Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02717g6.19ON32532514550.0
TPHA0J003206.19ON34228310651e-145
Kpol_1037.246.19ON36628010491e-142
YOR006C (TSR3)6.19ON31327810341e-141
Smik_15.1756.19ON31227810311e-140
Suva_15.1816.19ON33627810221e-139
TDEL0G045006.19ON30128110121e-138
KNAG0M011506.19ON30728210121e-138
Skud_15.1676.19ON31227810041e-136
KLLA0D01111g6.19ON31427910011e-136
SAKL0E01144g6.19ON43023810071e-135
Ecym_30236.19ON3492419801e-132
ACR007W6.19ON3132929741e-132
ZYRO0C07832g6.19ON2812409561e-130
KLTH0C11264g6.19ON3462389281e-124
NCAS0H008106.19ON3232879191e-123
Kwal_56.224216.19ON3372829091e-122
NDAI0D007906.19ON4013069081e-120
KAFR0L003906.19ON3292668381e-111
TBLA0A072506.19ON3042807901e-104
KLLA0C04345g3.183ON47548669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02717g
         (325 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   565   0.0  
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   414   e-145
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   408   e-142
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   402   e-141
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   401   e-140
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   398   e-139
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   394   e-138
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   394   e-138
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   391   e-136
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   390   e-136
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   392   e-135
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   382   e-132
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   379   e-132
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   372   e-130
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   362   e-124
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   358   e-123
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   354   e-122
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   354   e-120
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   327   e-111
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   308   e-104
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    30   9.9  

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 277/325 (85%)

Query: 1   MAKGKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCD 60
           MAKGKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCD
Sbjct: 1   MAKGKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCD 60

Query: 61  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARL 120
           PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARL 120

Query: 121 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFS 180
           EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFS
Sbjct: 121 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFS 180

Query: 181 WGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR 240
           WGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR
Sbjct: 181 WGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR 240

Query: 241 GNSGLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNIIXXXXXXXXXXXXXXXXXXX 300
           GNSGLMPPSDS             DTTTRKNVRYDNLGNII                   
Sbjct: 241 GNSGLMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGNIIEDSEDDNNESDYSNEESSD 300

Query: 301 XXXXXXXXXXXXXXXXNRVGKLAIE 325
                           NRVGKLAIE
Sbjct: 301 EASDEDYEDEHVDEVVNRVGKLAIE 325

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  414 bits (1065), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 202/283 (71%), Positives = 226/283 (79%), Gaps = 11/283 (3%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGG-----SKDSSFPVKLAMWDFDH 58
            KGKNKS +      S GSNGHHTR NH+ MEMK+        SK++ FPVKLAMWDFDH
Sbjct: 2   AKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFDH 61

Query: 59  CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWA 118
           CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGK VVCPDD+E VE  GASVVECSWA
Sbjct: 62  CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWA 121

Query: 119 RLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSH 178
           RL+EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA ELL H
Sbjct: 122 RLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLEH 181

Query: 179 FSWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNT 238
           FSWGLGFLELNK+LLE YQ+CTDSES+KKVEE+WL++ID+EVQERK +++  D+W+ GNT
Sbjct: 182 FSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGNT 241

Query: 239 NRGNSGLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
           NR    L   SD              +  T + +RYDNLGN++
Sbjct: 242 NR---DLQDMSDD---EEFDSEQYYSEENTERKIRYDNLGNVL 278

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  408 bits (1049), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 224/280 (80%), Gaps = 3/280 (1%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGG--SKDSSFPVKLAMWDFDHCDP 61
            KGKNK H+      S GSNGH ++ NH+HMEMK  G   S+D  FPVKLAMWDFDHCDP
Sbjct: 2   AKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCDP 61

Query: 62  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLE 121
           KRCSGK+LERLGLIKSLRVGQKFQG+VVSPNGK V+CP+DREIVE  GASVVECSWARL+
Sbjct: 62  KRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARLD 121

Query: 122 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSW 181
           EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A ELLS+FSW
Sbjct: 122 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFSW 181

Query: 182 GLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRG 241
           GLGFLE+N++LL+ YQQCTDSES+KK EE+WL +I+QE+QERK +A+  D+WMMGNTNR 
Sbjct: 182 GLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNRN 241

Query: 242 NSGLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
            +G     +              +    K+ RYDNLGNII
Sbjct: 242 MNG-DDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII 280

