIAKSFARMGNVHHKTNNLKKAIEFYQK--SLTEHRTPEILTKLRNTEKELKKQEAE 382

Query: 212 QSLNLEKTPDAR 223
           + +N EK  +AR
Sbjct: 383 EYINPEKAEEAR 394

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/91 (43%), Positives = 63/91 (69%), Gaps = 1/91 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KDF  AI  +++AIEV PT N + Y+NR+AA++S KQ+ EA+ DA + ++I+P +SK
Sbjct: 16  FTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKINPTWSK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEGD 193
           GY+RLG A++     EEA + YK+ + L+ +
Sbjct: 76  GYNRLGAAEFGLGNLEEAEKNYKEALKLDNN 106

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 39/66 (59%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  YSE I+  P +A  Y+NRAAA S L  + EA+ D + AI+ DP + + Y R 
Sbjct: 404 DWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRK 463

Query: 168 GFAKYA 173
             A+ A
Sbjct: 464 ATAQIA 469

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 93/194 (47%), Gaps = 2/194 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
           M  +D++ AI  Y+ AI   P + IYY+NR+ A+  +  Y+ A+ DA   I ID  +SK 
Sbjct: 148 MFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKA 207

Query: 164 YSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDAR 223
           Y RL   K  Q++  +AL+ YKK ++L  D   + + R++E  K KV+  ++L +  +  
Sbjct: 208 YIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFEDLKLKVQTDISLREISNDH 267

Query: 224 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMM-SNPQALQQMQSMMQ 282
                                            NP + Q   +++ +NP A + +  ++ 
Sbjct: 268 SNNNYNENSYNSTKNSPDIGSILGDGFAALLS-NPMLQQMIFKIIQNNPDAAKNIGYVLA 326

Query: 283 DPSIRQMAEQFTSG 296
           +P+++ + + F +G
Sbjct: 327 NPAMKNLLQNFKNG 340

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 35/50 (70%)

Query: 3  KEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVL 52
          K+VA +I+ +LE V+++K + +D +DS+NVAIDCI + + +    + S L
Sbjct: 9  KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSL 58

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 75/112 (66%), Gaps = 3/112 (2%)

Query: 104 MAGKDFELAIAKYSEAIEVL-PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
            A KDFE AI  +++AIEV    N + Y+NR+A ++S KQ+++A+ DA++ + I+PA+SK
Sbjct: 14  FAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNINPAWSK 73

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLE--GDKATDIMKRDYETAKKKVEQ 212
           GY+R+G A +     +EA + YKK ++L+     A D +++ ++T + + +Q
Sbjct: 74  GYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQSRQQQ 125

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA S L  + EA+ D   AI  DP + + Y R 
Sbjct: 408 DWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYIRK 467

Query: 168 GFAKYA 173
             A+ A
Sbjct: 468 ATAQIA 473

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 67/129 (51%), Gaps = 14/129 (10%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIE----IDPAY- 160
            + F+ AI  YS+A E L  +  Y  NRAAA     +Y+ A+    +A+E    +   Y 
Sbjct: 272 ARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRELRADYK 330

Query: 161 --SKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKR----DYETAKKKVEQSL 214
             SK ++R+G + +  N+ ++A+E Y+K   L   +  +I+ +    + E  K++ E  +
Sbjct: 331 VISKSFARIGNSYHKLNELKKAIEFYQK--SLTEHRTPEILTKLRNCEKELKKQETEAYI 388

Query: 215 NLEKTPDAR 223
           + EK  +AR
Sbjct: 389 DPEKAEEAR 397

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
            A KDFE AI  + +AIEV    N + Y+NR+A ++S++++ EA+ DA++ + I P +SK
Sbjct: 15  FAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIKPDWSK 74

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEGDK--ATDIMKRDYETAKKKVEQ 212
           G++RLG A Y     +EA E+YKK ++L+     A D + +   T ++++EQ
Sbjct: 75  GHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQRMEQ 126

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA + L  + +A+ D + AI+ DP + + Y R 
Sbjct: 403 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRK 462

Query: 168 GFAKYA 173
             A+ A
Sbjct: 463 ATAQIA 468

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 65/128 (50%), Gaps = 14/128 (10%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIE----IDPAY-- 160
           + F+ AIA Y +A + L  +  Y  NRAAA      Y+ A+   EKA+E    +   Y  
Sbjct: 268 RQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRELRADYKV 326

Query: 161 -SKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKR----DYETAKKKVEQSLN 215
            +K ++RLG A Y     ++A+E Y+K   L   +  +++ +    + E  K++ E  ++
Sbjct: 327 IAKSFARLGNAHYKLADLKKAIEYYEK--SLTEHRTPEVLNKLRSLEKEQKKREAEAYID 384

Query: 216 LEKTPDAR 223
            EK  +AR
Sbjct: 385 PEKAEEAR 392

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 63/90 (70%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLP-TNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
            + K++E A+  +S+AIEV P  N + Y+NR+A ++SLK++ +A+ DA +  +I+P +SK
Sbjct: 16  FSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINPTWSK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           GY+R+G A Y     +EA ++YKK ++L+ 
Sbjct: 76  GYNRVGAAHYGLGDLDEAEKSYKKALELDA 105

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 52/99 (52%), Gaps = 10/99 (10%)

Query: 106 GKDF------ELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPA 159
           GKDF        A+  Y+E I   P +A  Y+NRAAA S L  + EA+ D EKA+E DP 
Sbjct: 399 GKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPN 458

Query: 160 YSKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDI 198
           + K Y R   A+ A  +   ALE     +D+   K T++
Sbjct: 459 FVKAYIRKATAQIAIKEYSSALE----TLDIARSKDTEL 493

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 62/90 (68%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KDFE A   +S+AIE   T N + Y+NR+A ++SLK++ EA+ DAE+ ++I+P +SK
Sbjct: 14  FVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKINPTWSK 73

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           GY+R+G A+Y     ++A + YKK ++++ 
Sbjct: 74  GYNRVGAAQYGLGNLDDAEKEYKKALEIDS 103

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A++ Y+E I+  P +A  Y+NRAA  + L  + +A+ D + AI  DP + + Y R 
Sbjct: 416 DWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRK 475

Query: 168 GFAKYAQNKPEEALEAYK--KVMDLEGDKATD 197
             A+ A  +   A+E     +  DLE +K  +
Sbjct: 476 ASAQIAVREFAPAMETLDAARAKDLEINKGAN 507

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
            A KDF  AI  ++EAI    T N + Y+NR+A ++SLKQ+ EA+ DA++ ++I+P +SK
Sbjct: 15  FASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCVKINPDWSK 74

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEGD 193
           GY+R+G A       ++A   YKK ++L+ +
Sbjct: 75  GYNRMGAAHLGLGDLDDAESNYKKALELDSN 105

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 53/98 (54%), Gaps = 5/98 (5%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA + L  + EA+ D EKAIE DP + + Y R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPNFVRAYLRK 464

Query: 168 GFAKYAQN---KPEEALEAYKKVMDL--EGDKATDIMK 200
             A+ A     K  E LE  KK  D    G  + +IMK
Sbjct: 465 ATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMK 502

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 20/129 (15%)

Query: 109 FELAIAKYSEAIEVLPTNAIYYANRAAAH-------SSLKQYDEAVVDAEKAIEIDPAY- 160
           F+ AIA+Y++A + L  +  Y  NR+AA        +++   +EAV   E+  E+   Y 
Sbjct: 272 FDEAIAEYNKAWD-LHKDITYLNNRSAAEFEKGDFETAMNTLNEAV---EQGRELRADYK 327

Query: 161 --SKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKR----DYETAKKKVEQSL 214
             +K ++R+G A   Q   ++A+E Y+K   L   +  DI+ +    + E  K+++E+ +
Sbjct: 328 LIAKSFARMGNAYSKQKNLKKAIEYYQK--SLTEHRTADILTKLRTCEKELKKQEIEEYI 385

Query: 215 NLEKTPDAR 223
           N EK  +AR
Sbjct: 386 NPEKAEEAR 394

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 61/90 (67%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KD++ AI  +++AIEV  T N + Y+NR+A ++SLK++ +A+ DA++ I I+P++SK
Sbjct: 16  FTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININPSWSK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           GY+RLG A       +EA   YKK ++L+ 
Sbjct: 76  GYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA + L  + EA+ D  KAIE DP + + Y R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 168 GFAKYAQNKPEEALE 182
             A+ A  +   ALE
Sbjct: 471 ATAQIAVQEYAAALE 485

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 10/127 (7%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAI----EIDPAY- 160
            + F+ AI  Y++A E L  +  Y  NRAAA     +Y  A+     A+    E+   Y 
Sbjct: 275 ARQFDEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGREMRADYK 333

Query: 161 --SKGYSRLGFAKYAQNKPEEALEAYKKVM--DLEGDKATDIMKRDYETAKKKVEQSLNL 216
             S+ ++R+G A +     ++ +E Y+K +      D  T +   + E  K + E  +N 
Sbjct: 334 VISRSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKKAEAEAYINP 393

