Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02695g6.18ON94694650830.0
NCAS0D026506.18ON95093525200.0
TDEL0G045106.18ON96995924800.0
NDAI0I022606.18ON96795524750.0
ZYRO0C07854g6.18ON94493424680.0
KAFR0A050506.18ON94894024620.0
KNAG0F028706.18ON95495624170.0
Suva_15.1806.18ON94894023980.0
Smik_15.1746.18ON94593723560.0
YOR005C (DNL4)6.18ON94493723260.0
TBLA0G010406.18ON97294623090.0
Skud_15.1666.18ON94794422840.0
Kwal_56.224146.18ON96395222660.0
Kpol_1032.76.18ON96593922150.0
TPHA0M002606.18ON96695822100.0
KLTH0C11286g6.18ON95195021820.0
KLLA0D01089g6.18ON90793719530.0
ACR008W6.18ON98196019380.0
NDAI0A019407.343ON7653902756e-24
TPHA0D045707.343ON7363952693e-23
SAKL0F10912g7.343ON6933852621e-22
ACL155W7.343ON6972432594e-22
Smik_4.747.343ON8453772587e-22
Kpol_2001.717.343ON7263872561e-21
KLLA0D12496g7.343ON7003922541e-21
Kwal_56.246167.343ON7153872542e-21
YDL164C (CDC9)7.343ON7553772542e-21
Skud_4.937.343ON7554292522e-21
TBLA0E020507.343ON7203672496e-21
Suva_4.827.343ON7553772497e-21
TDEL0C020407.343ON7053892487e-21
CAGL0I03410g7.343ON7242692443e-20
KLTH0H01408g7.343ON7233812407e-20
KAFR0B008307.343ON7103772344e-19
ZYRO0F11572g7.343ON7313832202e-17
KNAG0C037407.343ON7273542165e-17
NCAS0A141107.343ON7534182165e-17
Ecym_50527.46ON873104900.061
NCAS0A094201.276ON78458735.3
Kpol_1036.373.211ON2493130735.6
ZYRO0D04664g7.46ON81790726.9
TPHA0J009107.247ON61271718.9
SAKL0G13882g5.162ON98278719.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02695g
         (946 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...  1962   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   975   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   959   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   957   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   955   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   952   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   935   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   928   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   912   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   900   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   894   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   884   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   877   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   857   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   855   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   845   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   756   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   751   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   110   6e-24
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   108   3e-23
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   105   1e-22
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   104   4e-22
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   103   7e-22
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   103   1e-21
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   102   1e-21
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   102   2e-21
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   102   2e-21
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   101   2e-21
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   100   6e-21
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   100   7e-21
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   100   7e-21
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...    99   3e-20
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...    97   7e-20
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    95   4e-19
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    89   2e-17
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    88   5e-17
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    88   5e-17
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    39   0.061
NCAS0A09420 Chr1 (1869312..1871666) [2355 bp, 784 aa] {ON} Anc_1...    33   5.3  
Kpol_1036.37 s1036 (92633..100114) [7482 bp, 2493 aa] {ON} (9263...    33   5.6  
ZYRO0D04664g Chr4 (387336..389789) [2454 bp, 817 aa] {ON} simila...    32   6.9  
TPHA0J00910 Chr10 complement(214418..216256) [1839 bp, 612 aa] {...    32   8.9  
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    32   9.1  

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 1962 bits (5083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 946/946 (100%), Positives = 946/946 (100%)

Query: 1   MADEGGLETGAHDELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTA 60
           MADEGGLETGAHDELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTA
Sbjct: 1   MADEGGLETGAHDELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTA 60

Query: 61  RYYEVISNFTTLWRTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSST 120
           RYYEVISNFTTLWRTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSST
Sbjct: 61  RYYEVISNFTTLWRTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSST 120

Query: 121 EKKLINWKQDAGRSVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQG 180
           EKKLINWKQDAGRSVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQG
Sbjct: 121 EKKLINWKQDAGRSVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQG 180

Query: 181 RSFKNLANSDIMNKCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVS 240
           RSFKNLANSDIMNKCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVS
Sbjct: 181 RSFKNLANSDIMNKCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVS 240

Query: 241 DLETVAKRLWDPSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDG 300
           DLETVAKRLWDPSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDG
Sbjct: 241 DLETVAKRLWDPSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDG 300

Query: 301 ERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFD 360
           ERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFD
Sbjct: 301 ERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFD 360

Query: 361 SNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLK 420
           SNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLK
Sbjct: 361 SNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLK 420

Query: 421 QILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKI 480
           QILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKI
Sbjct: 421 QILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKI 480

Query: 481 KPEYLEQFGENMDLVLMGRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGF 540
           KPEYLEQFGENMDLVLMGRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGF
Sbjct: 481 KPEYLEQFGENMDLVLMGRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGF 540

Query: 541 VSLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIK 600
           VSLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIK
Sbjct: 541 VSLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIK 600

Query: 601 ARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKP 660
           ARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKP
Sbjct: 601 ARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKP 660

Query: 661 QKVISKKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQK 720
           QKVISKKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQK
Sbjct: 661 QKVISKKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQK 720

Query: 721 VIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIM 780
           VIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIM
Sbjct: 721 VIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIM 780

Query: 781 KLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDN 840
           KLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDN
Sbjct: 781 KLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDN 840

Query: 841 SLMDVPHFLFHGRIVFLLSDNNNIQKESFMVDAYGGKVTNELSSANLVIVVGAVTQRRIN 900
           SLMDVPHFLFHGRIVFLLSDNNNIQKESFMVDAYGGKVTNELSSANLVIVVGAVTQRRIN
Sbjct: 841 SLMDVPHFLFHGRIVFLLSDNNNIQKESFMVDAYGGKVTNELSSANLVIVVGAVTQRRIN 900

Query: 901 DIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNYRLP 946
           DIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNYRLP
Sbjct: 901 DIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNYRLP 946

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/935 (51%), Positives = 660/935 (70%), Gaps = 21/935 (2%)

Query: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83
           NF+PSP F WLC++LF K++ +Q +R    + KPVT RYYEVI++F  LWR TVGN+I+P
Sbjct: 19  NFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDIFP 78

Query: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143
           AL LILPYRDRR+FNI+DYTLIKAICA+LKLP++S TEK+L++WK  AG+ V+LS+FCV 
Sbjct: 79  ALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFCVN 138

Query: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203
           EIKKR+SEP+ D+ E ITID LN  LD+LA ER  +GR FK LA+S     CL +M+F+E
Sbjct: 139 EIKKRKSEPK-DKIE-ITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFIE 196

Query: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263
           +Q+FFDILLKNR +GG EHK LN WHPDAQDYLSVVSDL TV  RLWDP  RL N DL I
Sbjct: 197 LQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVI 256

Query: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323
           N G AFAPQLA KL +SY+KI  KL  DF IEEKMDGERIQ+HY ++G  +KF+SRR TD
Sbjct: 257 NPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTD 316

Query: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383
           YTYLYG ++  G +   + LNK+VKDC+LD E++T+D    ++LPFG+VKSSA++ML++D
Sbjct: 317 YTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD 376

Query: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443
           GI  +G+ PL MVFD++++NG +L ++P   R+EYL  I TP  H IE++ S    +E  
Sbjct: 377 GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDS 436

Query: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503
           I+KSLE A+S+GSEGI+LKRYDSRY +ASR+DDWIK+KPEYLEQFGENMDL+++GRDP K
Sbjct: 437 IRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496

Query: 504 KDSLMLGL--------LDYEEVIQDSPIMV--NSQSSEENSQRFRGFVSLCIIANGISNE 553
           KDSLM GL         D  E   D+ I++  +  +  E  +    FVS C+IANG+S E
Sbjct: 497 KDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTIHKFVSFCVIANGLSQE 556

Query: 554 EYKEIDRKTKGLWNDSEKIPPLE-YMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSER 612
           E+K+IDRKT+GLWN S++IPP +  ++FG+++P +WIDPKKS+++E+KARS+D   S+ R
Sbjct: 557 EFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAESNGR 616

Query: 613 KFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVISKKRRYNI 672
           KFA GCTL+GGYCR IREDK+W+TCYTL EF R K+  + R+ GS +    + ++++   
Sbjct: 617 KFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKS-RRNGSDQVIHGVKRQKKNRR 675

Query: 673 ISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQN 732
              ++++LE+   L   +  F  +YFYV+SD FD V   RI+K  + K I   GG L+ N
Sbjct: 676 KYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHN 735

Query: 733 VITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFSK 792
           +I++ +   +LRIIS + T EC++LI RGYD+I+P+W+ DC+ S  ++KLEP +CFN S 
Sbjct: 736 IISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVST 795

Query: 793 QLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQF-DNSLMDVPHFLFH 851
           +L     KR+D +GD YE  I + + S+L   ++     Q     + D  L+ +P FLF 
Sbjct: 796 ELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTPYADEELIKIPLFLFQ 855

Query: 852 GRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQRRINDIRKQISS 908
            RI  +L  N   +  SF+   +  YGGK+T ++   NL+I+     Q+ +   R  ++ 
Sbjct: 856 DRI--MLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNG-NQQLLQRTRDLLTK 912

Query: 909 EVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
            ++     P IP +V+  W+   I++N+QV E++Y
Sbjct: 913 NIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDY 947

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/959 (50%), Positives = 665/959 (69%), Gaps = 42/959 (4%)

Query: 14  ELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLW 73
           E + TE+   NFAPSPDF+WLCE+LF K++ VQ +   +L  KP++ RYYEVIS+F  LW
Sbjct: 19  ESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLW 78

Query: 74  RTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGR 133
           R TVGNNI+PAL L LPYRDRR++NIKDYTL+KAIC++L LPK S+TEK+L+ WK+ A R
Sbjct: 79  RKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATR 138

Query: 134 SVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMN 193
            VRLS FCVEEI+KR+SEP   R  RITID LN  LD L  ER  +G  FK L++S   N
Sbjct: 139 GVRLSNFCVEEIRKRKSEPSPGR--RITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFN 195

Query: 194 KCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPS 253
            CL +M+F+E+++FFDI+LKNR +GG EHKLLNCWHPDA DYLSVVSDLETVA RLWDP 
Sbjct: 196 FCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPE 255

Query: 254 QRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSD 313
            RL   DL IN+G AF PQLA K+ +SY+KI  KL  DF IEEKMDGERIQ+HY ++G+ 
Sbjct: 256 HRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAK 315

Query: 314 IKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVK 373
           I+F SRR  DYT LYG NL++GT+AN++N + NV+DCVLD E++TFD++  +VLPFGMVK
Sbjct: 316 IRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVK 375

Query: 374 SSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEII 433
           SSA+  LS +GI +QG  P+LMV D++YLNG +L+ LP Y+R+E+L ++L P  H +EI+
Sbjct: 376 SSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEIL 435