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 198/278 (71%), Positives = 220/278 (79%), Gaps = 5/278 (1%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63
           GKGKNK H+        G+NGH +R+NHR MEMKY   S+   FPVKLAMWDFDHCDPKR
Sbjct: 2   GKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKY-DNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNGK VVCPDD EIVE HGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A ELLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243
           GFLELNK+LLE YQQCTD +S+K+ EE+WLQ++++E QERK +A+ ED+WMMGN NR  +
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRGN 240

Query: 244 GLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
           G    S S                  + + YD+LGN I
Sbjct: 241 G----SQSDTSESEENSEQSDLEGNNQCIEYDSLGNAI 274

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  401 bits (1031), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 197/278 (70%), Positives = 220/278 (79%), Gaps = 5/278 (1%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63
           GKGKNK+H+        G+NGH +R+NHR MEMKY   S    FPVKLAMWDFDHCDPKR
Sbjct: 2   GKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKY-ENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNGK VVCPDD E+VE HGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A ELLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243
           GFLELNK+LLE YQQCTD++S+K+ EE+WLQ++++E QERK +A+ ED+WMMGN NR   
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRGG 240

Query: 244 GLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
           G      S                 ++ V YD+LGN I
Sbjct: 241 GW----QSDESESGGSSGESESEGDKQCVEYDSLGNAI 274

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 192/278 (69%), Positives = 225/278 (80%), Gaps = 5/278 (1%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63
           GKGKNK+H+        G+NGH +R+NH+ MEMKY   S+ ++FPVKLAMWDFDHCDPKR
Sbjct: 26  GKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY-DNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123
           CSGKKLERLGLIKSLRVGQKFQGIVVSPNG  VVCPDD E+VE HGASVVECSWARLEEV
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183
           PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A  LLSHFSWGL
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243
           GFL+LN++LLE YQ+CTDS S+KK EE+WLQ++++E QERK +++ ED+WMMGN NR ++
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKDN 264

Query: 244 GLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
           G    + S               + ++++ YD+LGN I
Sbjct: 265 G----AQSDESESEEDSDQSELESDKQSIEYDSLGNAI 298

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  394 bits (1012), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/281 (69%), Positives = 222/281 (79%), Gaps = 6/281 (2%)

Query: 1   MAKGKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCD 60
           M+KGK KN+    G S K  GSNGH +R+NH+ MEMK   G++D+ FPVKLAMWDFDHCD
Sbjct: 1   MSKGKNKNREAKNGHSGK--GSNGHSSRQNHKRMEMKR--GTEDTKFPVKLAMWDFDHCD 56

Query: 61  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARL 120
           PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG  VVCPDD+ IVE HGASVVECSWARL
Sbjct: 57  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARL 116

Query: 121 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFS 180
           +EVPFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D A ELLSHFS
Sbjct: 117 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFS 176

Query: 181 WGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR 240
           WGLGFLELN++LLE YQQCTD++S+K  E  WL +I +EV+ERK +A+ ED+WM GN NR
Sbjct: 177 WGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNR 236

Query: 241 GNSGLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
             +  +   D+             +    K +RYD LGN+I
Sbjct: 237 KGTTFL--DDNEEEESSEVEESDEEEDNGKTLRYDRLGNLI 275

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  394 bits (1012), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/282 (68%), Positives = 221/282 (78%), Gaps = 11/282 (3%)

Query: 1   MAKGKGKNKSH-DEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHC 59
           MAKGKGKNKS  DE       GSNGH +R NH+ ME++   G K + FPVK+AMWDFDHC
Sbjct: 1   MAKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHC 60

Query: 60  DPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWAR 119
           DPKRCSGKKLERLGLI SL+VGQKFQGIVVSPNG+ VVCPDDR IVE  GASVVECSWAR
Sbjct: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120

Query: 120 LEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHF 179
           L+EVPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA +LLS+F
Sbjct: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180

Query: 180 SWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTN 239
           SWGLGFLELNK+LLE YQ+CTD ES+KK EEDWL +I++E Q+RK +A+  D+WMMGN N
Sbjct: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240

Query: 240 RGNSGLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
           R  + +                   + T   ++RYDNLGN I
Sbjct: 241 RNMNKM----------TLSDEESDEEETEASSIRYDNLGNAI 272