Query: 217 EKTPDAR 223
           EK  +AR
Sbjct: 394 EKAEEAR 400

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 65/93 (69%), Gaps = 1/93 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KD++ AI  +++AIEV  T N + Y+NR+AA++S KQY++A+ DA++ I+I+P+++K
Sbjct: 16  FVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKINPSWAK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKA 195
           GY+R G A    +K EEA + Y + + ++ + A
Sbjct: 76  GYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           D+  A+  Y+E I+  P +A  Y+NRAAA + L  + +A+ D  KAIE DP++ + Y R
Sbjct: 400 DWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLR 458

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 20/132 (15%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAH-------SSLKQYDEAVVDAEKAIEIDP 158
            + F+ AI+ Y++A E    +  Y  NR+AA        + +K   EAV   E A E+  
Sbjct: 264 ARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTEAV---ENARELRT 319

Query: 159 AY---SKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIM----KRDYETAKKKVE 211
            Y   +K ++R+G A    +  ++A+E Y+K   L   +  DI+    K + +  +++ E
Sbjct: 320 DYKIVAKSFARMGNAYAKLDDLKKAIEYYQK--SLTEHRTPDILSKLRKAEKDLKQQEAE 377

Query: 212 QSLNLEKTPDAR 223
             L+ EK  +AR
Sbjct: 378 AYLSPEKAEEAR 389

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 66/88 (75%), Gaps = 1/88 (1%)

Query: 106 GKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGY 164
            KD+  AI  +++AIEV  T N + Y+NR+A ++S K+++EA+ DAE+ ++I P++SKGY
Sbjct: 16  AKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISPSWSKGY 75

Query: 165 SRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           +R+G A++  ++ +EA ++YK+ ++L+ 
Sbjct: 76  NRVGAAQFGLSQLDEAEKSYKRALELDS 103

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E ++  P +A  ++NRAAA + L  + EA+ D  KA+ IDP + + Y R 
Sbjct: 395 DWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRK 454

Query: 168 GFAKYA 173
             A+ A
Sbjct: 455 ATAQIA 460

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 14/129 (10%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIE----IDPAY- 160
            + FE AI  Y++A E L  +  Y  NR+AA      YD A+     A+E    +   Y 
Sbjct: 259 ARQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRELRADYK 317

Query: 161 --SKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKR----DYETAKKKVEQSL 214
             +K ++R+G A Y      +A+E Y +   L   +  +++ +    + E  K + E  +
Sbjct: 318 TIAKSFARIGNAYYKLKDLRKAIEHYNR--SLTEHRTAEVLNKLRSTEKELKKAESEAYV 375

Query: 215 NLEKTPDAR 223
           N EK  +AR
Sbjct: 376 NPEKAEEAR 384

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 61/90 (67%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KD++ AI  +++AIEV  T N + Y+NR+A ++SLK++ +A+ DA + ++I+P++SK
Sbjct: 16  FTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINPSWSK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           GY+RLG A       +EA   YKK ++L+ 
Sbjct: 76  GYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA + L  + EA+ D  KAIE DP + + Y R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 168 GFAKYAQNKPEEALE 182
             A+ A  +   ALE
Sbjct: 471 ATAQIAVKEYASALE 485

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 60/127 (47%), Gaps = 10/127 (7%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAI----EIDPAY- 160
            + F+ AI  Y++A E L  +  Y  NRAAA     +Y+ A+     A+    E+   Y 
Sbjct: 275 ARQFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQGREMRADYK 333

Query: 161 --SKGYSRLGFAKYAQNKPEEALEAYKKVM--DLEGDKATDIMKRDYETAKKKVEQSLNL 216
             SK ++R+G A +     ++ +E Y+K +      D  T +   + E  K + E  +N 
Sbjct: 334 VISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKKAEAEAYVNP 393

Query: 217 EKTPDAR 223
           EK  +AR
Sbjct: 394 EKAEEAR 400

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 62/90 (68%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              K+++ AI K+++AIEV  T N + Y+NR+A ++S KQ+ + + DA + ++I+P +SK
Sbjct: 16  FVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKINPTWSK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           GY+R+G A +     +EA +AYKK ++L+ 
Sbjct: 76  GYNRVGAAHFGMGDLDEAEKAYKKALELDS 105

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 38/66 (57%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I   P++A  Y+NRAAA S L  + EA+ D   AIE DP + + Y R 
Sbjct: 404 DWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPNFIRAYIRK 463

Query: 168 GFAKYA 173
             A+ A
Sbjct: 464 ATAQIA 469

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 61/89 (68%), Gaps = 1/89 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KD+E A   +++AIE     N + Y+NR+A  +SLK+++EA+ DA + ++I+PA+SK
Sbjct: 14  FVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVKINPAWSK 73

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLE 191
           GY+R+G A +   K +EA + YKK ++++
Sbjct: 74  GYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E  +  P +A  Y+NRAAA + L  + EA+ D + AI  DP + + Y R 
Sbjct: 416 DWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRK 475

Query: 168 GFAKYA 173
             A+ A
Sbjct: 476 ATAQIA 481

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 61/90 (67%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KD++ AI  +S+AI+V    N + Y+NR+A ++SLK++  A+ DAE+ ++I+P++SK
Sbjct: 16  FVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKINPSWSK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           GY+R+G A +     +EA   YKK ++L+ 
Sbjct: 76  GYNRVGAAHFGMGDLDEAEAGYKKALELDA 105

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAA  S L  + EA+ D  KAIE DP + + Y R 
Sbjct: 412 DWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRK 471

Query: 168 GFAKYAQNKPEEALEA 183
             A+ A  +   ALE 
Sbjct: 472 ATAQIAVREFSSALET 487

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 22/133 (16%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAH-------SSLKQYDEAVVDAEKAIEIDP 158
            + F+ A+AKY+EA E    +  Y  NR+AA        +S+K  +EAV   EK  E+  
Sbjct: 276 ARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAV---EKGREMRA 331

Query: 159 AY---SKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKV----- 210
            Y   +K ++R+G      N  ++A++ YKK   L   +  +I+ +    A+K+V     
Sbjct: 332 DYKVIAKSFARMGNCYTKLNDLKKAIDFYKK--SLTEHRTPEILSK-LRAAEKQVKIQEA 388

Query: 211 EQSLNLEKTPDAR 223
           E  +N EK  +AR
Sbjct: 389 EDYINPEKAEEAR 401

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 62/89 (69%), Gaps = 1/89 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KD+E A   + +AI+V    N + Y+NR+A ++SLK++ E + DAE+ ++I+P +SK
Sbjct: 15  FVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKINPGWSK 74

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLE 191
           GY+R+G A++  N  E+A ++Y+K ++L+
Sbjct: 75  GYNRVGAAQFGLNNLEDAEKSYQKALELD 103

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (60%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA + L  + EA+ D ++AIE DP + + Y R 
Sbjct: 397 DWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPNFIRAYIRK 456

Query: 168 GFAKYA 173
             A+ A
Sbjct: 457 ASAQIA 462

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAI-EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KDF+ A+  ++ AI E    N + Y+NR+ A++SLK++DEA+ DA + ++I   +SK
Sbjct: 15  FVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIKADWSK 74

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           G++RLG A +     +EA E+YKK ++L+ 
Sbjct: 75  GHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 81/184 (44%), Gaps = 12/184 (6%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  YSE I   P +A  Y+NRAAA S L  + +A+ D +KAIEIDP++ + Y R 
Sbjct: 407 DWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRK 466

Query: 168 GFAKYAQNKPEEALEAYK--KVMDLEGDKATDIMKRD--YETAKKKVEQSLNLEKTPDAR 223
             A+ A  +   A+E     +  D E +  + I + D  Y  A ++  Q  N  ++P+  
Sbjct: 467 ATAQIAVQEYSAAIETLDVARTKDAEVNNGSSIREIDQLYVKATQQRFQPANTNESPE-- 524

Query: 224 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQD 283
                                            NP    A Q+ M NP+  ++MQ+++  
Sbjct: 525 ---ETYARAVKDPEVASILQDPVMQSILAQAQQNP---AALQEHMKNPEVFKKMQTLIAA 578

Query: 284 PSIR 287
             IR
Sbjct: 579 GIIR 582

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 69/131 (52%), Gaps = 20/131 (15%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAA-------HSSLKQYDEAVVDAEKAIEIDPA 159
           + F+ AIAKY EA   L  +  Y  NRAAA       +S++K  +EAV   E+  E+   
Sbjct: 272 RKFDEAIAKYEEAWN-LQKDITYLNNRAAAEYEKGDYNSAIKTLNEAV---EQGRELRAD 327

Query: 160 Y---SKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKR----DYETAKKKVEQ 212
           Y   +K ++RLG A Y  ++ ++A+E Y+K   L   +  D++ +    + E  K++ E 
Sbjct: 328 YKVIAKSFARLGNAYYKLDEVKKAVEYYEK--SLTEHRTPDVLNKLRNLEREIKKREAEA 385

Query: 213 SLNLEKTPDAR 223
            ++ EK   AR
Sbjct: 386 YIDPEKAEKAR 396

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              KD+  AI  +++AIEV    N + Y+NR+A ++SLK++ +A+ DA + ++I+P++SK
Sbjct: 16  FTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVKINPSWSK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           GY+RLG A       ++A   YKK ++L+ 
Sbjct: 76  GYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA + L  + EA+ D  KAIE DP + + Y R 
Sbjct: 408 DWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 467