Query: 434 KSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMD 493
             +R ++   I+KSLEK++S+GSEGI+LK Y +RY I +R+D WIK+KPEYLEQFGEN+D
Sbjct: 436 PYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLD 495

Query: 494 LVLMGRDPSKKDSLMLGLLDYE--------EVIQDSPIM-VNSQSSE----ENSQRFRGF 540
           LV++GR P KKDSLM GL  YE        E  ++S I+ ++S+  E    +  +  + F
Sbjct: 496 LVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYF 555

Query: 541 VSLCIIANGISNEEYKEIDRKTKGLWNDS-EKIPPLEYMKFGSKVPRQWIDPKKSLILEI 599
           +S C+IANGIS +E+KEIDRKT+G W  S +++P  + ++FGSK+P +WIDPK S++LE+
Sbjct: 556 ISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEV 615

Query: 600 KARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSK 659
           KARSLDNT SS++KFAAGCTL GGYCR+IR+DK+W  CY+  E  + +   +    GS  
Sbjct: 616 KARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFN 675

Query: 660 PQKVISKKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQ 719
            Q     K +   I   +       ++   ++IF G+ FYVLSDY D  +  RI KSE  
Sbjct: 676 KQYSKKMKSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFD 735

Query: 720 KVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKI 779
            +I+ N G+LV+N+I+++++ +  RIIS + T EC +LI RGYDI+SP+W+ DC+ +  +
Sbjct: 736 DLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMV 795

Query: 780 MKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQ-QPDVQF 838
           +KLEP HCFN S +LM     R+D+YGD +   I + +  +L    I T  KQ +P++  
Sbjct: 796 VKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNL----IDTNMKQTEPNLMR 851

Query: 839 D-NSLMD-VPHFLFHGRIVFLLSDNNNIQKESFMVDAY---------GGKVTNELSSANL 887
           + NS +D VP FLF  R V++     N       VDAY         GG + +++ S NL
Sbjct: 852 EANSELDVVPLFLFSTRAVYIPPQVFN------AVDAYGLTSKFKLHGGSIASDIPSCNL 905

Query: 888 VIVVGA---VTQRRINDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
           +I+      +  + + ++R+ +   + + D  P IP +V+  W+   I++N QV E+++
Sbjct: 906 IIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDF 964

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/955 (49%), Positives = 656/955 (68%), Gaps = 46/955 (4%)

Query: 24  NFAPSPDFLWLCEQLFAKIDHVQ---FERANNLLTKPVTARYYEVISNFTTLWRTTVGNN 80
           NFAPSP F WLC++LF K++ +Q     +A+    KP+  +YYEVI +F  LWR TVGN+
Sbjct: 21  NFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVGND 80

Query: 81  IYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKF 140
           IYPAL LILPYRDRR++N++DYTLIKAIC++LKLPK+S TEK+L++WKQ AGRSVRLS F
Sbjct: 81  IYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLSSF 140

Query: 141 CVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGR-SFKNLANSDIMNKCLTSM 199
            V EIKKR+SEPQ+   E ITID LN  LD L+ ER  +G   ++ L++S     CL +M
Sbjct: 141 IVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLENM 200

Query: 200 TFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQ 259
           TF+E+Q+FFDI+LK+R +GGHEHK LN WHPDAQDYLSVVSDL+TVA +LWDP+  L N 
Sbjct: 201 TFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKND 260

Query: 260 DLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSR 319
           DL IN+G  FAPQ A KL +SY+KI  KL  DFFIEEKMDGERIQ+HY ++G+ + F SR
Sbjct: 261 DLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSR 320

Query: 320 RATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNM 379
           R TDYTYLYG ++K GT++ +++L+ NV++CVLD E+VTFD     +LPFG+VKSSA+++
Sbjct: 321 RGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSI 380

Query: 380 LSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRAN 439
           ++Q+G+  +G+ PLLMVFD++YLNG +LV++P Y+R+ YL++I TP  H +E+++S R +
Sbjct: 381 ITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCS 440

Query: 440 DEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR 499
           DE+ IK +LE A+S+GSEG++LK Y+SRY +ASR+DDWIK+KPEYLEQFGENMDL+++G+
Sbjct: 441 DERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGK 500

Query: 500 DPSKKDSLMLGL-------------------LDYEEVIQDSPIMVNSQSSE-ENSQRFRG 539
           DP KKDSLM GL                   LD ++ I +     + + +E E  +  + 
Sbjct: 501 DPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGEGE---DKEGNEIEREKTIKR 557

Query: 540 FVSLCIIANGISNEEYKEIDRKTKGLWNDSEKI-PPLEYMKFGSKVPRQWIDPKKSLILE 598
           FVS C IANGIS EE+K I R TKG W  S++I PP + ++FGS+VP +WIDPK S+++E
Sbjct: 558 FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE 617

Query: 599 IKARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKS---GNNWRKR 655
           +KARSL+N   + +KF  G TL+GGYCRQIREDK+WKTCYTL E  R K    G+N R  
Sbjct: 618 VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRAN 677

Query: 656 GSSKPQKVISKKRRYNIIS-SVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIK 714
             +      SK+R+   I     K  E       +S IFDG+YFYV+SD  D     R+ 
Sbjct: 678 NDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATG-SRVS 736

Query: 715 KSEIQKVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCL 774
           + E+   I+  GG +V NVI +++  N  RI+  + T EC SLI RGYDII P+WV DC+
Sbjct: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796

Query: 775 LSGKIMKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQP 834
               ++KLEP +CFN S++LM  A +R+D +GD +E  I++  +S L    + +     P
Sbjct: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPP 856

Query: 835 DVQFDNSLMD-VPHFLFHGRIVFL-LSDNNNIQKESFMVDAYGGKVTNELSSANLVIVVG 892
            +Q+D  ++D VP FLF+GR + L + D     K    +  YGGK T +L+S NLV++  
Sbjct: 857 SIQYD--MVDTVPLFLFYGRTILLRIKDKALFTKLKVQIRLYGGKTTGDLASCNLVVI-- 912

Query: 893 AVTQRRINDIRKQISSEVIK----QDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
              Q+    + K + S ++K     D PP +P +V+  W+   I +  QV E+++
Sbjct: 913 ---QQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDH 964

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/934 (51%), Positives = 650/934 (69%), Gaps = 19/934 (2%)

Query: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83
           NFAPSPDF WLC++LF KID+VQ +  ++   K +T +Y+E+IS F  LWR TVG+NIYP
Sbjct: 13  NFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNIYP 72

Query: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143
           AL LILPYRDRR+FNIKDYTLIKAIC+FL+LP +S TEK+L+ WK+ AGR ++LS FCVE
Sbjct: 73  ALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFCVE 132

Query: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203
           EI++RRSEP     ERITID LN  LDQLA ER  +GR FK+LA+S +   CL +M+F E
Sbjct: 133 EIRRRRSEPL--NGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFTE 190

Query: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263
           M+Y+FDI+LK+R +GG EHK LNCWHPDA+DYLSVVSDL+TVA +LWDPS RL N DL +
Sbjct: 191 MKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLGV 250

Query: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323
           N+GL FAP LA +L++SY K+  +L  DF+IEEKMDGERIQ+HY ++G  +K++SRR  D
Sbjct: 251 NLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGND 310

Query: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383
           YTYLYG ++ TGT+A ++ L+  V++CVLD E+++FD+    VLPFG+VKSSA++ L+ +
Sbjct: 311 YTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370

Query: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443
           GI TQG+ PL MV D LYLNG +L+++P   R++YL  IL P  H +EII+S+   D+  
Sbjct: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430

Query: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503
           IK SLEKA+ +GSEGIILK + S+Y I +R+D+WIKIKPEYLEQFGEN+DL+++GRDP K
Sbjct: 431 IKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGK 490

Query: 504 KDSLMLGLL----DYEEVIQDSPIMVNSQSSEENSQR--FRGFVSLCIIANGISNEEYKE 557
           KDSLM GL     D E   Q    +VN  S EE   R   + F+S C IANGIS EE+K+
Sbjct: 491 KDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQ 550

Query: 558 IDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERKFAAG 617
           I+RKT G W ++E   P + ++FGSK+P +WI P+ S++LE+KARSLDNT SS RKF  G
Sbjct: 551 IERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSGRKFKVG 610

Query: 618 CTLFGGYCRQIREDKNWKTCYTLQEF--ERAKSGNNWRKRGSSKPQKVISKK-RRYNIIS 674
           CTL GGYCR+IREDKNW  CYTL E   ER K         + KP K  SKK RR  I+S
Sbjct: 611 CTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMK--SKKIRRPRIVS 668

Query: 675 SVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQNVI 734
            +N+ L    E +  S IFDG+ FYV+SDY      +RI K ++  +I  NGG+L  NVI
Sbjct: 669 RLNQTLSCDDEAK-TSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTFNVI 727

Query: 735 TRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFSKQL 794
           + +     LRIIS + T+EC +LI RGYDI+SP+W+ DC+ +G ++ +EP HCF+ S+ +
Sbjct: 728 SDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFSVSEDM 787

Query: 795 MDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFHGRI 854
              A  R+D +GD Y+ +I +     + + K   +      +   + + D+P FLF  RI
Sbjct: 788 EKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDIPLFLFSRRI 847

Query: 855 VFLLSDNN--NIQKESFMVDAYGGKVTNELSSANLVIVVGA---VTQRRINDIRKQISSE 909
           VF+    +  + Q     V  YGG++T+ ++  NL+IV      +  R I+D+R+ +S+ 
Sbjct: 848 VFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDLRRLLSTF 907

Query: 910 VIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
               + PP IP +V   W+   I++N QV E+++
Sbjct: 908 AAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDF 941

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/940 (50%), Positives = 665/940 (70%), Gaps = 27/940 (2%)

Query: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83
           NFAPSP F WLCE+LF+K++ V  +R  +L TK +T RYYE+I+NF  LWRTTVG++IYP
Sbjct: 13  NFAPSPQFKWLCEELFSKLEEVPNQR--HLTTKRITLRYYEIITNFVNLWRTTVGDDIYP 70

Query: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143
           AL L LPYRDRR++N+KDYTLIKAIC +LKLPK+S TEK+L+NWKQ A RSV+LS  CV 
Sbjct: 71  ALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVN 130

Query: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203
           E++KR+SEP       IT+D+LN  LD L+ +R  +GR +KNL+ S I   C+  M+F+E
Sbjct: 131 EMRKRKSEPV--EKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFME 188

Query: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263
           ++YFFDI+LK R +G HEHKLLN WHPDA+DYLSVVSDL+TV  RLW+P+ RL + +L I
Sbjct: 189 LRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSI 248