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  391 bits (1004), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 187/278 (67%), Positives = 219/278 (78%), Gaps = 5/278 (1%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63
           GKGKNK+H+     +  G+NGH  R+NH+HMEMKY   S+   FPVKLAMWDFDHCDPKR
Sbjct: 2   GKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKY-DKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123
           CSGKKLERLGLI+SLRVGQKFQG+VVSPNG+ VVCP+D EIVE HGASVVECSWARLEEV
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183
           PFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+ D A ELLSHFSWGL
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243
           GFL+LNK+LLE YQ+CTD++S+KK E++WL++++ E QERK   +  D+WMMGN NR  +
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRRGN 240

Query: 244 GLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
           G+     S                + + + YD LGN I
Sbjct: 241 GVQ----SDELESGEDSEQSGLENSEQPIEYDALGNAI 274

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  390 bits (1001), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 194/279 (69%), Positives = 223/279 (79%), Gaps = 7/279 (2%)

Query: 4   GKGKNK-SHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPK 62
           GKGKNK S    RS K  GSNGH +R NH+ MEMK+   S  S FPVKLAMWDFDHCDPK
Sbjct: 2   GKGKNKESSTRPRSQK--GSNGHSSRLNHKRMEMKHVD-STTSKFPVKLAMWDFDHCDPK 58

Query: 63  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEE 122
           RCSGKKLERLGLIKSLRVGQKFQG+VVSPNGK+VVCPDD+ +VE +GASVVECSWARL+E
Sbjct: 59  RCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDE 118

Query: 123 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWG 182
           VPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA +LLS+FSWG
Sbjct: 119 VPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWG 178

Query: 183 LGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGN 242
             FLELNK+LL+ YQQCTD +S+K  EE WLQ+I+QE  ERK +A+TED+WM+GN NR +
Sbjct: 179 PAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRAS 238

Query: 243 SGLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
             L   S               D    ++++YD+LGN+I
Sbjct: 239 RDLPGSSGEEEEEDYLNGDSLIDV---RDIKYDSLGNVI 274

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  392 bits (1007), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 185/238 (77%), Positives = 209/238 (87%), Gaps = 1/238 (0%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCG-GSKDSSFPVKLAMWDFDHCDPK 62
           GKGKNK+H+E  S    G+NGH +R NH+ MEMK  G  S  + FPVKLAMWDFDHCDPK
Sbjct: 2   GKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDPK 61

Query: 63  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEE 122
           RCSGKKLERLGLIKSLRVGQKFQGIVVSPNG+ VVCP+DR IVE HGASVVECSWARL+E
Sbjct: 62  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLDE 121

Query: 123 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWG 182
           VPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA ELLS+FSWG
Sbjct: 122 VPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSWG 181

Query: 183 LGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR 240
           LGFLELNK+LLE YQQCTD++S+K  EE WL++I++E Q+RK +++ ED+WMMGN NR
Sbjct: 182 LGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNR 239

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  382 bits (980), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 201/241 (83%), Gaps = 3/241 (1%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63
           GKG+NK +D+  S K  GSNGH +R NHR +E KY    + S FPV LAMWDFDHCDPKR
Sbjct: 2   GKGRNKDYDKNHSQK--GSNGHSSRTNHRRIETKY-NAIQGSKFPVTLAMWDFDHCDPKR 58

Query: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123
           CSGKKLERLGLIKSLRV QKFQGIVVSPNGK+VVCP+DREI E +G SVVECSWARLEE+
Sbjct: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118

Query: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183
           PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA  LLSHFSWGL
Sbjct: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178

Query: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243
           GFLELNK++LE YQ+CTD +SIK  EE WL+QI+ E  ER+ + +  D+WMMGN NR N+
Sbjct: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNA 238

Query: 244 G 244
            
Sbjct: 239 S 239

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  379 bits (974), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 183/292 (62%), Positives = 222/292 (76%), Gaps = 16/292 (5%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63
            KGKNK  +E R   + GS+ H+ + N R  E+K+ G +K++ FP KLAMWDFDHCDPKR
Sbjct: 2   AKGKNKKTEE-RQKPAKGSSKHNGKSNQRRTELKH-GHTKETEFPAKLAMWDFDHCDPKR 59

Query: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNGK+VVCP+D+EIVE HG SVVECSWARL+E+
Sbjct: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119

Query: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGRTDLA ELLSHFSWG 
Sbjct: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179

Query: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRG-- 241
           GFLELN++LLE YQQCTD  SIK  EE WLQ++++E ++R+ +   ED+WMMGN NR   
Sbjct: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 239

Query: 242 --NSGLMPPSDSXXXXXXXXXXXXXDTTT----------RKNVRYDNLGNII 281
              S ++   D+              + T          +++V YD+LGN+I
Sbjct: 240 NMRSSMLDSDDNSDSEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVI 291