Query: 168 GFAKYAQNKPEEALE 182
             A+ A  +   ALE
Sbjct: 468 ATAQIAVQEFAGALE 482

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 61/127 (48%), Gaps = 10/127 (7%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAV---VDA-EKAIEIDPAY- 160
            + FE AI  Y++A E L  +  Y  NRAAA      Y+ A+    DA E+  E+   Y 
Sbjct: 272 ARQFEEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGREMRADYK 330

Query: 161 --SKGYSRLGFAKYAQNKPEEALEAYKKVM--DLEGDKATDIMKRDYETAKKKVEQSLNL 216
             SK ++R+G A +     ++ ++ Y+K +      D  T +   + E  K + E  +N 
Sbjct: 331 VISKSFARIGNAYHKLGDLKKTIDNYQKSLTEHRTADILTKLRNAEKELKKAEAEAYINP 390

Query: 217 EKTPDAR 223
           EK  +AR
Sbjct: 391 EKAEEAR 397

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 62/91 (68%), Gaps = 1/91 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
              K+++ AI  +++AIEV  T + + ++NR+A ++SLK++ +A+ DA + ++I+P++SK
Sbjct: 16  FTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVKINPSWSK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEGD 193
           GY+RLG A       +EA   YKK ++L+ +
Sbjct: 76  GYNRLGAAHLGLGDLDEAESDYKKALELDAN 106

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (58%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA + L  + EA+ D  KAIE DP + + Y R+
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRM 470

Query: 168 GFAKYAQNKPEEALE 182
             A+ A  +   ALE
Sbjct: 471 AAAQIAVKEFAAALE 485

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 107 KDFELAIAKYSEAIEVLPTN-AIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYS 165
           K +E A+  ++ A+    TN  I Y+NRAAAH  LK Y EA+ D +  +E+ P + KGYS
Sbjct: 22  KGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAPNWDKGYS 81

Query: 166 RLGFAKYAQNKPEEALEAYKKVMDL 190
           R+G A     K +EA E +KK + L
Sbjct: 82  RVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYS 165
            +++  A+  Y+E I+  PT+ + + NRAA    L    + + D +KAI +DP+Y K Y 
Sbjct: 442 NREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPSYIKAYV 501

Query: 166 RLGFAKYAQNKPEEALEAY 184
           R GFA+  +   +EALE +
Sbjct: 502 RKGFAQITERDLDEALETW 520

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 61/90 (67%), Gaps = 1/90 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLP-TNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
            A KD+  AI  +++AIEV    N + ++NR+A ++S K + +A+ DA + ++I+P+++K
Sbjct: 14  FASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKINPSWAK 73

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEG 192
           GY+RLG A Y     +EA ++YKK ++L+ 
Sbjct: 74  GYNRLGAAHYGLGDLDEAEQSYKKALELDS 103

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (62%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           D+  A+  Y+E I+  P +A  Y+NRAAA S L  + +A+ D +KAIE DP + + Y R
Sbjct: 404 DWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVRAYIR 462

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 14/128 (10%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAI----EIDPAY-- 160
           + F+ AI KY+EA E    +  Y  NRAAA      Y+ A+    KA+    E+   Y  
Sbjct: 269 RKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKV 327

Query: 161 -SKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKRDYETAK----KKVEQSLN 215
            SK ++R+G + +     ++A++ Y+K   L   +  DI+ +   T K    K+ E  ++
Sbjct: 328 ISKSFARMGNSYHKLGDLKKAIDYYEK--SLTEHRTPDILTKLRNTEKELKQKEAESYMD 385

Query: 216 LEKTPDAR 223
            EK  +AR
Sbjct: 386 PEKAEEAR 393

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 63/91 (69%), Gaps = 1/91 (1%)

Query: 104 MAGKDFELAIAKYSEAIEVLPT-NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
            A K ++ A+  +++AIEV  T N + Y+NR+A+++S ++++EA+ DA +  +I+P+++K
Sbjct: 16  FAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKINPSWAK 75

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEGD 193
           GY+R G A +     ++A  +YKK ++L+ +
Sbjct: 76  GYTREGAAHFGMGNLDDAEASYKKALELDAN 106

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 39/66 (59%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+  A+  Y+E I+  P +A  Y+NRAAA S L  + +A+ D  KAIE DP + + Y R 
Sbjct: 400 DWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPNFVRAYIRK 459

Query: 168 GFAKYA 173
             A+ A
Sbjct: 460 ATAQIA 465

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 8/90 (8%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAI----EIDPAY- 160
            ++F+ AIA Y++A E L  N  Y  NR+AA     +YD A+    +AI    E+   Y 
Sbjct: 264 ARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKGREMRADYK 322

Query: 161 --SKGYSRLGFAKYAQNKPEEALEAYKKVM 188
             +K ++R+G A       +EA+  Y+K +
Sbjct: 323 IIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%)

Query: 104 MAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
           + GK+F  A   YS+AIE+  T +IY++NRA AH  L  +  A+ D  KAIE+DP   K 
Sbjct: 23  IKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPKNVKA 82

Query: 164 YSRLGFA 170
           Y R G +
Sbjct: 83  YHRRGLS 89

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 44/67 (65%)

Query: 104 MAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
           +A KD+  AI  Y++AIE+    +I+++NRA A+  L ++  A+ D+ KAIE+D +  KG
Sbjct: 20  VASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSSNVKG 79

Query: 164 YSRLGFA 170
           Y R G A
Sbjct: 80  YHRRGMA 86

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 49/107 (45%), Gaps = 9/107 (8%)

Query: 119 AIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPE 178
            + ++P  A+ Y ++     + K Y +A+    KAIE+D   S  +S    A    ++ +
Sbjct: 2   TLTIVP-EALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQ 60

Query: 179 EALEAYKKVMDLEGDKATDIMKR--------DYETAKKKVEQSLNLE 217
            ALE   K ++L+        +R        D+ +AK+ +E  L ++
Sbjct: 61  SALEDSSKAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVK 107

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K F  AI KY+EAI++  T +IY++NRA AH  +  +  A+ D ++AI++DP   K Y R
Sbjct: 26  KHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHR 85

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K F  AI KY+EAI++  T +IY++NRA AH  +  +  A+ D ++AI++DP   K Y R
Sbjct: 26  KHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHR 85

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 4/107 (3%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +DF+ A   Y++AIE  PT +I+Y+NRA A+  L  +  A+ D   AIE++ +  K Y R
Sbjct: 23  QDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSSNLKAYHR 82

Query: 167 LGFAKYAQNKPEEALEAYKKVMDLEGDKATDIM-KRDYETAKKKVEQ 212
            G A       + A   +  V+     K  DI+ K  ++T +K + +
Sbjct: 83  RGLANIGLLNFKSARNDFNIVLKY---KPNDIIAKNGFDTCEKVIRE 126

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 57/102 (55%), Gaps = 9/102 (8%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +DF  AI  Y++AI +  T +IY++NRA AH  L  +  ++ D ++A+++DP  +K Y R
Sbjct: 26  QDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPKNAKAYHR 85

Query: 167 LGFA-------KYAQNKPEEALEAYKKVMDLEGDKATDIMKR 201
            G +       K A+N  +  L+A  K  D    +A D+ ++
Sbjct: 86  RGLSYIGLLEFKKAKNDLQIVLKA--KPGDATASRALDVCEK 125

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 38/60 (63%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K F  AI KY+EAI++  T  IY++NRA +H  +  +  A+ D ++AI++DP   K Y R
Sbjct: 26  KHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHR 85

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +D+  AI KY +AIE+  T ++Y++NRA  H  L  +  A  D +KA+ +DP   K Y R
Sbjct: 23  QDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHR 82

Query: 167 LGFA 170
            G A
Sbjct: 83  RGLA 86

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D++ AI  YS+AI +  T +IY++NRA AH     +  AVVD + A+++DP   K Y R 
Sbjct: 27  DYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPKNIKAYHRR 86

Query: 168 GFA 170
           G +
Sbjct: 87  GLS 89

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +D+  AI  Y+EAI++  T +IY++NRA  H  +  +   + D +KA+EIDP   K Y R
Sbjct: 26  QDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPKNIKAYHR 85

Query: 167 LG 168
            G
Sbjct: 86  RG 87

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K F  AI KY++AI++  T +IY++NRA AH  +  +  A+ D ++A+++DP   K Y R
Sbjct: 26  KHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHR 85

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +D++ AI  Y++AIE+  T++I+Y+NRA AH  L  +  A+ D   AI++D    K Y R
Sbjct: 26  QDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNNNIKAYHR 85

Query: 167 LGFA 170
            G A
Sbjct: 86  RGLA 89

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD+  A+  Y+ AIE   T +I+++NRA A+  L ++  A+ D+ +AIE+D    K Y R
Sbjct: 52  KDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHR 111

Query: 167 LGFAK 171
            G A 
Sbjct: 112 RGLAH 116

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 112 AIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFA 170
           AI  YS+AIE+ PT +I+++NRA A   L  +   + D + A+ +DP   K Y R G +
Sbjct: 31  AIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPKNIKAYHRRGLS 89

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 52/100 (52%), Gaps = 5/100 (5%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPA-----YS 161
           K +  A+  Y++AIE+  T +I+++NRA A   L  +   + D   A+E+DP      + 
Sbjct: 27  KKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPKNIKAYHR 86

Query: 162 KGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKR 201
           +G S+LG   + + K + ++    K  D    +A D+ ++
Sbjct: 87  RGLSQLGLLHFKKAKNDLSIVLKAKPSDATAKRALDMCEK 126