Query: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323
           NIG AFAP LA KL +SY KI +KL  DFFIEEKMDGERIQ+HY ++G+DIKF SRR  D
Sbjct: 249 NIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVD 308

Query: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383
           YTYLYG NL TGT+A ++ LN++VK+CVLD E+VT+D +  I+LPFGMVKS+A N L+++
Sbjct: 309 YTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKE 368

Query: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443
            I  Q +HPLLMVFD+++LNG++LV+ P Y+R++YL  +L P   R++I+   R ++E +
Sbjct: 369 EISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428

Query: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503
           I+KSLE A+SVGSEGI+LK Y+SRY+I SR+D WIKIKPEYLEQFGENMDL+++GRD +K
Sbjct: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488

Query: 504 KDSLMLGL--LDYEEVIQDSPI---MVNSQSSE------ENSQRFRGFVSLCIIANGISN 552
           KDS   GL  LD EE      I   +VN  S E      EN++  +  VS C+IANGIS 
Sbjct: 489 KDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQ 548

Query: 553 EEYKEIDRKTKGLWNDSEKI-PPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSE 611
            EYKEI RKT+G W  +E++ PP E ++FG++VP +WI+P+ S++LEIKARSLDNT SS 
Sbjct: 549 NEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESSC 608

Query: 612 RKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVISKKRRYN 671
           ++F AGCTL+GGYCR+IR+D +WK+ ++L E  R +   ++             K+R+  
Sbjct: 609 KRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKSKKRRKKQ 668

Query: 672 IISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQ 731
           +++ +N+ L    +++  S IFDG++FY+LSDYFD  +  RI K ++QK+++ NGG++  
Sbjct: 669 LLTPLNQNLNP-RDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKISH 727

Query: 732 NVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFS 791
           N++++  + ++LRI+  + T ECN LI RGYDI+SP+WV DC+ + KI+K+EPSHCF+ S
Sbjct: 728 NIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSVS 787

Query: 792 KQLMDYAYKRIDQYGDPYER--DINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFL 849
             LM  A +R+D+YGD YE    +++  +   +S+ I        ++  D     VP+FL
Sbjct: 788 DDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLD--FEKVPYFL 845

Query: 850 FHGRIVFLLS---DNNNIQKESFMVDAYGGKVTNELSSANLVIVVGA---VTQRRINDIR 903
           F  R  F++    D ++I++    +  YGGKV   +S  N+VI   A   V +  +  IR
Sbjct: 846 FWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRESMKFIR 905

Query: 904 KQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
             ++  V      P +P +VS  W+   I++N QV E++Y
Sbjct: 906 NTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/956 (50%), Positives = 645/956 (67%), Gaps = 36/956 (3%)

Query: 18  TEEQAVNFAPSPDFLWLCEQLFAKIDHVQFE-RANNLLTKPVTARYYEVISNFTTLWRTT 76
            EE   NFAPSPDF WLC++LF K D V  + R  NL  KP+T RYYEV+SNF  LWR T
Sbjct: 5   VEEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINL--KPITVRYYEVVSNFVQLWRKT 62

Query: 77  VGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVR 136
           VGNN YP L L LPYRDRR +NIKD TLIKAIC +L LPK SSTEKKL+NWKQ A R+ R
Sbjct: 63  VGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNER 122

Query: 137 LSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCL 196
           LS FCV EI+KR+S P   + + IT+D LN  LD LA  ++ +G+  + LA+S     CL
Sbjct: 123 LSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCL 182

Query: 197 TSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRL 256
            +M+F+E++YFFDILLK R +GGHEHKLLN WHPDA DY SVVSDL +V K+L++PS RL
Sbjct: 183 ENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRL 242

Query: 257 GNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKF 316
            N+DL + IG AFAP LA +L++SY+KI +KLG DF IEEKMDGERIQ+HY ++G++IKF
Sbjct: 243 RNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKF 302

Query: 317 YSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSA 376
            SRR TDYTYLYG +  TGT+A ++ LN+NVK+C+LD E+VT+D   +++LPFG+VKSSA
Sbjct: 303 LSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSA 362

Query: 377 KNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSI 436
           KN LS++ I    +HPL M FD++YLNG +LVDLP Y+R++YL +ILT     ++I+   
Sbjct: 363 KNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFA 422

Query: 437 RANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVL 496
           R N+ + I KSL  A+SVGSEGIILK+ +SRY++ASR+D WIKIKP+YL+QFGENMDL++
Sbjct: 423 RCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLII 482

Query: 497 MGRDPSKKDSLMLGL-----------LDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCI 545
           +GRDP KKD+ M  L           L  EE +       +S+     + R   FVS C 
Sbjct: 483 IGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCT 542

Query: 546 IANGISNEEYKEIDRKTKGLWNDSEKI-PPLEYMKFGSKVPRQWIDPKKSLILEIKARSL 604
           IANGISN E+KEID+KT+GLW   +++ PP EY++FG+K P +WIDPK+SL+LE+K+RSL
Sbjct: 543 IANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSL 602

Query: 605 DNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWR-KRGSSKPQKV 663
           DNT S+ +K+ AG TLFGGYCR +R DK+W TCYT+ EFER +     +   G S     
Sbjct: 603 DNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSN 662

Query: 664 ISKKRR--YNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKV 721
             +K+R   +I+  ++   +   E EH SDIF  ++F VLSDY D     RI ++ + ++
Sbjct: 663 KGRKKRNTTSILGVISPRKKRTPEGEH-SDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQL 721

Query: 722 IVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMK 781
           I+  GG+++ NV+ +      LRII     +ECN+LI RGYDI+SP WV DC+ S +++K
Sbjct: 722 IIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLK 781

Query: 782 LEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQF--- 838
           LE +HCFN SK+LM+ +  R+D+Y D +E +I+      L    I       P   F   
Sbjct: 782 LERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRL----IDVHLHNMPSGSFSGE 837

Query: 839 --DNSLMDVPHFLFHGRIVFL----LSDNNNIQKESFMVDAYGGKVTNELSSANLVIVVG 892
             D  L  +P  LF  R VF+    LSD     K S     +GG+VT+ +   NL+I+  
Sbjct: 838 NLDFELRGLPPLLFFDRSVFIAETKLSD-RIYAKISSETKLFGGQVTHTIEDCNLIIIPN 896

Query: 893 AVTQRRI---NDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNYRL 945
              + +I     IR +++S + K +   RIP +VSE WLY  IK+N QV E+NY +
Sbjct: 897 TDDEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSV 952

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/940 (49%), Positives = 642/940 (68%), Gaps = 29/940 (3%)

Query: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83
           NFAPSPDF WLCE+LFAK++ V          K V+ RYYE+ISNFT LWR TVGNNIYP
Sbjct: 13  NFAPSPDFRWLCEELFAKVEEVLINGTAGT-GKSVSFRYYEIISNFTELWRKTVGNNIYP 71

Query: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143
           AL L LPYRDRR++NIKDY LI+ +C++LKLPK+S TE++L +WKQ  G+   LS   VE
Sbjct: 72  ALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLVE 131

Query: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203
           EI KRR+EP     + IT+D +N YLD+L+ E    GR FKNL  S     CL +MTF+E
Sbjct: 132 EISKRRTEPT---RKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVE 188

Query: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263
           +++FFDILLKNR +GG EHKLLNCWHPDAQDYLSVVSDL  V  +L+DP  RL N DL I
Sbjct: 189 LKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSI 248

Query: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323
            +G AFAPQLA K+++SY+KI   L  DFF+EEKMDGERIQ+HY N+G  IKF+SRR  D
Sbjct: 249 KVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGID 308

Query: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383
           YTYLYG NL +GT++ ++  + +VK+CVLD E+VTFD+  K++LPFG+VK SAK  LS +
Sbjct: 309 YTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFN 368

Query: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443
            I+   FHPL MVFD+LYLNG +L  LP Y+R+EYL  IL P+   +EI++  R  D + 
Sbjct: 369 DINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAES 428

Query: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503
           +KKSLE A+S+GSEG++LK Y S Y +ASR+++WIK+KPEYLE+FGEN+DL+++GRD  K
Sbjct: 429 VKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSGK 488

Query: 504 KDSLMLGLLDYEE-----VIQDSPIMVNSQSSEEN-----SQRFRGFVSLCIIANGISNE 553
           KDS MLGLL  +E       Q+ P  + + SS E       +R R  +S C IANGIS E
Sbjct: 489 KDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQE 548

Query: 554 EYKEIDRKTKGLWNDSEKI-PPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSER 612
           E+KEIDRKT+G W  +  + PP   ++FGSK+P +WI+P +S++LEIK+RSLDNT ++ +
Sbjct: 549 EFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETNMQ 608

Query: 613 KFAAGCTLFGGYCRQIREDKNWKTCYTLQE-FERAKSGNNWRKRGSSKPQKVISKKRRYN 671
           K+A  CTL+GGYCR+IR DK+W  CYTL E +E  ++ +N   +  +   +++ KKR+  
Sbjct: 609 KYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPKKRKRA 668

Query: 672 IISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQ 731
           ++S      +   E +  S +F G++FYVLSDY + V   RI +SE+  VIV +GG+L+ 
Sbjct: 669 LVSD---PFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIH 725

Query: 732 NVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFS 791
           NVI + + + D+R+I  + T EC +LI RGYDI+ P+W+ DC    K++ +EPS+CF+ S
Sbjct: 726 NVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVS 785

Query: 792 KQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFH 851
            +L   A +R+D +GD +E DI++ + SSL   +    + +Q D  F+  L  +P FLF 
Sbjct: 786 GKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSFE--LQIIPLFLFS 843

Query: 852 GRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQRR---INDIRKQ 905
            RIV++       + E  +   +  +GGK+T++ S +NL+I+  A    R   + ++  Q
Sbjct: 844 NRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEVHSQ 903

Query: 906 ISSEV--IKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
           I+  V     D  PRIP +V+  W+   I +N QV E+++
Sbjct: 904 INEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/937 (48%), Positives = 638/937 (68%), Gaps = 26/937 (2%)

Query: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83
           NFAPSPDF WLCE+LF+KID VQ  +      K  + +YYEV+SNF  +WR TVGNNIYP
Sbjct: 13  NFAPSPDFKWLCEELFSKIDEVQV-KGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIYP 71

Query: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143
           AL L LPYRDRR++NIKDY LI+ IC++LKLPK+S+TE +L +WKQ  G+   LS   VE
Sbjct: 72  ALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLVE 131

Query: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203
           EI KRRSEP     + ITID +N  LD+L+ +R+  GR FKNL  S     CL SM+F+E
Sbjct: 132 EIAKRRSEPN---GKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFVE 188

Query: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263
           ++YFFDILLK+R +GG EHK L+CWHPDAQDYLSVVSDL+ VA +L+DP  RL N DL I
Sbjct: 189 LKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLTI 248