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  372 bits (956), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 209/240 (87%), Gaps = 4/240 (1%)

Query: 4   GKGKNKSHDEGRSNKSG-GSNGHHTRRNHRHMEMKYCGGSKD--SSFPVKLAMWDFDHCD 60
           GKGKNK+H E RS + G G+NGH++++NH+HMEMK+ G S    ++FPVKL MWDFDHCD
Sbjct: 2   GKGKNKNH-EVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 61  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARL 120
           PKRCSGKKLERLGLI+SLRVGQKFQG+VV+PNG  VVCP+D+ IVE HGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 121 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFS 180
           +EVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D A ELLS+FS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 181 WGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR 240
           +G  FLE+N +LLE YQQCTD+ES+K  E  WL++I++E+++RK +A+ ED+WM GN NR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  362 bits (928), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 197/238 (82%), Gaps = 5/238 (2%)

Query: 2   AKGKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDP 61
           +KGKG NK      S  S G    HT   HRH+E K+       +FPVKLAMWDFD CDP
Sbjct: 5   SKGKGSNKQRGAHSSKPSSG----HTS-THRHVESKHGANKSGKNFPVKLAMWDFDQCDP 59

Query: 62  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLE 121
           KRCSGKKLERLG+IKSLRVGQKFQGIVVSPNGKSVVCP+DR IVE +GA+VVECSWARL+
Sbjct: 60  KRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLD 119

Query: 122 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSW 181
           EVPFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA ELLSHFSW
Sbjct: 120 EVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSW 179

Query: 182 GLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTN 239
           GL FLELNK+LLE YQ+CTD++SIKK E+ WL+QI++E QERK +   +D+W+ GN N
Sbjct: 180 GLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVN 237

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  358 bits (919), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 219/287 (76%), Gaps = 10/287 (3%)

Query: 4   GKGKNKSHDEGRSN--KSGGSNGHHTRRNHRHMEMKYCGGSKDSS---FPVKLAMWDFDH 58
           GKGKNK  D+G S   +  G+NGH +R NH++MEM+       S+    PVKL MWDFDH
Sbjct: 2   GKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFDH 61

Query: 59  CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWA 118
           CDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV P+D +I++  GA+VVECSWA
Sbjct: 62  CDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSWA 121

Query: 119 RLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHE 174
           RL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR+D A +
Sbjct: 122 RLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAAD 181

Query: 175 LLSHFSWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWM 234
           LLS+FSWG+ FL LN++L E Y QCTDS+SI++ +E WL +ID+E +ERKL+AQ  D+W+
Sbjct: 182 LLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIWL 241

Query: 235 MGNTNRGNSGLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
           MGNTNR N  L   + S                T K+V+YDNLGN+I
Sbjct: 242 MGNTNRVNDNLRDLTLSDGDEDEEEEDAED-YLTEKSVKYDNLGNVI 287

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  354 bits (909), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 177/282 (62%), Positives = 210/282 (74%), Gaps = 16/282 (5%)

Query: 14  GRSNKSGGSN----GHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKRCSGKKL 69
           GRSNK  GSN    GH  R +  ++E K+   +   +FPVKLAMWDFD CDPKRCSGKKL
Sbjct: 5   GRSNK--GSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62

Query: 70  ERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEVPFNKIG 129
           ERLG+IKSLRVGQKFQGIVVSPNGK VVCP+D++IVE  GA+VVECSWARL E+PFNKIG
Sbjct: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122

Query: 130 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGLGFLELN 189
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA ELL+HFSWGLGFLELN
Sbjct: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182

Query: 190 KDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR----GNSGL 245
           K+L+E YQ+CTD+ES+K+ E  WL++I++E  ER+  + T+D+WM GN NR    GN   
Sbjct: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGNDTE 242

Query: 246 MPPS------DSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
                     D+                 ++ V+YDNLGN I
Sbjct: 243 SSQEESENSVDTGDEEDDDNEDDYATGNRKRVVKYDNLGNEI 284

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  354 bits (908), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 219/306 (71%), Gaps = 28/306 (9%)

Query: 4   GKGKNKSHDEGRSNKSG--GSNGHHTRRNHRHMEMKYCGGSKDSS--------------- 46
           GKGKNKS D+G  N     G+NGH +R NH++MEMK       +                
Sbjct: 46  GKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSV 105