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%), Gaps = 1/61 (1%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYS 165
            KDFE AI  Y+ AI  L  + ++Y+NR+AA+ S+  +++ V D   A+++ P YSK + 
Sbjct: 117 AKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWL 175

Query: 166 R 166
           R
Sbjct: 176 R 176

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +++  AI  Y++AIE+ P  +I+Y+NRA A   L  +  A  D  +A+ +D    K Y R
Sbjct: 26  QNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSKNVKAYHR 85

Query: 167 LGFA 170
            G A
Sbjct: 86  RGLA 89

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 53/100 (53%), Gaps = 5/100 (5%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +DF  A   Y++AIE+  T +I+++NRA AH     +  ++ D +KA+E+D    K Y R
Sbjct: 26  QDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSKNIKAYHR 85

Query: 167 LGFAKYAQNKPEEALEAYKKVM-----DLEGDKATDIMKR 201
            G +     + ++A    K V+     D+  D+A  I ++
Sbjct: 86  RGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 107 KDFELAIAKYSEAIEVL----PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
           K F  A   Y++ I+V       N   +ANRAA    LK Y   V D +KA+EI+P   K
Sbjct: 99  KRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAMEINPMNLK 158

Query: 163 GYSRLGFAKYAQNKPEEALEA 183
            + R+G A  A  K +EA +A
Sbjct: 159 CFYRMGKAFLALGKFKEAHDA 179

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K ++ A+  YS+AIE+  T +IY++NRA +   L  +  A  D +KAI +DP   K   R
Sbjct: 24  KKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPKNIKAIHR 83

Query: 167 LGFAKYAQNKPEEALEAYKKVMDLE 191
            G +          LE +K   DL 
Sbjct: 84  RGLSYVG------LLEFFKARKDLR 102

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%)

Query: 112 AIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFA 170
           A+  YS+AIE+  T +I+++NRA +   L  +  A+ D  K+IE+DP   K   R G +
Sbjct: 31  AVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPKNIKAIHRRGLS 89

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%)

Query: 127 AIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKK 186
           A+ + N+  A    K+Y EAV    KAIE+D   S  +S   F++   +    ALE   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 187 VMDLEGDKATDIMKR 201
            ++L+      I +R
Sbjct: 72  SIELDPKNIKAIHRR 86

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 14/94 (14%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYS 165
            KD+  AI  Y+ A++ L  + I+Y+N +A + SL Q D+ +  + KA+E++P YSK   
Sbjct: 135 AKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALL 193

Query: 166 RLGFAKYAQNKPEEALEAYK------KVMDLEGD 193
           R   A        E+LE Y        V+ L GD
Sbjct: 194 RRASAN-------ESLENYSDALFDLSVLSLNGD 220

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 107 KDFELAIAKYSEAIEVL----PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
           K F  A   Y++ IE+       N   +ANRAA    LK Y   + D + A+ ++P   K
Sbjct: 94  KRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCKHALTLNPKNIK 153

Query: 163 GYSRLGFAKYAQNKPEEALEA 183
            Y R+G A Y  N  EEA E+
Sbjct: 154 CYYRMGKAFYLLNNIEEAKES 174

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 55/121 (45%), Gaps = 15/121 (12%)

Query: 107 KDFELAIAKYSEAIE----VLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
           K F  A   Y++ IE    V   N   YANRAA    LK +   + D + A+  +P   K
Sbjct: 92  KRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTALTYNPKNIK 151

Query: 163 GYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKAT-----DIMK------RDYETAKKKVE 211
            Y R+G A  A NK E A E+ +    ++ D  +     +I+K      R YE  K K +
Sbjct: 152 CYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKEEEIRKYEEKKLKAQ 211

Query: 212 Q 212
           Q
Sbjct: 212 Q 212

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK---- 162
           KDFE AI  Y+ A+  L  + +YY+N +A +SSL  Y++ +  A KA+ + P YSK    
Sbjct: 109 KDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVR 167

Query: 163 ---GYSRLG 168
               Y +LG
Sbjct: 168 RANAYEKLG 176

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 61/120 (50%), Gaps = 12/120 (10%)

Query: 113 IAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKY 172
            A Y +A+++   NA  Y +R   +   +QY++A  D +KA E+DP     Y +L    Y
Sbjct: 360 FANYEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSY 419

Query: 173 AQNKPE--EAL--EAYKK------VMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDA 222
            +NK +  E L  EA +K      V +   +   D  K D++ A K+ E+++ LEK  DA
Sbjct: 420 RENKFDDCETLFSEARRKFPNSSEVPNFYAEILAD--KGDFDAALKEYERAIELEKKQDA 477

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 130 YANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKK--V 187
           Y N +A +  L++ D+A   + + I I+P   KGY R+G     Q K  EA + YKK  +
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGLL 133

Query: 188 MDLE---------GDKATDIMKRDYETAKKKV-EQSL 214
           M  E          +K  DI+K+  +  KK++  QSL
Sbjct: 134 MSREMLQKFDIVVPEKFRDIIKQQRDIVKKRINNQSL 170

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K FE A+  YS AIEV   + ++Y+NR+A + SL Q ++ V D   A+++ P YSK   R
Sbjct: 110 KQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLR 168

Query: 167 LGFAKYAQNKPEEA---LEAYKKVMDLEGDKATDIMKRD 202
              A  +  K  +A   L A     D  G     +++R+
Sbjct: 169 RASANESLGKFADAMFDLSAVSLYGDFNGSSIEPLLERN 207

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175
           + +A+E+ P  A  Y +R   H   +Q+++A  D EKA E++ +    Y +L    Y + 
Sbjct: 363 FEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREG 422

Query: 176 K 176
           K
Sbjct: 423 K 423

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 28/55 (50%)

Query: 126 NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
           N   YANRAA    LK Y   + D  KA+ I+P   K Y R   A +  NK EEA
Sbjct: 120 NESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 62/118 (52%), Gaps = 8/118 (6%)

Query: 107 KDFELAIAKYSEAIEV-LPTNAI---YYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
           K F  A   YS+ I+V    N I    YANRAA    +K Y   + D ++A++++P   K
Sbjct: 95  KRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQLNPKNIK 154

Query: 163 GYSRLGFAKYAQNKPEEALEA--YKKVMDLEGDKATDIMKRDYETAKKKVE-QSLNLE 217
            Y R+  A  A  + +EALE+  + + +D   +K+   +K   ET + ++E + L LE
Sbjct: 155 CYYRIAKAFTALERLDEALESIEFGEKID-NTNKSLKTLKLHIETKQLEIEARRLKLE 211

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%)

Query: 104 MAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
              K+F+ AI  Y  AIE+ P + ++Y+N +A + S    ++ V    KA+EI P +SK 
Sbjct: 136 FTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKA 195

Query: 164 YSR 166
             R
Sbjct: 196 LLR 198

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 45/91 (49%), Gaps = 14/91 (15%)

Query: 109 FELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLG 168
           FE AI  Y+ AIE L  N I+Y+N +A + SL + +E +    KA+E+ P YSK   R  
Sbjct: 127 FEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRA 185

Query: 169 FAKYAQNKPEEALEAYK------KVMDLEGD 193
            A        E LE Y        V+ L GD
Sbjct: 186 NAN-------EKLENYADAMFDLSVLSLNGD 209

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 20/104 (19%)

Query: 127 AIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPE-------- 178
           A+YY +RA  +   + + +A VD EKA E DP     Y +L    Y +NK +        
Sbjct: 390 AVYY-HRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDCETLFSE 448

Query: 179 ---------EALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQS 213
                    E    Y +V+  +GD   D   ++YETA++  E S
Sbjct: 449 AKRKFPTLPEVPNFYAEVLTDKGD--FDNAMKNYETARRLEEAS 490

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 14/93 (15%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD++ A+  Y+ A+ V+  + ++Y+N +A + SL Q D+ V ++ KA+E+ P YSK   R
Sbjct: 115 KDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLR 173

Query: 167 LGFAKYAQNKPEEALEAYK------KVMDLEGD 193
              A        E+LE Y        V+ L GD
Sbjct: 174 RASAN-------ESLENYADAMFDLSVLSLNGD 199

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           Y++AIE  P N I Y+NRA  +  L  +  ++ DA++AIE+D    K Y R
Sbjct: 36  YTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNNNLKAYHR 86

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 49/88 (55%), Gaps = 4/88 (4%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD++ A+  Y  A+  L  + ++Y+N +A + S+ Q D+ V ++ KA+E+ P YSK   R
Sbjct: 120 KDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLR 178

Query: 167 LGFAKYA-QNKPEEALEAYKKVMDLEGD 193
              A  + +N P+   +    V+ L GD
Sbjct: 179 RASANESLENYPDAMFDL--SVLSLNGD 204

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 1/56 (1%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
           KD+E AI  Y  A++ L  + ++Y+N AA + SL+   EA+    KA+E++P YSK
Sbjct: 100 KDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSK 154

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 109 FELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLG 168
           FE AI  Y  A++ L  + IYY+N +A ++SL QY++ +  A KA+++ P +SK   R  
Sbjct: 126 FEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRA 184

Query: 169 FA 170
            A
Sbjct: 185 LA 186

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K ++ AI  YS AIEV   + ++Y+NR+A + SL Q ++ V D   A+++ P YSK   R
Sbjct: 109 KKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLR 167