Query: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323
            +G AFAPQLA K+++ Y+KI   L  DF +EEKMDGERIQ+HY N+G  ++FYSRR  D
Sbjct: 249 KVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGID 308

Query: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383
           YTYLYG +L +GT+++ ++   NV++CVLD E+VTFD+  K++LPFG+VK SAK+ LS +
Sbjct: 309 YTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFN 368

Query: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443
            I+   FHPL +VFD+LYLNG +L  LP ++R+EYL+ ILTP  + +E++++ R  + + 
Sbjct: 369 SINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVES 428

Query: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503
           IKKSLE A+S+GSEG++LK Y+S Y +ASR+++WIK+KPEYLE+FGEN+DLV++GRDP K
Sbjct: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPGK 488

Query: 504 KDSLMLGLLDYEEVIQD------SPIMVNSQSSEE---NSQRFRGFVSLCIIANGISNEE 554
           KDS MLGLL   E   D      S  + N+  +E    + ++ +  +S C +ANGIS EE
Sbjct: 489 KDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGISQEE 548

Query: 555 YKEIDRKTKGLW-NDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERK 613
           +KEIDRKT+G W   SE  PP    +FGSK+P +WI+P +S++LEIK+RSLDNT ++ +K
Sbjct: 549 FKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETNMQK 608

Query: 614 FAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGN-NWRKRGSSKPQKVISKKRRYNI 672
           +A  CTL+GGYC++IR DK+W  C+TL E   ++S   N   +      K++ KKRR  +
Sbjct: 609 YATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRKKRREVL 668

Query: 673 ISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQN 732
            S+     +   E    S IF G+YFYVLSDY       RI + E++  IV +GG+L+ N
Sbjct: 669 TSN---TFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYN 725

Query: 733 VITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFSK 792
           +I + + + D+R+IS +NT EC +LI RGYDI+ P WV DC+   K++ +EP +CFN S+
Sbjct: 726 IILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNVSQ 785

Query: 793 QLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFHG 852
           ++   A KR+D  GD +E DI++ + S L   +      ++  V+ D  +   P FLF  
Sbjct: 786 KMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEE--VERDAEVQVFPLFLFSN 843

Query: 853 RIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIV-VGAVTQRR--INDIRKQI 906
           RIV++      ++ E  +   +  +GGK+T+  S  NLVI+  G  T R+  I ++ +QI
Sbjct: 844 RIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVNEQI 903

Query: 907 SSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
             +V   D  P+IP +V+  W+   I  N QV E+++
Sbjct: 904 KEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDF 940

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/937 (47%), Positives = 643/937 (68%), Gaps = 27/937 (2%)

Query: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83
           NFAPSPDF WLCE+LF KI  VQ         K  + +YYE+ISNF  +WR TVGNNIYP
Sbjct: 13  NFAPSPDFKWLCEELFVKIHEVQINGTAGT-GKSRSFKYYEIISNFVEMWRKTVGNNIYP 71

Query: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143
           AL L LPYRDRR++NIKDY LI+ IC++LKLPK+S+TE++L +WKQ  G+   LS   VE
Sbjct: 72  ALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLVE 131

Query: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203
           EI KRR+EP    ++ ITID++N YLD L+ +R   GR FK+L  S     C+ +M+F+E
Sbjct: 132 EIAKRRAEPS---SKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVE 188

Query: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263
           ++YFFDI+LKNR +GG EHKLLNCWHPDAQDYLSV+SDL+ V  +L+DP  RL + DL I
Sbjct: 189 LKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSI 248

Query: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323
            +G AFAPQLA K+++SY+KI   L  DF +EEKMDGERIQ+HY N+G  IKF+SRR  D
Sbjct: 249 KVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGID 308

Query: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383
           YTYLYG +L +GT++  +    +VK+CVLD E+VTFD+  +++LPFG+VK SAK  LS +
Sbjct: 309 YTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFN 368

Query: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443
            I+   FHPL MVFD+LYLNG +L  LP ++R++YL  IL+P  + +EI++S R    + 
Sbjct: 369 SINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVES 428

Query: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503
           IKKSLE A+S+GSEG++LK Y+S Y +ASR+++WIK+KPEYLE+FGEN+DL+++GRD  K
Sbjct: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSGK 488

Query: 504 KDSLMLGLL-----DYEEVIQDSPIMVNSQSSEENSQ----RFRGFVSLCIIANGISNEE 554
           KDS MLGLL     +Y++   DS  +V+  S E++ Q    R +  +S C IANGIS EE
Sbjct: 489 KDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEE 548

Query: 555 YKEIDRKTKGLWN-DSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERK 613
           +KEIDRKT+G W   SE  PP   ++FGSK+P +WIDP +S++LEIK+RSLDNT ++ +K
Sbjct: 549 FKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETNMQK 608

Query: 614 FAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVISKKRRYNII 673
           +A  CTL+GGYC++IR DK W  CYTL +   +++  +     + + Q  + +K+R  ++
Sbjct: 609 YATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKKRKRVL 668

Query: 674 SSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQNV 733
             ++ +     +    S+IF G+ FYVLSDY       RI ++E++K IV +GG+L+ NV
Sbjct: 669 --ISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKLIYNV 726

Query: 734 ITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFSKQ 793
           I + +++ D+R+IS + T EC +LI RGYDI+ P WV DC+   +++ +EP++CFN S++
Sbjct: 727 ILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCFNVSQK 786

Query: 794 LMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFHGR 853
           +   A KR+D  GD +E DI++ + SSL   ++  +     +++ D+ +   P FLF  R
Sbjct: 787 MRAVAEKRVDCLGDSFENDISETKLSSLYKSQL--SLPPMGELEIDSEVRRFPLFLFSNR 844

Query: 854 IVFL----LSDNNNIQKESFMVDAYGGKVTNELSSANLVIVVGAVTQRR---INDIRKQI 906
           I ++    +S  ++I +    +  +GGK+T++ S  NL+I+       R   +N++ ++I
Sbjct: 845 IAYVPRRKISTEDDIIE--MKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHEKI 902

Query: 907 SSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
             ++   D  P+I  +V+  W+   I +N QV E+++
Sbjct: 903 KEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDF 939

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/946 (46%), Positives = 637/946 (67%), Gaps = 27/946 (2%)

Query: 24  NFAPSPDFLWLCEQLFAKID----HVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGN 79
           NFAPSPDF WLC++LF KID     ++ + AN +  KP++ RY++ I++F  LWRTT+G+
Sbjct: 25  NFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTIGD 84

Query: 80  NIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSK 139
           +I+PALRLILPYRDRRV+NIKD TLI+AIC++LKLPK+S  E++LI WK  A R   L+ 
Sbjct: 85  DIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETLAT 144

Query: 140 FCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTE-QGRSFKNLANSDIMNKCLTS 198
           FC+ EI KR++EPQ+ + ERI+ID LN  LD L + R     +   NL   +    CL +
Sbjct: 145 FCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCLEN 204

Query: 199 MTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGN 258
           MTF+E++YFFDI++KN+ LG  E+  L  WHPD+++YLSVVSDL T++ +LW+PS ++ N
Sbjct: 205 MTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKINN 264

Query: 259 QDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYS 318
            DL I +G  FAPQLA +L +SY  I  +L  DFFIEEKMDGERIQ+HY N+G  +KF+S
Sbjct: 265 SDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFS 324

Query: 319 RRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKN 378
           R  TDYTYLYGN+   GT+A F+ L+KNVK+CVLD E+VTFDS +K VLPFG+VKSSA +
Sbjct: 325 RHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASS 384

Query: 379 MLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRA 438
            L++  ID   FHPL MVFD+LYLNG++L+DLP +KR+E+L  +LTP    +EI+ SIR 
Sbjct: 385 QLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRC 444

Query: 439 NDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMG 498
            D   IKK L+ A+SVGSEGI+LK+Y S+Y+  +R ++WIK+KPEYLE+FGENMDL+++G
Sbjct: 445 TDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIG 504

Query: 499 RDPSKKDSLMLGLLDYEE-------VIQDSPIMVNSQSSEEN-----SQRFRGFVSLCII 546
           RD  KKD L+ G+L  EE       + ++S I + S S +++     SQ  +  +S C I
Sbjct: 505 RDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQGIKKVISFCTI 564

Query: 547 ANGISNEEYKEIDRKTKGLW-NDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLD 605
           ANG+S  E KEI+R T+G W N + + PP++ ++FG+K P +WI P+ S++LEIKARSLD
Sbjct: 565 ANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARSLD 624

Query: 606 NTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVIS 665
            T  ++ K+A GCTL+GGYCRQIR+DK+W +CYTL +    +   +  K+  +K   + S
Sbjct: 625 RTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRH-EKKNKNKQTLIRS 683

Query: 666 KKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVAN 725
             R+ + I S    L +  +L   SD+F G+YFY++SDY      +RI + +I  +I+ N
Sbjct: 684 YSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLIIKN 743

Query: 726 GGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPS 785
           GG+++ NVI + Y ++ LRI+SS++T+EC  L+ RGYD+I+  W+FDCL +G I+ LEP+
Sbjct: 744 GGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPLEPA 803

Query: 786 HCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQF---DNSL 842
           HC   S +L+  A  RID++GD YE  +   +   L    I    +   ++     D  +
Sbjct: 804 HCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSNSNLLLINKDEGV 863

Query: 843 MDVPHFLFHGRIVFLLSDNNNIQKES---FMVDAYGGKVTNELSSANLVI-VVGA-VTQR 897
             +P FLF  R  FL+ ++  +       F +  YGG +  +L   N+++ V G+ +  +
Sbjct: 864 DSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGSQLVNK 923

Query: 898 RINDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
           ++ D+R ++  + +  + P  IP  V+  W+ + IK   Q++ ++Y
Sbjct: 924 KLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLSPEDY 969

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/944 (47%), Positives = 625/944 (66%), Gaps = 39/944 (4%)

Query: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83
           NFAPSPDF WLCE+LF +ID+V+         K  + +YYE+ISNF   WR  VGNNIYP
Sbjct: 13  NFAPSPDFKWLCEELFVRIDNVRINGTAGT-GKSASFKYYEIISNFVESWRKGVGNNIYP 71

Query: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143
           AL L LPYRDRR++NIKDY LI+ IC++LKLP++S TE++L +WKQ   R+  LS   VE
Sbjct: 72  ALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLVE 131

Query: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203
           EI KRR EP     + ITID +N YLD+L+ ER+  GR FK+L NS     CL SM+F+E
Sbjct: 132 EIAKRRPEPN---GKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVE 188

Query: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263
           ++YFFDI+LKNR +GG EH+ LNCWHPDAQDYLSVVSDL+ V  +L+DP  RL N DL I
Sbjct: 189 LKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSI 248