Query: 47  --FPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREI 104
              PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD +I
Sbjct: 106 KKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADI 165

Query: 105 VEAHGASVVECSWARLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALA 160
           ++  GA+VVECSWARL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALA
Sbjct: 166 IKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALA 225

Query: 161 ACFAIVGRTDLAHELLSHFSWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEV 220
           ACFAI+GR+D A +LLS+FSWGL FL+LN++L E Y +CTDS+S+K  +E+WL +I+QE 
Sbjct: 226 ACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQEA 285

Query: 221 QERKLKAQTEDVWMMGNTNRGNSGLMPPSDSXXXXXXXXXXXXXD-----TTTRKNVRYD 275
            ERKL+AQ  D+WMMGNTNR ++ L   + S             +      T  K +RYD
Sbjct: 286 TERKLQAQETDIWMMGNTNRLDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKELRYD 345

Query: 276 NLGNII 281
           NLGN+I
Sbjct: 346 NLGNVI 351

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  327 bits (838), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 161/266 (60%), Positives = 195/266 (73%), Gaps = 6/266 (2%)

Query: 21  GSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRV 80
            SNGHH+R N++ ME K    S+++SFPVKLAMWDFDHCDPKRCSGKKLERL LI+SL++
Sbjct: 22  NSNGHHSRHNNKKMEFKQ-HVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKI 80

Query: 81  GQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEVPFNKIGG-KHERLLPYL 139
            QKFQGI VSPNGK  V P+DRE+V   G +VVECSWAR++E+PF+K    K +RLLPYL
Sbjct: 81  NQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYL 140

Query: 140 VAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGLGFLELNKDLLERYQQC 199
           VAANQVNYGRPW+LNCVEA+AAC AIVG  DLA ELLSHFSWG+ FL+LN++LLE YQQC
Sbjct: 141 VAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQC 200

Query: 200 TDSESIKKVEEDWLQQIDQEVQERKLK--AQTEDVWMMGNTNRGNSGLMPPSDSXXXXXX 257
           TDS+ I+  ++ W+ QI++EVQERK    AQ  D+WM GN NR +       D       
Sbjct: 201 TDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIDESDEDNEDEDSEDEE 260

Query: 258 XXXXXXXDTTTR--KNVRYDNLGNII 281
                  +      + VRYDNLGNII
Sbjct: 261 VTYDNLGNIIENEPREVRYDNLGNII 286

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  308 bits (790), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 158/280 (56%), Positives = 195/280 (69%), Gaps = 16/280 (5%)

Query: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63
            KGKNK H+E RSN+      +++RRN     +     S  ++FPVKLAMWDFDHCDPKR
Sbjct: 2   AKGKNKGHEE-RSNRKS----NNSRRNESKHSLSI--KSTKTNFPVKLAMWDFDHCDPKR 54

Query: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123
           CSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P DRE +E +G +VVECSWARL+EV
Sbjct: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114

Query: 124 PFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSW 181
           PFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + A ++L  FSW
Sbjct: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174

Query: 182 GLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRG 241
           G  FLELN +LL+ Y  CTDS S++K +++WL++I+ E +ERK K  + D W++GNTNR 
Sbjct: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234

Query: 242 NSGLMPPSDSXXXXXXXXXXXXXDTTTRKNVRYDNLGNII 281
           N      S                T +  + RYD LGN+I
Sbjct: 235 NLNDFDNSSESTEDNIS-------TVSSADERYDALGNLI 267

>KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} similar
           to uniprot|P06243 Saccharomyces cerevisiae YDL017W CDC7
           DDK (Dbf4-dependent kinase) catalytic subunit required
           for firing origins and replication fork progression in
           mitosis through phosphorylation of Mcm2-7p complexes and
           Cdc45p kinase activity correlates with cyclical DBF4
           expression
          Length = 475

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 155 CVEALAACFAIVG-RTDLAHELLSHFSWGLGFLELNKDLLERYQQCTD 201
           C + LA CF +   +   A +LL H    L F ELN+DLL+R Q+  D
Sbjct: 425 CFDLLAKCFELNSYKRPSASDLLEH----LWFKELNEDLLDRDQRRED 468

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,870,095
Number of extensions: 1262528
Number of successful extensions: 4316
Number of sequences better than 10.0: 25
Number of HSP's gapped: 4384
Number of HSP's successfully gapped: 25
Length of query: 325
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 215
Effective length of database: 40,868,139
Effective search space: 8786649885
Effective search space used: 8786649885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)