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 126 NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
           N   +AN+AA    LK Y   + D  KA+ I+P  +K Y R   A +  NK EEA
Sbjct: 120 NESLFANKAACELELKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 8/82 (9%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD+E A+  Y  A+ +L  + ++Y+N +A + SL + D+ +  + KA+E+ P YSK   R
Sbjct: 122 KDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLR 180

Query: 167 LGFAKYAQNKPEEALEAYKKVM 188
              A        E LE Y   M
Sbjct: 181 RATAN-------EQLENYSDAM 195

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%)

Query: 104 MAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
              K F  AI  Y  AIE+ P + ++Y+N +A + S    D+ V    KA+EI P +SK 
Sbjct: 142 FTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKA 201

Query: 164 YSR 166
             R
Sbjct: 202 LLR 204

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 107 KDFELAIAKYSEAIEVLPTNA----IYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
           K F  A   Y++ IEV   +A    +   NRAA    LK Y   + D  +A++++P   K
Sbjct: 91  KRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREALKLNPKNPK 150

Query: 163 GYSRLGFAKYAQNKPEEALEA 183
            + R+G A    +K EEA EA
Sbjct: 151 AFFRIGKAFLQLDKLEEAAEA 171

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 10/99 (10%)

Query: 116 YSEAIEVL----PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAK 171
           Y++ +EV       N   + NRAA    LK +   + D ++A+  +P   K + R+G A 
Sbjct: 103 YNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKEALRYNPKNVKCFYRMGRAF 162

Query: 172 YAQNKPEEALEAYKKVMDLEGDKAT------DIMKRDYE 204
           ++ NK EEA EA +  +  + + A        I+K+D E
Sbjct: 163 FSLNKLEEAKEAIEFGLRFDSNNAALGALLDKIVKKDEE 201

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 51/107 (47%), Gaps = 12/107 (11%)

Query: 124 PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLG--FAKYAQNKPEEAL 181
           P   I   NRAA+   +    +A++DA++ I++D    KGY R G    K AQ+K  EAL
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDK--EAL 124

Query: 182 EAY-------KKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEK-TP 220
             Y       K+   L  +K         E  K +V + LNL+K TP
Sbjct: 125 YVYREGLSKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQKLTP 171

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 126 NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
           N   +ANRAA    LK Y   + D  KA+ I+P   K Y R   A ++ +K EEA
Sbjct: 120 NESLFANRAACELELKNYRRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 116 YSEAIEV-LPTNAI---YYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAK 171
           Y++ IE+   +N I    ++NRAA    LK Y   V D  +A++ +P   K + R+  A 
Sbjct: 101 YNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCRQALQFNPTNIKCFYRIARAF 160

Query: 172 YAQNKPEEALEAYKKVMDLEGDKA 195
           +  +K E+A EA +  + L+ + A
Sbjct: 161 FLLDKCEDAKEAIEFGLKLDSESA 184

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 104 MAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
              K+F  AI  Y  AIE+ P   ++Y+N +A + S    ++ +    KA+EI P +SK 
Sbjct: 138 FTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKA 197

Query: 164 YSR 166
             R
Sbjct: 198 LLR 200

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%)

Query: 127 AIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKK 186
           A+   NR     + K ++EA+   + AIE+DP     YS +     +    E+ +E   K
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 187 VMDLEGDKATDIMKR 201
            ++++ D +  +++R
Sbjct: 187 ALEIKPDHSKALLRR 201

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%)

Query: 112 AIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEI 156
           AI+ Y+  I + P+N I Y+N+A A     ++DEA+   EK +++
Sbjct: 22  AISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQL 66

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 126 NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
           N   +ANRAA    LK Y + V D  KA+ I+P   K Y R+  + +   K EEA
Sbjct: 120 NESLFANRAACELELKNYRKCVEDCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 106 GKDFELAIAKYSEAIEV----LPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYS 161
            K F+ A   Y++ IE+       N   YANRAA    +K Y   + D + A++ +P   
Sbjct: 91  AKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKTALQYNPKNL 150

Query: 162 KGYSRLGFAKYAQNKPEEA 180
           K Y R+G A  A    EEA
Sbjct: 151 KCYYRMGKAFLALELLEEA 169

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 104 MAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
              KD E AI  Y  A+  L  + ++Y+N +A + ++ Q D+ +  + KA+E+ P YSK 
Sbjct: 169 FKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKA 227

Query: 164 YSRLGFAKYAQNKPEEALEAYKKVMDLEGD 193
             R   A  A    +EAL  +  ++ L G+
Sbjct: 228 LLRRANAYEALGNNKEALYDF-SILSLFGE 256

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 11/99 (11%)

Query: 124 PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEA 183
           P   +   NRAA    L + D A+ DA   I +D    KGY R G       + EEAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 184 YKKVMDLEGD-----------KATDIMKRDYETAKKKVE 211
           Y+  +   G+           K  DI+ R   T K+ ++
Sbjct: 127 YENGLKQAGEAEKTHAIHAPQKFLDIVYRQRSTIKELLQ 165

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 104 MAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
              K+F  AI  Y  AIE+ P + ++Y+N +A + S    ++ +    KA+EI P +SK 
Sbjct: 135 FTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKA 194

Query: 164 YSR 166
             R
Sbjct: 195 LLR 197

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K +E AI  YS A+  L  + ++Y+NR+A    L + ++ V D   A+E+ P YSK   R
Sbjct: 112 KKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175
           + +A+E+ P ++  Y +R   +   +Q++++  D +KA E +P     Y +L    Y +N
Sbjct: 365 FDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYREN 424

Query: 176 KPEEA 180
           K E+ 
Sbjct: 425 KFEDC 429

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 6/99 (6%)

Query: 107 KDFELAIAKYSEAIEVL----PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
           K F  A   Y++AI+V       N   YANRAA    LK Y   + D + A+ ++P   K
Sbjct: 88  KRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALSLNPKNIK 147

Query: 163 GYSRLGFAKYAQNKPEEALEA--YKKVMDLEGDKATDIM 199
            Y R+  A  A  K ++  EA  +    DLE     +++
Sbjct: 148 CYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKSLLNLL 186

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 107 KDFELAIAKYSEAIEVL----PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
           K ++ A   YS+ IEV       N   Y NRAA    L+ +   + D +KA+  +    K
Sbjct: 93  KRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKALNFNAKCVK 152

Query: 163 GYSRLGFAKYAQNKPEEA 180
            + R+G A +   K EEA
Sbjct: 153 AFYRMGQAYFKLKKLEEA 170

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K FE AI  Y+ AI+ L  + ++++N +A + SL   D+ V  + +A+E+ P YSK   R
Sbjct: 107 KRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLR 165

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175
           + +AI + P NA  Y +R   +   + Y++A  D +K+ E DP     Y +L    Y +N
Sbjct: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428

Query: 176 K 176
           K
Sbjct: 429 K 429

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 106 GKDFELAIAKYSEAIEVL----PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYS 161
            K F+ A   Y + IE+       N   +AN AA    +K +   +   +KA++ +P   
Sbjct: 91  AKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQKALQFNPKNM 150

Query: 162 KGYSRLGFAKYAQNKPEEALEAYK 185
           K Y R+  A Y  NK +EA E+ K
Sbjct: 151 KCYYRIAKAFYQLNKLDEAKESVK 174

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD E AI  + +A +V P  A  Y  +   HSS   +D A     KA+  DP +   Y  
Sbjct: 549 KDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYG 608

Query: 167 LGFAKYAQNKPEEALEAYKK 186
           LG +     + +EAL  ++K
Sbjct: 609 LGMSCMKLGQYDEALLHFEK 628

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 11/114 (9%)

Query: 116 YSEAIEVL----PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAK 171
           Y++ I+V       N   YANRAA    LK + + + D +KA+  +    K Y R+G A 
Sbjct: 97  YTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKALSFNVKNIKCYYRMGKAF 156

Query: 172 YAQNKPEEALEA--YKKVMDLEGDKATDIM----KRDYETAKKK-VEQSLNLEK 218
            + ++ +E+ E+  +   +D E     +++    KR  E  ++K +E  + LEK
Sbjct: 157 LSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEIQRRKDMEMKIKLEK 210

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175
           + +A+++ P N+  Y +R   +  L+ YD+A  D +KA E+DP     Y +L    Y +N
Sbjct: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 176 K 176
           K
Sbjct: 446 K 446

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
            K ++ AI  Y+ A+E L  + ++Y+N +A + S+    + V  + KA+EI P YSK
Sbjct: 112 NKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSK 167

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 18/58 (31%)

Query: 257 NPQIMQAAQQMM-SNPQALQQMQSM-----------------MQDPSIRQMAEQFTSG 296
           +PQ+MQ AQQ +  NP  +Q MQ+M                 MQDP++++MA+QF  G
Sbjct: 527 SPQMMQQAQQRLRQNPGMMQNMQNMFGGAGGGMPDMNEMMKMMQDPNMQKMAQQFGMG 584

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 130 YANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYK 185
           Y N +A +  L+  D+A   +++ I +DP   KGY  +G     QNK + A +AYK
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 11/84 (13%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167
           D+E AI  Y +A  +  +N IY++N A A   L+++ EAV           A  KG +++
Sbjct: 56  DYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAV----------NACDKGLNKV 105