Query: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323
            +G AFAPQLA K+ + Y+KI   L  DF IEEKMDGERIQ+HY N+G  IKF+SRR  D
Sbjct: 249 KVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGID 308

Query: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383
           YTYLYG +L +GT++ ++ L   VK+CVLD E+VTFDS  K++LPFG+VK SAK +LS  
Sbjct: 309 YTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCS 368

Query: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443
            I+   F PL MVFD+LYLN  +L  LP ++R++YL  ILTP  + +EI++S R  D Q 
Sbjct: 369 DINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQS 428

Query: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503
           +K SLE A+S+GSEG++LK Y+S Y IASR+ +WIK+KPEYLE+FGEN+DL+++GRD  K
Sbjct: 429 VKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSGK 488

Query: 504 KDSLMLGLL----------DYE----EVIQDSPI---MVNSQSSEENSQRFRGFVSLCII 546
           KDS MLGLL          D E    EV+ DS I   ++NS+   +        +S C +
Sbjct: 489 KDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKV------LSFCSV 542

Query: 547 ANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDN 606
           ANGIS+EE+KEI+R+T+G W  +    P   ++FGS++P +WI+P  S++LEIK+RSLDN
Sbjct: 543 ANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRIPAEWIEPSDSIVLEIKSRSLDN 602

Query: 607 TRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTL-QEFERAKSGNNWRKRGSSKPQKVIS 665
           T +S R++A  CTL+GGYCR+IR DK+W  CYTL Q +E     +   ++  +   ++  
Sbjct: 603 TETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAH 662

Query: 666 KKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVAN 725
           KKR+  +IS          E +  S IF G++FYVLSDY       RI ++ ++  IV +
Sbjct: 663 KKRKRALISD---PFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKH 719

Query: 726 GGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPS 785
           GG+L+ NVI + + + D+R+IS + T+EC  LI RGYDI+ P WV DC+   +++ +EPS
Sbjct: 720 GGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPS 779

Query: 786 HCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDV 845
           +CF+ S +L + A KR+D  GD +E +I++ + S L   +         ++  D+    +
Sbjct: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSR--QDLSSIGEIGIDSEAQVI 837

Query: 846 PHFLFHGRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQRR---I 899
           P FLF  RIV++      +++E  +   +  +GG++T + S  NL+I+    + RR   I
Sbjct: 838 PLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKDCI 897

Query: 900 NDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
             + +QI  ++      P++  +VS GW+   I +N QV E+++
Sbjct: 898 EKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDF 941

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/952 (46%), Positives = 623/952 (65%), Gaps = 21/952 (2%)

Query: 4   EGGLETGAHDELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYY 63
           E   E  A    + ++++  NFAPSPDF WLC++LF+K++ +  +R    L K VT +  
Sbjct: 18  EANTENLAQQPGEVSQKKPQNFAPSPDFRWLCDELFSKLEEITEDRQK--LGKAVTVKRV 75

Query: 64  EVISNFTTLWRTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKK 123
           EVI  F  LWRTTVG+NIYP LRLILPYRD R +NIKDYTL+KA+C  L LPKDS TEK+
Sbjct: 76  EVIMYFIKLWRTTVGDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKR 135

Query: 124 LINWKQDAGRSVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSF 183
           L+NWKQ A R   LSKFCVEEI KRR EPQ   ++R+TID LN  LD+L+ E + +   F
Sbjct: 136 LLNWKQYAPRGTSLSKFCVEEIMKRRKEPQ--GSQRLTIDALNKCLDELSKEASAKKWGF 193

Query: 184 KNLANSDIMNKCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLE 243
             L+ S     CL +M+F E +YFFDI+LK R +GG EHK LNCWHPDAQDYL VVSDL+
Sbjct: 194 NGLSKSPSFQNCLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLK 253

Query: 244 TVAKRLWDPSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERI 303
            +++ LW+P+ RLG  +L INIG AFAP LA +LH+SY+++  KL  DF IEEKMDGERI
Sbjct: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313

Query: 304 QMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNN 363
           Q+HY   G+ I+F SRR TD+T+LYG++L+ G ++  +    +V+DCVLD E+V+FD   
Sbjct: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373

Query: 364 KIVLPFGMVKSSAKNML--SQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQ 421
            +VLPFG+VKS+A   L  S   +DT G+ PL M+FD++YLNG +L  LP + R+ YL+ 
Sbjct: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433

Query: 422 ILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIK 481
           IL+P A+ +EI+  +RA++   IK SLE+A+ +GSEGIILK++ S Y I +R+D WIKIK
Sbjct: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIK 493

Query: 482 PEYLEQFGENMDLVLMGRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFV 541
           PEY E+ GE MDLV++GRDP KKDSLM GL+  +E    S  + +        QR    +
Sbjct: 494 PEYFEELGETMDLVVIGRDPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQRNPKVI 553

Query: 542 SLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLE-YMKFGSKVPRQWIDPKKSLILEIK 600
           S C IANG+S+ E+KEI+RKT+GLWN +   PP    ++FG+K+P +WIDP+ SL+LE+K
Sbjct: 554 SFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVK 613

Query: 601 ARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKP 660
           ARS+D    S +K+  G TL G YCR +R +K+W TC T+Q++E+AK  +N+ K      
Sbjct: 614 ARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSH 673

Query: 661 QKVISKKRRYNIISSVNKAL-EDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQ 719
           Q    K+R+   +S +   L +D  E    S+IF G+ FY+LSDY D  ++KR +K +I 
Sbjct: 674 QISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDS-QKKRYEKDQIG 732

Query: 720 KVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKI 779
            ++  N G ++ N   R    + LRIIS +NTVEC SL  +GYDII P W+FDCL  G +
Sbjct: 733 TLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSL 792

Query: 780 MKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFD 839
           +KLEP HCF  S++L++ + +R+D++GD + R ++  E+  L + +   +    P +   
Sbjct: 793 VKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVS----PHLSAP 848

Query: 840 NSLMDVPHFLFHGRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQ 896
             L  +P FLF    ++     N+  +E ++   +  +GG+ +  L   NLV+V  +  +
Sbjct: 849 EELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKE 908

Query: 897 RR-----INDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
           ++     +  +RK+I+S     +   RIP +VS  WL  CI +   V E+++
Sbjct: 909 QKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDF 960

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/939 (46%), Positives = 619/939 (65%), Gaps = 20/939 (2%)

Query: 20  EQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGN 79
           E+  NF+PSPDF WLC++LF K+D +QF       +KP    YY++I+NF  +WR TVGN
Sbjct: 29  EEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRTVGN 88

Query: 80  NIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSK 139
           +IYPAL L +PYRDRR++NIK+  LI+ +C +LKLPK+S TE++L+ WK  A R+VRLS 
Sbjct: 89  DIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLST 148

Query: 140 FCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSM 199
           FCVEEIKKR+ EP+     +ITID LN  LD L +ER  +G   + ++ S+    C  +M
Sbjct: 149 FCVEEIKKRKGEPR--EKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFENM 206

Query: 200 TFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQ 259
           T++E++YFFDILLK++ +GG EHK LNCWHPDAQDYLSVVSDL+ V+ +LW+P  RL   
Sbjct: 207 TYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYD 266

Query: 260 DLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSR 319
           DL INI  AF P+ A +L  SY  I  +L  DFFIEEKMDGERIQ+HY N+G+ +KF SR
Sbjct: 267 DLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSR 326

Query: 320 RATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNM 379
           R  DY+YLYG+N   G +  ++N +K+VK+C+LD E+VT+DS    +LPFG+VKSSA   
Sbjct: 327 RGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQS 386

Query: 380 LSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRAN 439
           LS   I+  G+HPL M FD++YLNG++L  LP ++R+ YL ++L P    +EI+ ++  N
Sbjct: 387 LSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCN 446

Query: 440 DEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR 499
           D  +IK SLEKA+ +GSEGIILKR+DS+Y++A RSDDWIKIKPEYLEQFGENMDL+++GR
Sbjct: 447 DSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGR 506

Query: 500 DPSKKDSLMLGLL-----DYEEVIQ-DSPIMVNSQSSEENSQRFRGFVSLCIIANGISNE 553
           DP KKDSLM GL+     + EE+   DS     ++S  +  +  R  +S C IANGIS +
Sbjct: 507 DPGKKDSLMCGLILTGDNEPEEITSLDSNPTDTAESFLKPDK--RKIISFCNIANGISQK 564

Query: 554 EYKEIDRKTKGLW-NDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSER 612
           E+++IDR T G W    +++PP +  +FG+K P +WI P+ S++LEIKARSL+   S+  
Sbjct: 565 EFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETNESARI 624

Query: 613 KFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVISKKR-RYN 671
           K+  G TLFGGYCRQIR DK+W +C+T  EF  +++  N           +  KKR +  
Sbjct: 625 KYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRKKRPKKR 684

Query: 672 IISSVNKALEDFAELEHRSD-IFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLV 730
           + +S+ +  E+  +    S+ IF G++FYV+SDY D     R+ KS++  +++ + G+LV
Sbjct: 685 MFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLEHNGKLV 744

Query: 731 QNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNF 790
            N I+R   LN LRIIS + T E  SLI RGYDII P+W+ DC+ + K+++L PSHCFN 
Sbjct: 745 HNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLPSHCFNV 804

Query: 791 SKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLF 850
           S  LM+    R+D+YGD YE  + + ++  L + ++  +      +    + + +P  LF
Sbjct: 805 SSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADKRITEGENHLKIPILLF 864

Query: 851 HGRIVFLLSD--NNNIQKESFMVDAYGGKVTNELSSANLVIVVGAVTQRRINDIRKQISS 908
             R  F+     +  I +    V+ YGGK+ N++S  N+++     T+ R  ++ K+I  
Sbjct: 865 CNRRFFIPETLPSTPIYELKSKVELYGGKLVNKISDCNVIVFTNTHTENR-KEVMKKIRR 923

Query: 909 EVIKQD----HPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
            ++  D      P +P +V   W+  CI +  QV E++Y
Sbjct: 924 ALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDY 962

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/958 (45%), Positives = 628/958 (65%), Gaps = 39/958 (4%)

Query: 18  TEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTV 77
           +E +  NF+PSPDF WLC +LF K+D V+  +  ++ T+P   +Y  VI+NF  LWR TV
Sbjct: 12  SEREPRNFSPSPDFKWLCNELFVKLDEVRL-KPKSVDTRPKNIQYDIVINNFIHLWRVTV 70

Query: 78  GNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRL 137
           GN+IYPALRLILPYRDRR + I+++TLI+ +C +LKL K+S TE++L  WKQ A RS+ L
Sbjct: 71  GNDIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINL 130