Query: 168 GFAKYAQNKPEEALEAYKKVMDLE 191
            F     +K ++ LE ++++  L+
Sbjct: 106 SFKTGMDSKTKQKLE-WRRITALK 128

>AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR032W
           (CPR7)
          Length = 383

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 48/114 (42%), Gaps = 22/114 (19%)

Query: 107 KDFELAIAKYSEAI----EVLPTNAI--------------YYANRAAAHSSLKQYDEAVV 148
           KDF+ A  KY +++    E +P   I               Y N   A  ++  YD A+ 
Sbjct: 245 KDFQNAFFKYRKSLNYVNEYIPDVDIDAEQFEKFNVLKQKLYLNMTLALFNMGSYDSAIS 304

Query: 149 DAEKAIEIDPAYS----KGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDI 198
                +E+D   S    K Y R G    A+N  EEAL  YK+  +   D+A D+
Sbjct: 305 YTNYVLEMDRVPSMDLAKAYYRRGNCYLAKNLLEEALSNYKRCKEHNSDEAVDM 358

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K F+ AI  Y+ A+E L  + ++Y+NR+A + S+ Q ++ V D   A+++   YSK   R
Sbjct: 116 KKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLR 174

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 13/98 (13%)

Query: 130 YANRAAAHSSLKQYDEAVVDAEKAIEIDPA----YSKGYSRLGFAKYAQNKPEEALEAYK 185
           Y N   A  +LK YDE++      +E+D       +K Y R+G + +A+ + +EAL+ Y+
Sbjct: 289 YLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYR 348

Query: 186 KVMDLEGD---------KATDIMKRDYETAKKKVEQSL 214
              D   D         K  +I++++ E  KK + +  
Sbjct: 349 LCRDHNPDDNVIGQKIEKTENILEKEKERTKKNISKFF 386

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K  E AI  Y  A+E    + ++YAN +A + SL  +++ + +  KA+E+ P YSK   R
Sbjct: 120 KAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLR 178

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 126 NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP-EEALEAY 184
           N I + +    HS  K +DEA+    KAI++DP ++  Y+  G  +Y+ N   + A   +
Sbjct: 491 NPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQG-HEYSNNDAFDNAKSCF 549

Query: 185 KKVMDLE 191
           +K + +E
Sbjct: 550 RKALTIE 556

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYS 165
            KD + AI  + +AI++ P  A  Y  +   +S+   +D A     KA+ I+  +     
Sbjct: 505 NKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALY 564

Query: 166 RLGFAKYAQNKPEEALEAYKK 186
            LG       K EEAL  ++K
Sbjct: 565 GLGMCCVKLGKFEEALLFFEK 585

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEI 156
           D+E A+  Y +AI   P+N I Y+N A     L+++ EAV    K +++
Sbjct: 19  DYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLKM 67

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 57/120 (47%), Gaps = 13/120 (10%)

Query: 106 GKDFELAIAKYSEAIEV----LPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYS 161
           GK F+ A A Y +A++V    L  N   Y N AA    +K Y   +    +A++++    
Sbjct: 83  GKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALKLNAKNV 142

Query: 162 KGYSRLGFAKYAQNKPEEALEAYKKVMDLEGD---------KATDIMKRDYETAKKKVEQ 212
           K + R+G A     + E++LEA +  + ++ +         KAT+ +KR  E   + + Q
Sbjct: 143 KAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKLKRKKELENRTLAQ 202

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
           +++LAI +Y + I + PTNA+ Y+N A A+   +  DE    A+ A E+  +Y K
Sbjct: 50  EYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDE----AKTACEMGLSYCK 100

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%)

Query: 137 HSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180
           H    +YD A+    K I ++P  + GYS L  A      P+EA
Sbjct: 45  HFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEA 88

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD + AI  + +A ++ P  A  Y  +   HSS    D A     KA+  DP +   Y  
Sbjct: 559 KDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYG 618

Query: 167 LGFAKYAQNKPEEALEAYKK 186
           LG +     + EEAL  ++K
Sbjct: 619 LGTSSMKLGQYEEALLYFEK 638

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD + AI  + +A ++ P  A  Y  +   HSS    D A     KA+  DP +   Y  
Sbjct: 554 KDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYG 613

Query: 167 LGFAKYAQNKPEEALEAYKK 186
           LG +     + EEAL  ++K
Sbjct: 614 LGTSAMKLGQYEEALLYFEK 633

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 33/55 (60%)

Query: 137 HSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDLE 191
           H S   +D+ +   + A++I+P     ++RLG +    N+ EEA++AY K ++L+
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 61/135 (45%), Gaps = 31/135 (22%)

Query: 107 KDFELAIAKYSEAI----EVLPTNAI--------------YYANRAAAHSSLKQYDEAVV 148
           KDF+ A  KY +A+    E +P   +               Y N +    +LK+YD A+ 
Sbjct: 293 KDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAELKMKLYLNISLVLFNLKKYDSAIT 352

Query: 149 DAEKAIEID--PAY--SKGYSRLGFAKYAQNKPEEALEAYK---------KVMDLEGDKA 195
            A   +E++  P    +K Y R G    A+N+ EEAL+ YK         KV+D + +  
Sbjct: 353 HATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKDYKNCKENNPDDKVIDQKIESV 412

Query: 196 TDIMKRDYETAKKKV 210
            ++++   E  +K +
Sbjct: 413 ENLLEERKEKTRKNI 427

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 113 IAKYSEAIEVLP-TNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAK 171
           I K++   E LP  +A     R   + +   +D+ +   +++++I+P     ++RLG + 
Sbjct: 416 IKKFNRLAESLPEHDAKLELIRGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASL 475

Query: 172 YAQNKPEEALEAYKKVMDL 190
              NKPE+A++AY + ++L
Sbjct: 476 ANSNKPEDAIQAYHRALNL 494

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD + AI  + +A ++ P  A  Y  +   HSS    D A     KA+  DP +   Y  
Sbjct: 547 KDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYG 606

Query: 167 LGFAKYAQNKPEEALEAYKK 186
           LG +     + EEAL  ++K
Sbjct: 607 LGTSSMKLGQYEEALLYFEK 626

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%)

Query: 110 ELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGF 169
           E +I  +  AI +  TNA  Y +R   +   +QY++A +D +KA E+D +    Y +L  
Sbjct: 366 EESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLAC 425

Query: 170 AKYAQNK 176
             Y +NK
Sbjct: 426 LAYKENK 432

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +DFE A+  Y+ A+  L  + ++Y+N +A + SL Q ++ V  + +A+++   YSK   R
Sbjct: 119 QDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLR 177

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 36/80 (45%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +D + AI  + +A EV P  A  Y  +   HSS    D A     KAI  DP +   Y  
Sbjct: 523 RDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYYG 582

Query: 167 LGFAKYAQNKPEEALEAYKK 186
           LG       + EEAL  ++K
Sbjct: 583 LGMCCMKLGQYEEALLYFEK 602

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%)

Query: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176
           +E +E  P     + +    +S  + +DEA+   EKA E+DP ++ GY+  G    + + 
Sbjct: 499 NELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDS 558

Query: 177 PEEALEAYKKVM 188
            + A   Y+K +
Sbjct: 559 IDMAKTCYRKAI 570

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 126 NAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEA-- 183
           N + + N+AA    +K Y   + D +KA+  +P   K Y R+  A  A  K +E+ E+  
Sbjct: 111 NELLFVNKAACELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIE 170

Query: 184 YKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEK 218
           +   +D       +++K   +  ++K    L LE+
Sbjct: 171 FGLKVDSRNSSLLNLLKTIIKKQEEKTAYRLKLER 205

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 132 NRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAY 184
           NRAA+   L + D+A+ DA+  I ++P   K Y R G      NK +EA   Y
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 12/117 (10%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175
           + +A++V P +A  Y +R   H   +QY++A  D EKA E D +    Y +L    Y + 
Sbjct: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEG 425

Query: 176 KPE--EAL--EAYKK------VMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDA 222
           K +  E L  EA +K      V +   +  TD  K D++ A K+ + +  LE++ DA
Sbjct: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTD--KGDFDAASKQYDIAKRLEESLDA 480

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 109 FELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +E A+  Y+ A++ L  + ++Y+N +A + SL   ++ V  + KA+E+ P YSK   R
Sbjct: 115 YEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLR 171

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 35/61 (57%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175
           + +A+E+ P ++  Y +RA  +  ++Q+D+A  D +KA E DP+    Y +L    Y + 
Sbjct: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421

Query: 176 K 176
           K
Sbjct: 422 K 422

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 115 KYSEAIEV------LPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           +Y EAI+       L  + ++Y+NR+A +  L + ++ V D   A+++ P YSK   R
Sbjct: 110 RYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLR 167

>KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.395
           YPR088C gene spans a gap in the genome sequence
          Length = 537

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 21/63 (33%)

Query: 257 NPQIMQAAQQMM-SNPQALQQMQ--------------------SMMQDPSIRQMAEQFTS 295
           +PQ+MQ AQQ +  NP  ++ M                      MMQDP ++QMA+QF +
Sbjct: 474 SPQMMQQAQQRLKQNPGMMKNMMDMFGGANGGAGGMPNMNDMMKMMQDPKMQQMAQQFGA 533

Query: 296 GNG 298
           G G
Sbjct: 534 GMG 536

>ACR173W Chr3 (657718..658575) [858 bp, 285 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR088C
          Length = 285

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 49/107 (45%), Gaps = 15/107 (14%)

Query: 110 ELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDP-AYSKGYSRLG 168
           EL + K    +E  P +A  +   A  +  L Q+D+A+   E+ + I P AYS       
Sbjct: 142 ELWMKKLLSLLEKFPLDAELWWTLAMEYYKLGQFDQAIYCFEEVLLISPLAYS------A 195

Query: 169 FAKYAQNKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLN 215
           FA+ A+         Y K M  E   +TD+++   E A + VE S N
Sbjct: 196 FAQLAEV-------LYCKAMR-EKPVSTDVLQEALENALRAVELSSN 234

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 12/117 (10%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175
           + +A+++   N+  Y +R   +  L+ YD+A  D +KA E+DP     Y +L    Y +N
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 176 KPE--EAL--EAYKK------VMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDA 222
           K +  E L  EA +K      V +   +  TD  K D+E A K+ + ++ LE   D 
Sbjct: 446 KFDDCETLFSEAKRKFPEAPEVPNFFAEILTD--KNDFEKALKQYDLAIELENKLDG 500

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
            K ++ AI  Y+ A+E L  + ++Y+N +A + S+    + V  + KA+E+ P YSK
Sbjct: 112 NKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSK 167

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 109 FELAIAKYSEAIEVLPTNAIYYANRAAAHSSLK--QYDEAVVDAEKAIEIDPAYSKGYSR 166
           F+ A   Y +A+ + P +  Y A+     S +K  QYDEA++  EKA  I+P        
Sbjct: 488 FDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCC 545

Query: 167 LGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKR 201
            G A     + E+AL+ Y+   +L+ + +  + K+
Sbjct: 546 CGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 7/84 (8%)

Query: 109 FELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG-YSRL 167
           +++A   Y + +++ P N I Y+N+A A   L +Y E V    K +   P  +   Y +L
Sbjct: 19  YKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTPNTTDTVYKKL 78

Query: 168 GFAKYAQNKPEEALEAYKKVMDLE 191
            +      + E AL+  K V D E
Sbjct: 79  NY------RLEMALKNMKHVNDQE 96

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 17/88 (19%)

Query: 113 IAKYSEAIEVLP---------TNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
           I KY +    LP            ++YAN        +++ + +     A+E++P     
Sbjct: 401 ITKYLQVANALPQVDPEVQLGLGTLFYAN--------EEFGKTIDCFRTALEVNPNDELM 452

Query: 164 YSRLGFAKYAQNKPEEALEAYKKVMDLE 191
           ++RLG +    N+ EEA++AY K + L+
Sbjct: 453 WNRLGASLANSNRSEEAIQAYHKALALK 480

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 109 FELAIAKYSEAIEVLPTNAIYYANRAAAHSSLK--QYDEAVVDAEKAIEIDPAYSKGYSR 166
           F+ A   Y +A+ + P +  Y A+     S +K  QYDEA++  EKA  I+P        
Sbjct: 507 FDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCC 564

Query: 167 LGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKR 201
            G A     + E+AL+ Y+   +L+ + +  + K+
Sbjct: 565 CGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 22/101 (21%)

Query: 107 KDFELAIAKYSEAI----EVLP--------------TNAIYYANRAAAHSSLKQYDEAVV 148
           KDF+ A+ KY +A+    E +P                A  Y N +    +LK+Y+EA+ 
Sbjct: 256 KDFQNALFKYKKALRYVNEFIPEIEVDEAYNKKFIELKAKLYLNLSLVMFNLKRYEEAIT 315

Query: 149 DAEKAIEIDPAYS----KGYSRLGFAKYAQNKPEEALEAYK 185
                +EI  A S    K Y R G   +A+ + ++AL  +K
Sbjct: 316 YTTYLLEIPEASSIDKAKAYYRSGNCHFAKKRYDKALSDFK 356

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 108 DFELAIAKYSEAIEVLPTNA----IYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKG 163
           D++ A+++Y +++  LP       I Y+N  AA   + +Y ++V D + A+E+ P   K 
Sbjct: 561 DYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQ 620

Query: 164 YSRL 167
           +++ 
Sbjct: 621 WTQF 624

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 9/76 (11%)

Query: 143 YDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKRD 202
           Y  A+   EK IEI+P    GYS    A    NK +EA+   +       D    + K D
Sbjct: 19  YASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQ-------DGLKRVSKND 71

Query: 203 --YETAKKKVEQSLNL 216
             +ET +KK+E  L L
Sbjct: 72  ATHETIQKKLEYRLEL 87

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175
           + +A+++   N+  Y +R   +  L+ YD+A  D +KA E+DP     Y +L    Y +N
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 176 K 176
           K
Sbjct: 446 K 446

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 6/73 (8%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYS 165
            K ++ AI  Y+ A+E L  + ++Y+N +A + S+    + V  + KA+E+ P YSK   
Sbjct: 112 NKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLL 170

Query: 166 RL-----GFAKYA 173
           R      G  K+A
Sbjct: 171 RRASANEGLGKFA 183

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 16/83 (19%)

Query: 104 MAGKDFELAIAKYSEAIEVLPTN---------AIYYANRAAAHSSLKQYD-------EAV 147
           M  KDF+ AI  + E + ++P N         ++YY  ++ +HSS  + +       +++
Sbjct: 175 MNLKDFDRAIYCFEEILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVELRKEIVQKSM 234

Query: 148 VDAEKAIEIDPAYSKGYSRLGFA 170
            +A ++IE+   Y KG+S +   
Sbjct: 235 NNALRSIELSGLYLKGWSMVAIT 257

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%)

Query: 125 TNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEA 183
            N   ++NRAA    LK Y   V D ++A++ +    K Y R+  A    NK E+A +A
Sbjct: 114 VNESLFSNRAACELELKNYRRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDAKQA 172

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 128 IYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKV 187
           ++YAN         ++D  +   + A++++P     ++RLG +    N+ EEA++AY + 
Sbjct: 433 LFYAN--------DEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRA 484

Query: 188 MDLE 191
           + L+
Sbjct: 485 LQLK 488

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 143 YDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDLE 191
           +D+ +   E A++++P     ++RLG +    N+ EEA++AY + + L+
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 152 KAIEIDPAYSKG---YSRLGFAKYAQNKPEEALEAYKKVM 188
           K +E+DP + K    Y RLG     QNK ++ALE ++ ++
Sbjct: 194 KVLELDPHFEKANEIYFRLGIIYKHQNKWQQALECFRYIL 233

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 143 YDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDLE 191
           +D+ +   E A++++P     ++RLG +    N+ EEA++AY + + L+
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 143 YDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDLE 191
           +D+ +   E A++++P     ++RLG +    N+ EEA++AY + + L+
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 128 IYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKV 187
           ++Y+N         ++D+ +   + A+ I P     ++RLG +    ++PEEA++AY K 
Sbjct: 440 LFYSN--------NEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKA 491

Query: 188 MDLE 191
           + L+
Sbjct: 492 LQLK 495

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 7/76 (9%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAI-------EIDPAY 160
           +F  A   Y + I + P N I Y+NRA A   L+++ E +   ++ +       + +P  
Sbjct: 19  NFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLGKLEDNEKDEPIR 78

Query: 161 SKGYSRLGFAKYAQNK 176
            K   RL  A+ + NK
Sbjct: 79  KKLLYRLHLAQESLNK 94

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 143 YDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDLE 191
           +D+ +   E A+ ++P     ++RLG +    N+ EEA++AY + + L+
Sbjct: 473 FDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%)

Query: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175
           + +A+++   N+  Y +R   +  L+ YD+A  D +KA E+DP     Y +L    Y +N
Sbjct: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 176 K 176
           K
Sbjct: 446 K 446

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 106 GKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSK 162
            K ++ AI  Y+ A+E L  + ++Y+N +A + S+    + V  + KA+E+ P YSK
Sbjct: 112 NKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSK 167

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           K+   AI  + +A +V P  A  Y  +   ++S   +D A     KAI  DP +   Y  
Sbjct: 542 KNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYG 601

Query: 167 LGFAKYAQNKPEEALEAYKK 186
           LG       + EEAL  ++K
Sbjct: 602 LGMVSMKLGQYEEALLFFEK 621

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%)

Query: 132 NRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYK 185
           N +A +  L    +A+  A K +E+DP   K Y RLG     Q + ++A E YK
Sbjct: 78  NMSATYEKLGDLKKALSYATKMVEVDPYNLKCYIRLGKILQKQVRDKQAYETYK 131

>Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON}
           (57301..58476) [1176 nt, 392 aa]
          Length = 391

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 26/105 (24%)

Query: 107 KDFELAIAKYSEAI----------EVLPTNAIY--------YANRAAAHSSLKQYDEAV- 147
           KD++ A+ KY +++          EV   N I         Y N +  + +LK  D  + 
Sbjct: 252 KDYQNALLKYKKSLKYVNEFIPEMEVNKDNCILFTVLKMKLYLNISLVYFNLKDNDNCIT 311

Query: 148 -----VDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKV 187
                +D E   ++D A  K Y R G A +A+ + EEAL  YK  
Sbjct: 312 YTTYLLDMENVPDLDQA--KAYYRRGNAYFAKKRLEEALNDYKNC 354