Query: 138 SKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQ----GRSFKNLANSDIMN 193
           S FC++EIKKR SEP     E+ITID LN  LD L++ER+      G S K L+  + + 
Sbjct: 131 SSFCIQEIKKRLSEPV--SKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIK 188

Query: 194 KCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPS 253
            C  +M+F+E++YFFDIL+K R +GG EHK LN WHPDA DYLSVVS+L  V ++LW+P+
Sbjct: 189 YCFENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPN 248

Query: 254 QRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSD 313
            RL ++DL I +  AF PQLA K+++SY+ +  ++   F IEEKMDGERIQ+HY ++G  
Sbjct: 249 FRLNSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQ 308

Query: 314 IKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVK 373
           IK++SRR  DYTYLYG +  T T++ ++ LN++VK+C+LD E+V++D +   +LPFGMVK
Sbjct: 309 IKYFSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVK 368

Query: 374 SSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEII 433
           S A N L  DG++     PL +VFDVL+LNG+ L +LP Y+R+EYL  ILTP    IEI+
Sbjct: 369 SGAANSLKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEIL 428

Query: 434 KSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMD 493
           K   A+D + I+ +L+ A+SVGSEGI+LK+YDS Y +  R++DWIK+KPEYLEQFGEN+D
Sbjct: 429 KFSIAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLD 488

Query: 494 LVLMGRDPSKKDSLMLGLL------DYEEVIQDSPIMVNSQSSEEN----------SQRF 537
           L+++GRDP KKDSLM G+        YE+++Q+  I + S   +            ++R 
Sbjct: 489 LIVIGRDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRI 548

Query: 538 RGFVSLCIIANGISNEEYKEIDRKTKGLWND-SEKIPPLEYMKFGSKVPRQWIDPKKSLI 596
             F+S C+IANGISNEE+KEIDRKT G W   S++ PP +Y++FG+++P +WI+P  S++
Sbjct: 549 TKFISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVV 608

Query: 597 LEIKARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRG 656
           LE+KARSL+N  +   KF  G TL+G YCR+IR DK++  CYT  +   A +    +KR 
Sbjct: 609 LEVKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATN----KKRS 664

Query: 657 SSK---PQKVISKKR-RYNIISSVNKALE-DFAELEHRSDIFDGMYFYVLSDYFDGVKRK 711
           SS+       I KKR R + ++ +N+ L     +    S IFDG+ F+V+SDY D     
Sbjct: 665 SSELYGNHSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSF 724

Query: 712 RIKKSEIQKVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVF 771
           R++  E+  +I  NGGQL+ N++++N N   +RI+S + T ECN LI RGYDII PKW+ 
Sbjct: 725 RLRIDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWIL 784

Query: 772 DCLLSGKIMKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAK 831
           DC+ + K++  EPSHCFN S+ L   + +R+D  GD Y++ I + E   L S K      
Sbjct: 785 DCIANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKEQL 844

Query: 832 QQPDVQFDNSLMDVPHFLFHGRIVFLLSD--NNNIQKES-FMVDAYGGKVTNELSSANLV 888
               +QFD  +  +P FLF  +  +      +  + KE+   +  YGG   N ++  N++
Sbjct: 845 YSNPLQFDQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCNVI 904

Query: 889 IV---VGAVTQRRINDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
           I+       +  +I+ IRK++S   +  ++   IP +VS  W+   I Q TQV E+++
Sbjct: 905 IIGDEHSKSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEEDF 962

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/950 (44%), Positives = 635/950 (66%), Gaps = 32/950 (3%)

Query: 13  DELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTL 72
           D  K +E +  NFAPSPDF WLCE+LF ++D +   R    L K VT +  E+I+ F  L
Sbjct: 12  DTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQE--LGKAVTVKRVEIITCFIKL 69

Query: 73  WRTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAG 132
           WRTTVG++ +PALRL+ PYRD R ++IKD+TLIKA+C  L L +DS TE++L+NWKQ AG
Sbjct: 70  WRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAG 129

Query: 133 RSVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERT-EQGRSFKNLANSDI 191
           R   LSKFCV+EI KRR EP  +R  ++TID LN  LD+LA E + ++      L+ S  
Sbjct: 130 RGTSLSKFCVQEISKRRKEPLPER--QLTIDGLNEKLDELAKEASGKKAWGTTGLSESHS 187

Query: 192 MNKCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWD 251
              CL +++FLE++YFFDI+LKNR +GG EHK L CWHPDAQ YL VV+DL+ ++K+LW+
Sbjct: 188 FQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWN 247

Query: 252 PSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFG 311
           PS RL  +DL INIG AFAP LA +LHVSY++I  KL  DF +EEKMDGERIQ+HY N G
Sbjct: 248 PSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGG 307

Query: 312 SDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGM 371
           S +KF SRR  D+++LYG  +  G ++ ++ L  +V+DCVLD E+V++D   KI+LPFG+
Sbjct: 308 SVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGI 367

Query: 372 VKSSAKNML--SQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHR 429
           VKS+A + L  S+ G +  G+ PL MVFD++YLNG +L  +P + R+EYLK+IL+P    
Sbjct: 368 VKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDV 427

Query: 430 IEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFG 489
           +EI+K IRA D + IK  +++A+ +GSEG+I+K+  S Y + +R+D W+KIKPEY E  G
Sbjct: 428 VEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLG 487

Query: 490 ENMDLVLMGRDPSKKDSLMLGLL--DYEEVIQD-SPIMVNSQSSEENSQRFRGFVSLCII 546
           E MDLV++GRDP KKDSLM GLL  D E ++++  PI    +  +E     +  VS C +
Sbjct: 488 ETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGPI----EHGKEGDPIIK-CVSFCNV 542

Query: 547 ANGISNEEYKEIDRKTKGLW-NDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLD 605
           ANG+S+EE+KEI+RKT+G W +  EK PPL  ++FGSK+P +WIDPK S+++E+KARS++
Sbjct: 543 ANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVE 602

Query: 606 NTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVIS 665
           N+  S +++ AG TL   YCR+IR DK+W TC ++ ++++AK+ +N+ +      Q  +S
Sbjct: 603 NSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQ--VS 660

Query: 666 KKRRYNIISSVNK-ALEDFAELEHR-SDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIV 723
            +R+ N+       A E  +EL+   S IF+G++FY+LSDY    +R+R ++  +   +V
Sbjct: 661 PRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTS-QRRRYERGMVAAKVV 719

Query: 724 ANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLE 783
            +GG +V+N+  R  +L+ LRI+S + T+EC +L+ RGYDII P W+FDC+ +G  + +E
Sbjct: 720 KHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIE 779

Query: 784 PSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTA---KQQPDVQFDN 840
           P HCF  S++L+D + +R+DQYGD + R ++  E+  L  +  C++      +      +
Sbjct: 780 PKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLF-KFFCSSPSDFSSRISSMLQD 838

Query: 841 SLMDVPHFLFHGRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQR 897
            L + P FL     +++L+ +   Q+ S +   ++ YGG V+  L  ANLV+V  A++  
Sbjct: 839 DLDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTA 898

Query: 898 R----INDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
           R    + ++R++I+      +   RIP +V   WL  C  +   V E+++
Sbjct: 899 RTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDF 948

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/937 (43%), Positives = 591/937 (63%), Gaps = 53/937 (5%)

Query: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83
           NF+PSP+F WLC++L  KI     ++  +L+ KPVT RY E+I+NF  LWR+TVGN IYP
Sbjct: 6   NFSPSPEFKWLCDELLGKIYETSSKK--HLIGKPVTVRYLEIITNFIKLWRSTVGNYIYP 63

Query: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143
           ALRLI+P+RDRR++N+K+ TLIKA+C +L+LPK S TE +L+ WKQ A R V+LS FCVE
Sbjct: 64  ALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVE 123

Query: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203
           EI+KR+ +   +   RITID+LNGYLD+++ E   +   +  L +S   N CL  MTF+E
Sbjct: 124 EIRKRQKD--YEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFME 181

Query: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263
           M++FFDI+LK R L G E+  L  WHPDA DYLSVVSDL+ +++RL++P++RL   DL I
Sbjct: 182 MKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSI 241

Query: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323
            I  AF PQLA + H+SY+++  KL  DF IEEKMDGER+Q+HY N+G  IK+ SRR  D
Sbjct: 242 TISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVD 301

Query: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383
           ++YLYG N  +G ++  + L+ NVKDC+LD E++T+D+   IVLPFG+VKSSA N +  +
Sbjct: 302 FSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSE 361

Query: 384 --GI-DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRAND 440
             GI  T+ + PL + FD++YLNG +L +L   +R++YL +ILTP    +EII+ ++A +
Sbjct: 362 LAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAIN 421

Query: 441 EQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRD 500
            + IK SLE+A+S+GSEGI+LK   S+Y + SR+ DWIKIKPEYLEQFGENMDL+++GR+
Sbjct: 422 AEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGRE 481

Query: 501 PSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDR 560
             KKDS   GL      I D           E +++ R F+S C IANG+SNEE+K+I+R
Sbjct: 482 QGKKDSFFCGL-----SISD---------PNEVAEKPR-FISFCTIANGLSNEEFKDIER 526

Query: 561 KTKGLWND-SEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERKFAAGCT 619
           KT G W+  SE  P    + FG+KVP +WI P+ S++LE+KAR++D   S +RK+ +GCT
Sbjct: 527 KTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYRSGCT 586

Query: 620 LFGGYCRQIREDKNWKTCYTLQEFERAKSGNN-WRKRGSSK---PQKVISKKRRYNIISS 675
           L  GYC+QIR DK+WKT  +  EFE  K   N + KR S +    +K  SK+ +  I++S
Sbjct: 587 LHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKRAKIGIVNS 646

Query: 676 VNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQNVIT 735
                E  A +   S+ F    F V+SDYFD  KR+RI + ++  VI+ +GG++V     
Sbjct: 647 S----EPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSDE 702

Query: 736 RNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFS-KQL 794
            N   ++L II  + T EC  L+     II P W+F C+  G       S  F    +  
Sbjct: 703 NNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRGELESS 762

Query: 795 MDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFLFHGRI 854
           MD +          +  D N    + L   +      + PD   D  L +VP FLF    
Sbjct: 763 MDCS---------QFYTDFNTASLNHLL--ETANRGIKNPDS--DLLLPEVPLFLFSNLK 809

Query: 855 VFLLSDNN----NIQKESFMVDAYGGKVTNELSSANLVIVVGAVTQRR-INDIRKQISSE 909
           + +L+  N    +I +  F +  +GG++ + + +A+++IV      R  +  +R++I+S+
Sbjct: 810 LAVLNSENVLDTSILEVEFAIKCHGGELVH-IENASIIIVFNDFISREDLFSLRQKIASK 868

Query: 910 VIKQ--DHPPRIPDMVSEGWLYDCIKQNTQVAEDNYR 944
            +K+  +  PRIP MV   W  D IK N     ++Y+
Sbjct: 869 AVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQ 905

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/960 (39%), Positives = 594/960 (61%), Gaps = 37/960 (3%)

Query: 5   GGLETGAHDELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYE 64
           GG  TG H E+   +   +NF+PSPDF WLC++LF K++ V  ++ +  L KP   R  E
Sbjct: 35  GGTPTGEH-EINAQDGSPINFSPSPDFCWLCDELFIKLEEVALKKKD--LGKPRKVRNLE 91

Query: 65  VISNFTTLWRTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKL 124
           + SNF +LWR TVGN+IYPAL L LPY DRR + +KD TL+KA+C  +KLP++S TE++L
Sbjct: 92  ITSNFVSLWRKTVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRL 151

Query: 125 INWKQDAGRSVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFK 184
           ++WKQ+A R V+LS FCVEE++KRR EP + +  R++ID++NG LD+L  E      S+ 
Sbjct: 152 LHWKQNAPRGVKLSTFCVEELQKRRREPVVPK--RMSIDEVNGMLDKLEHESNVGKWSYI 209

Query: 185 NLANSDIMNKCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLET 244
           +LA S   N CL  M+++E+++FFDI+LK   + G E  LL+CWHPDA+ Y  VVSDL  
Sbjct: 210 SLAESPAFNYCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRI 269

Query: 245 VAKRLWDPSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQ 304
           VA  L+DP++RL   DL + IG AFAP +A ++ + Y+K+  KLG DF++EEKMDG+RIQ
Sbjct: 270 VAHTLYDPNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQ 329

Query: 305 MHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNK 364
           +HY ++G+ I ++SR   +YTYLYG N   G+++N +   + VK+C+LD E+V++D   +
Sbjct: 330 VHYMDYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQ 389

Query: 365 IVLPFGMVKSSAKNMLS--QDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQI 422
            +LPFG+ KS A + ++    G     + PL  VFD+LYLNG  L +    KR+EYL++I
Sbjct: 390 CILPFGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKI 449

Query: 423 LTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKP 482
           L P+ + + ++   R +D + I  +L  A++ GSEGI+LK+  S+Y +  R D WIKIKP
Sbjct: 450 LIPSKNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKP 509

Query: 483 EYLEQFGENMDLVLMGRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQ------- 535
           EYLE FGENMDLV++GRD  +KDS +  L   ++  +++P    S S  ++         
Sbjct: 510 EYLENFGENMDLVVIGRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQP 569

Query: 536 RFRGFVSLCIIANGISNEEYKEIDRKTKGLWND-SEKIPPLEYMKFGSKVPRQWIDPKKS 594
           +   F+S C IANGISNEE+KEIDR T+G W    E+ PP ++++FG+K PR+WIDPK S
Sbjct: 570 KIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNS 629

Query: 595 LILEIKARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNW-- 652
           ++LE+KARS+DN  S    +  G TL+  YC++IR DKNW T  T+ E++ A+   ++  
Sbjct: 630 VVLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFN 689

Query: 653 --RKRGSSKPQKVISKKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKR 710
             +     K +    K+R ++++  ++           ++D   G YFYV S YFD   +
Sbjct: 690 VSQNAKFGKDRSSPRKRRTFHLVGDID------VTKPSKADFLKGYYFYVTSGYFDLQSK 743

Query: 711 KRIKKSEIQKVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWV 770
           K I  SEI + +V+ GG  + N+  R  +L+ L I+  ++T E   LI RGYDII P+W+
Sbjct: 744 KNIDASEIGEAVVSCGGTYIHNLRIRA-SLDKLYILGCKDTRELKMLIERGYDIIHPEWL 802

Query: 771 FDCLLSGKIMKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKI--CT 828
            DC+  G ++++EP + ++ S++LM  A  + D+YG+ Y+  + +    +L ++++    
Sbjct: 803 MDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGY 862

Query: 829 TAKQQPDVQFDNSLMDVPHFLFHGRIVFLLSDNNNIQKESFMV----DAYGGKVTNELSS 884
            ++   D   +   +     +F G + ++L D       S +V    ++ GG+VTN+L  
Sbjct: 863 ASEMGTDAVSEYERL----LIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLEL 918

Query: 885 ANLVIVV-GAVTQRRINDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943
           A +V+ V    +Q  +  +R  I + +   +    IP +V+  W+  C++    V ED Y
Sbjct: 919 ATIVVAVKDCFSQLSLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEY 978

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  110 bits (275), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 98/390 (25%), Positives = 171/390 (43%), Gaps = 50/390 (12%)

Query: 258 NQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFY 317
           N+   +  G+   P LA       + +    G  F  E K DGER Q+H    G+ ++ Y
Sbjct: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIY 448

Query: 318 SRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSA- 376
           SR   + T  Y        + +F+      K  +LDCE V +D   + +LPF ++ +   
Sbjct: 449 SRNGENMTERYPEI----HIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKR 504

Query: 377 KNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSI 436
           K++L++D          L  FD+L  N   L++    +RRE L ++ TP     +    +
Sbjct: 505 KDVLAKD----VKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATEL 560

Query: 437 RANDEQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMD 493
             ++   ++K L+++++   EG+++K  +   S Y  + RS +W+K+K +YLE  G+++D
Sbjct: 561 TTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLD 620

Query: 494 LVLM------GRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIA 547
           L ++      G+        +LG               N  + E        F + C I 
Sbjct: 621 LCVLGAYYGRGKRTGTYGGFLLGC-------------YNDNTGE--------FETCCKIG 659

Query: 548 NGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT 607
            G S+E  +++  K K    D    P   Y+   S  P  W +P  SL+ E+    L  +
Sbjct: 660 TGFSDEMLQQLHEKLKATVIDG---PKATYIYDSSAEPDVWFEP--SLLFEVLTADLSLS 714

Query: 608 ---RSSERKFAAGCTL-FGGYCRQIREDKN 633
              ++    +  G +L F  + R IREDK 
Sbjct: 715 PIYKAGSSAYDKGVSLRFPRFIR-IREDKG 743

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 99/395 (25%), Positives = 173/395 (43%), Gaps = 63/395 (15%)

Query: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325
           G+   P LA       + +    G +F  E K DGER Q+H    G +++ YSR   + T
Sbjct: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414

Query: 326 YLYG--------------NNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGM 371
             Y                N + G      N  + VKD +LDCEVV +D   K +LPF +
Sbjct: 415 ERYPELDVKDFLCVVKAITNDQEGE-----NAIQPVKDIILDCEVVAWDVEQKKILPFQV 469

Query: 372 VKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIE 431
           + +  +  +    +  +     L  FD+LYLN   +++    +R+E L+++        +
Sbjct: 470 LTTRKRKNVDLKDVKVR---VCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQ 526

Query: 432 IIKSIRANDEQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQF 488
              S+  +D   ++  L++A+    EG+++K  D   S Y  + RS +W+K+K +YL+  
Sbjct: 527 YATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGV 586

Query: 489 GENMDLVLM------GRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVS 542
           G+++DLV+M      G+        +LG  +                  E++Q F    +
Sbjct: 587 GDSLDLVVMGAYFGKGKRTGSYGGFLLGCYN------------------EDTQEFE---T 625

Query: 543 LCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKAR 602
            C I  G S+E    +    +    D+   PP+ Y+   S  P  W   K  ++ E+   
Sbjct: 626 CCKIGTGFSDEMLGNLHTLLQPTEIDN---PPMTYIYDSSAEPDVWFQAK--VLFEVLTA 680

Query: 603 SLDNT---RSSERKFAAGCTL-FGGYCRQIREDKN 633
            L  +   ++   ++  G +L F  + R IREDK+
Sbjct: 681 DLSLSPVYKAGNSRYDKGISLRFPRFLR-IREDKD 714

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 94/385 (24%), Positives = 175/385 (45%), Gaps = 40/385 (10%)

Query: 258 NQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFY 317
           N+   +  G+   P LA       + +    G  F  E K DGER Q+H    GS +  Y
Sbjct: 318 NKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGS-MNIY 376

Query: 318 SRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAK 377
           SR   + T  Y        + +++   +     +LDCE V +D+    +LPF ++ +  +
Sbjct: 377 SRNGENMTERYPEL----HIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKR 432

Query: 378 NMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIR 437
             +    +  +     L  FD+L  NG +L++    +RREYL+++L P   + +    + 
Sbjct: 433 KGVEAKDVKVR---VCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELN 489

Query: 438 ANDEQMIKKSLEKALSVGSEGI---ILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDL 494
           +++ + ++K LE+++    EG+   +L+  +S Y  + RS +W+K+K +YL+  G+++DL
Sbjct: 490 SSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDL 549

Query: 495 VLMGR--DPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISN 552
            ++G      K+     G L          +   +Q + E       F + C I  G S+
Sbjct: 550 CVLGAYYGRGKRTGTYGGFL----------LGCYNQDTGE-------FETCCKIGTGFSD 592

Query: 553 EEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RS 609
           E    +  K K     S + P   Y+   S  P  W +P  +++ E+    L  +   ++
Sbjct: 593 EMLVSLYEKLK---PSSLEQPKAFYVYDSSAEPDVWFEP--TMLFEVLTADLSLSPIYKA 647

Query: 610 SERKFAAGCTL-FGGYCRQIREDKN 633
               +  G +L F  + R IR+DK+
Sbjct: 648 GNSAYGKGISLRFPRFIR-IRDDKD 671

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 120/243 (49%), Gaps = 11/243 (4%)

Query: 259 QDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYS 318
           Q   +  G+   P LA       + +    G  F  E K DGER Q+H    G+ I+ YS
Sbjct: 323 QHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGT-IRIYS 381

Query: 319 RRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKN 378
           R + + T  Y        LAN     +  +  ++DCE V +D+  + +LPF ++ +  + 
Sbjct: 382 RNSENMTERYPEIQFHQFLAN----PQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRK 437

Query: 379 MLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRA 438
            +    +  +     L  FD+LYLNG +L+      RR++L  +L      ++    I  
Sbjct: 438 GVELKDVKVR---VCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITT 494

Query: 439 NDEQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLV 495
            +   ++  LE+++S   EG+++K  D   S+Y  + RS +W+K+K +YLE  G+++DL 
Sbjct: 495 MELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLA 554

Query: 496 LMG 498
           ++G
Sbjct: 555 VLG 557

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  103 bits (258), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 96/377 (25%), Positives = 169/377 (44%), Gaps = 40/377 (10%)

Query: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325
           G+   P LA       + +    G  F  E K DGER Q+H  N G+ ++ YSR   + T
Sbjct: 478 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 536