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 8/63 (12%)

Query: 128 IYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKV 187
           ++Y+N         ++D+ +   + A+++ P     ++RLG +    N+ EEA++AY K 
Sbjct: 459 LFYSN--------NEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKA 510

Query: 188 MDL 190
           ++L
Sbjct: 511 LNL 513

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 143 YDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDLE 191
           YD+ V     A+ + P     ++RLG +    N+ EEA++AY+K + L+
Sbjct: 442 YDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLK 490

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD + AI  + +A ++ P  A  Y  +   HSS    D A     KA+  D  +   Y  
Sbjct: 565 KDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQHYNAYYG 624

Query: 167 LGFAKYAQNKPEEALEAYKK 186
           LG +     + EEAL  ++K
Sbjct: 625 LGTSSMKLGQYEEALLYFEK 644

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 143 YDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDL 190
           YD+ V     A+ + P     ++RLG +    N+ EEA++AY+K + L
Sbjct: 435 YDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 482

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 108 DFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEI 156
           ++E A+  Y  A    P+N ++ AN + A   L+++++A+   ++A+EI
Sbjct: 23  EYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALEI 71

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 17/86 (19%)

Query: 115 KYSEAIEVLP---------TNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYS 165
           +Y + I  LP            ++YAN         ++D+ +   + A+ + P     ++
Sbjct: 408 QYLKVINTLPEIDPDVQLGLGVLFYAN--------DEFDKTIDCFKAALHVRPNDECMWN 459

Query: 166 RLGFAKYAQNKPEEALEAYKKVMDLE 191
           RLG +    N+ EEA++AY + + L+
Sbjct: 460 RLGASLANSNRSEEAIQAYHRAIQLK 485

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 128 IYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKV 187
           ++YAN        + YD+ +   + A+ + P     ++RLG +    N+ EEA++AY + 
Sbjct: 431 LFYAN--------EDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRA 482

Query: 188 MDLE 191
           + L+
Sbjct: 483 LQLK 486

>NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa]
           {ON} Anc_3.395 YPR088C
          Length = 539

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 26/66 (39%)

Query: 257 NPQIMQAAQQMMS-NPQALQ-------------------------QMQSMMQDPSIRQMA 290
            PQ+MQ AQQ +S NP  ++                         +M  MMQDP +++MA
Sbjct: 472 TPQLMQQAQQKLSQNPNLMKNMMNMFGGAGGMPGMGGAGGMPDMNEMMKMMQDPGMQEMA 531

Query: 291 EQFTSG 296
           +QF  G
Sbjct: 532 KQFGMG 537

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 108 DFELAIAKYSEAIEVLPTNA----IYYANRAAAHSSLKQYDEAVVDAEKAIEIDP 158
           D+  A+ +Y +++  LP       I Y+N  A+   + Q+ ++VVDA++A+++ P
Sbjct: 377 DYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLP 431

>TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.456
           YJR032W
          Length = 396

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 63/135 (46%), Gaps = 26/135 (19%)

Query: 107 KDFELAIAKYSEAI----EVLP------TNAI--------YYANRAAAHSSLKQYDEAVV 148
           KDF+ ++ KY +++    E +P       N +         Y N +  + +LK YDE + 
Sbjct: 254 KDFKNSLFKYQKSLRYVNEFMPDMDMDKNNCLKFTTLKSKLYLNMSLNYYNLKMYDECMT 313

Query: 149 DAEKAIEIDPA----YSKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKRDYE 204
            A   +++D       +K Y R G +   + + E+AL +YK  +  E +    ++ +  E
Sbjct: 314 YANYLLDLDNIPDIDQAKAYYRRGNSYLMKKRYEDALASYK--LCKEKNPEDKVIDQKIE 371

Query: 205 TAKKKVEQSLNLEKT 219
           + K  +E   N+EKT
Sbjct: 372 SVKSLIEA--NIEKT 384

>Suva_16.417 Chr16 complement(718714..720333) [1620 bp, 539 aa] {ON}
           YPR088C (REAL)
          Length = 539

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 24/64 (37%)

Query: 257 NPQIMQAAQQMM-SNPQALQ-----------------------QMQSMMQDPSIRQMAEQ 292
           +PQ+MQ AQQ +  NP  +Q                       +M  MMQDP +++MA+Q
Sbjct: 476 SPQMMQQAQQKLKQNPGLMQNMMSMFGGSGMGGGMGGGMPDMNEMMKMMQDPQMQEMAKQ 535

Query: 293 FTSG 296
           F  G
Sbjct: 536 FGMG 539

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 112 AIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAK 171
           AI  Y  A+++ P +   +     A+  L  +  ++   +KA  + P   + +  LG   
Sbjct: 506 AIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACALKPLDKRMWQALGECY 565

Query: 172 YAQNKPEEALEAYKKVMDLEGDKATD--IMKR---------DYETAKKKVEQSLNLEKTP 220
           +  +  + AL+ YK+ + L      D  I+ +         D E  KK + Q+L++E+  
Sbjct: 566 FIVDNTDSALKCYKRALQLSDLALQDSIILYKLAILYEKMDDIENCKKMMIQTLDVEELT 625

Query: 221 DA 222
           D 
Sbjct: 626 DG 627

>TBLA0C04650 Chr3 complement(1128825..1132646) [3822 bp, 1273 aa] {ON}
            Anc_7.246 YER064C
          Length = 1273

 Score = 30.8 bits (68), Expect = 6.0,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 51/143 (35%), Gaps = 14/143 (9%)

Query: 174  QNKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARXXXXXXXXXX 233
            QN+P  A E    ++D   DK+    +++ ET +KK+E S N  K               
Sbjct: 1061 QNQPNNANETTSNIIDNNNDKS----QKNKETCEKKIENSNNESK------KSVDGLKML 1110

Query: 234  XXXXXXXXXXXXXXXXXXXXXXNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQF 293
                                    P+    ++Q+ + P+ +Q + +   D      + Q 
Sbjct: 1111 STISSLINEDDNAINDESKTSEKKPENNTDSEQVKTEPKGIQSLLTSNADLPTTAQSHQL 1170

Query: 294  TSGNGTPNMDDLMSNPALRNMAS 316
             S   TP    ++ NP   N A+
Sbjct: 1171 ISRPNTP----MILNPVPANFAT 1189

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 137 HSSL-KQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP-EEALEAYKKVM 188
           H SL K +DEA+    KA E+DP ++  Y+  G  +YA N+  + A   Y+K +
Sbjct: 503 HFSLQKDHDEAIKAFNKATELDPRFAYAYTLQG-HEYASNESFDTARTFYRKAL 555

>CAGL0K07392g Chr11 (731078..732421) [1344 bp, 447 aa] {ON} similar
           to uniprot|P20107 Saccharomyces cerevisiae YMR243c
           Zinc/cadmium resistance protein
          Length = 447

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 26  YLDSVNVAIDCIAESFEVERGDVDSVLKQSGISK 59
           Y+ S++V IDC A+ FE     +  + +Q GI+ 
Sbjct: 352 YIASIHVEIDCAADKFESSARKIRRIFRQHGINS 385

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 142 QYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDL 190
           ++D+ +   + A+ ++P     ++RLG +    N+ EEA++AY K + L
Sbjct: 411 EFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQL 459

>KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 632

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 51/100 (51%), Gaps = 13/100 (13%)

Query: 107 KDFELA-IAKYSEAIEVL-PTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGY 164
           K ++LA +A+Y+  +++  P      AN     SS +Q++++++   +A+ +D +Y+  +
Sbjct: 384 KPYKLAYLAQYAANVDIYRPETCCIIAN---YFSSKQQHEKSILYFRRALMLDKSYTHAW 440

Query: 165 SRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKRDYE 204
             +G           A+E Y+        +A+D+  RD++
Sbjct: 441 ILMGHEFIEMKNSHAAIECYR--------RASDVNPRDFQ 472

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%)

Query: 107 KDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166
           KD E AI  + +A ++ P  A  Y  +    SS   +D A     KAI  DP +   Y  
Sbjct: 565 KDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYG 624

Query: 167 LGFAKYAQNKPEEALEAYKK 186
           +G         +EAL  ++K
Sbjct: 625 MGIYSMKLGHYDEALLYFEK 644

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 28.9 bits (63), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 112 AIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIE-IDPAYSKGYSRLGF 169
           A+  Y + IEV P N I Y+N A +   L +Y EA+      ++ ++ A S+ Y +L +
Sbjct: 22  AVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKYVNDADSQVYKKLQY 80

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 152 KAIEIDPAYSKG---YSRLGFAKYAQNKPEEALEAYKKVM 188
           K +E+DP + K    Y RLG     Q K  +ALE +K ++
Sbjct: 164 KVLELDPGFEKANEIYFRLGIIYKHQGKWAQALECFKYIL 203

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 26/48 (54%)

Query: 141 KQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVM 188
           K +DEA+   +KA ++DP ++  Y+  G    + +  + A   Y+K +
Sbjct: 428 KDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKAL 475

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,343,359
Number of extensions: 891662
Number of successful extensions: 4038
Number of sequences better than 10.0: 220
Number of HSP's gapped: 3951
Number of HSP's successfully gapped: 320
Length of query: 343
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 233
Effective length of database: 40,868,139
Effective search space: 9522276387
Effective search space used: 9522276387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)