Query: 326 YLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGI 385
             Y   +K       +++ KN+   +LDCE V +D +   +LPF ++ +  +  +  + +
Sbjct: 537 ERYPE-IKITDFIQDLDITKNL---ILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDV 592

Query: 386 DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIK 445
             +     L  FD+L  N   L+++   +RREYL ++        +    I  N+   ++
Sbjct: 593 KVR---VCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQ 649

Query: 446 KSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR--D 500
           K L+++++   EG+++K  D   S Y  + RS +W+K+K +YLE  G+++DL ++G    
Sbjct: 650 KFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 709

Query: 501 PSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDR 560
             K+     G L          +   +Q + E       F + C I  G S+E  + +  
Sbjct: 710 RGKRTGTYGGFL----------LGCYNQDTGE-------FETCCKIGTGFSDEMLQLLHA 752

Query: 561 KTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERKFAAG 617
           +      D    P   Y+   S  P  W +P  + + E+    L  +   ++    F  G
Sbjct: 753 RLTPTIIDG---PKATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFDKG 807

Query: 618 CTL-FGGYCRQIREDKN 633
            +L F  + R IREDK 
Sbjct: 808 VSLRFPRFLR-IREDKG 823

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 100/387 (25%), Positives = 177/387 (45%), Gaps = 40/387 (10%)

Query: 258 NQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFY 317
           + + K+  G+   P LA       + +    G +F  E K DGER Q+H  + G +++ Y
Sbjct: 347 DNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNG-EMRIY 405

Query: 318 SRRATDYTYLYGN-NLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSA 376
           SR   + T  Y   +++   + +  N +K V   +LDCEVV +D+    +LPF ++ +  
Sbjct: 406 SRNGENMTERYPELHIEDFLVKDESNTDKEV-SLILDCEVVAWDNEQNKILPFQVLSTRK 464

Query: 377 KNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSI 436
           +  +    +  +     L  FD+LY NG  L+     +RR+ L ++        +   S+
Sbjct: 465 RKGVELKDVKVR---VCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSL 521

Query: 437 RANDEQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMD 493
              +   I+K L++A+    EG+++K  D   SRY  + RS +W+K+K +YL   G+++D
Sbjct: 522 ITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLD 581

Query: 494 LVLMGR--DPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGIS 551
           L +MG      K+     G L          +   +Q S E       + + C I  G S
Sbjct: 582 LCVMGAYYGKGKRTGTYGGFL----------LGCYNQDSGE-------YETCCKIGTGFS 624

Query: 552 NEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKV-PRQWIDPKKSLILEIKARSLDNT--- 607
           +    E+  K   L+ + E   P  +  F S   P  W +PK  ++ E+    L  +   
Sbjct: 625 D----EMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPK--VLFEVLTADLSLSPIY 678

Query: 608 RSSERKFAAGCTL-FGGYCRQIREDKN 633
           ++    +  G +L F  + R IR+DK+
Sbjct: 679 KAGSATYDKGISLRFPRFLR-IRDDKS 704

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 98/392 (25%), Positives = 171/392 (43%), Gaps = 54/392 (13%)

Query: 258 NQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFY 317
           NQ +K+  G+   P LA       + +    G  F  E K DGER Q+H    GS +K Y
Sbjct: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIY 384

Query: 318 SRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAK 377
           SR   D T  Y        + +++      K  ++D E V +D     +LPF ++ +  +
Sbjct: 385 SRNGEDMTERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440

Query: 378 NMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIR 437
             +    +  +     L  FD+L LN   L++  +++RR+ L      T  + +    + 
Sbjct: 441 KGVELKDVKVR---VCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497

Query: 438 ANDEQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDL 494
             +   ++K L++++    EG+++K  +   S Y  + RS +W+K+K +YLE  G+++DL
Sbjct: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557

Query: 495 VLM------GRDPSKKDSLMLGL--LDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCII 546
           V++      G+        +LG   LD EE                       F + C I
Sbjct: 558 VVLGAYYGRGKRTGTYGGFLLGCYNLDSEE-----------------------FETCCKI 594

Query: 547 ANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQ-WIDPKKSLILEIKARSLD 605
             G S+E  +++  K K    D+    P   + + S  P   W +P  S++ E+    L 
Sbjct: 595 GTGFSDEMLQDLYTKLK----DTTVEHPSTNVIYDSSAPADVWFEP--SMLFEVLTADLS 648

Query: 606 NT---RSSERKFAAGCTL-FGGYCRQIREDKN 633
            +   ++    F  G +L F  + R IR+DKN
Sbjct: 649 LSPVYKAGFEAFGKGISLRFPRFVR-IRDDKN 679

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/387 (24%), Positives = 171/387 (44%), Gaps = 54/387 (13%)

Query: 263 INIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRAT 322
           +  G+   P LA       + +    G  F  E K DGER Q+H    GS ++ YSR   
Sbjct: 346 LTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGE 404

Query: 323 DYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQ 382
           + T  Y        +++F+         +LDCE V +D +  ++LPF ++ +  +  +  
Sbjct: 405 NMTERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVA 460

Query: 383 DGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQ 442
           + +  +     L  FD+L  N   L++    +RR YL++IL P    +++   +      
Sbjct: 461 EDVKVR---VCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLD 517

Query: 443 MIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR 499
            ++  L++++    EG+++K  D   S Y  + RS +W+K+K +YL+  G+++DL ++G 
Sbjct: 518 EMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGA 577

Query: 500 --DPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKE 557
                K+     G L          +   +Q + E       F + C I  G S+E    
Sbjct: 578 YYGRGKRTGTYGGFL----------LGCYNQDTGE-------FETCCKIGTGFSDEM--- 617

Query: 558 IDRKTKGLWNDSEKIPPLE-------YMKFGSKVPRQWIDPKKSLILEIKARSLDNT--- 607
                  L N  EK+ P E       Y+   S  P  W++P  S++ E+    L  +   
Sbjct: 618 -------LQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVY 668

Query: 608 RSSERKFAAGCTL-FGGYCRQIREDKN 633
           ++    +  G +L F  + R IR+DK+
Sbjct: 669 KAGGSSYGKGISLRFPRFIR-IRDDKS 694

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 94/377 (24%), Positives = 167/377 (44%), Gaps = 40/377 (10%)

Query: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325
           G+   P LA       + +    G  F  E K DGER Q+H  N G+ ++ YSR   + T
Sbjct: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446

Query: 326 YLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGI 385
             Y        + +FI      K+ +LDCE V +D +   +LPF ++ +  +  +  + +
Sbjct: 447 ERYPEI----NITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDV 502

Query: 386 DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIK 445
             +     L  FD+L  N   L++    +RREYL ++        +    I  N+   ++
Sbjct: 503 KVK---VCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQ 559

Query: 446 KSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR--D 500
           K L+++++   EG+++K  +   S Y  + RS +W+K+K +YLE  G+++DL ++G    
Sbjct: 560 KFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 619

Query: 501 PSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEI-D 559
             K+     G L          +   +Q + E       F + C I  G S+E  + + D
Sbjct: 620 RGKRTGTYGGFL----------LGCYNQDTGE-------FETCCKIGTGFSDEMLQLLHD 662

Query: 560 RKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERKFAA 616
           R T  + +     P   ++   S  P  W +P  + + E+    L  +   ++    F  
Sbjct: 663 RLTPTIIDG----PKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDK 716

Query: 617 GCTLFGGYCRQIREDKN 633
           G +L      +IREDK 
Sbjct: 717 GVSLRFPRFLRIREDKG 733

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 105/429 (24%), Positives = 185/429 (43%), Gaps = 60/429 (13%)

Query: 230 PDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKIN-----------------IGLAFAPQ 272
           PD +  + V   LE+  +R+ D   ++ N ++ IN                  G+   P 
Sbjct: 338 PDKEIPMDV---LESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPM 394

Query: 273 LATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNL 332
           LA       + +    G  F  E K DGER Q+H  N G+ ++ YSR   + T  Y    
Sbjct: 395 LAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPEI- 452

Query: 333 KTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHP 392
               + +FI    + K+ +LDCE V +D   K +LPF ++ +  +  +    +  +    
Sbjct: 453 ---KITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKV--- 506

Query: 393 LLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSLEKAL 452
            L  FD+L  N   L++    +RRE+L ++        +    I  N+   ++K L++++
Sbjct: 507 CLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESV 566

Query: 453 SVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR--DPSKKDSL 507
           +   EG+++K  D   S Y  + RS +W+K+K +YLE  G+++DL ++G      K+   
Sbjct: 567 NNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGT 626

Query: 508 MLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDRKTKGLWN 567
             G L          +   +Q + E       F + C I  G S+E  + +  +      
Sbjct: 627 YGGFL----------LGCYNQDTGE-------FETCCKIGTGFSDEMLQLLHERLTPTII 669

Query: 568 DSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERKFAAGCTL-FGG 623
           D    P   ++   S  P  W +P  + + E+    L  +   ++    F  G +L F  
Sbjct: 670 DG---PKATFVFDASAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPR 724

Query: 624 YCRQIREDK 632
           + R IREDK
Sbjct: 725 FLR-IREDK 732

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 89/367 (24%), Positives = 161/367 (43%), Gaps = 39/367 (10%)

Query: 261 LKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRR 320
           +K+  G+   P LA       + +       F  E K DGER Q+H    GS ++ YSR 
Sbjct: 348 IKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGS-MRIYSRN 406

Query: 321 ATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNML 380
             D T  Y        + +++  +      +LDCE V +D   + +LPF ++ +  +  +
Sbjct: 407 GEDMTQRYPEL----NIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSV 462

Query: 381 SQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRAND 440
               I  +     L  FD+L  N  +L++    +RR+ L  I  P   + +    +  ++
Sbjct: 463 DLKDIKVRV---CLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSN 519

Query: 441 EQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLM 497
              ++  L+KA+    EG+++K  D   S Y  + RS +W+K+K +YL+  G+++DL ++
Sbjct: 520 LDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVL 579

Query: 498 GR--DPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEY 555
           G      K+     G L          +   +Q +EE       F + C I  G S+E  
Sbjct: 580 GAYYGRGKRTGTYGGFL----------LACYNQDTEE-------FETCCKIGTGFSDEML 622

Query: 556 KEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSERKFA 615
           + +     GL   + + P   ++   S  P  W +P  +++ E+    L    S    + 
Sbjct: 623 QTL---YNGLKETAIESPRANFVFDSSAEPDVWFNP--TMVFEVLTADL----SLSPIYK 673

Query: 616 AGCTLFG 622
           AG T++G
Sbjct: 674 AGSTVYG 680

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 94/377 (24%), Positives = 166/377 (44%), Gaps = 40/377 (10%)

Query: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325
           G+   P LA       + +    G  F  E K DGER Q+H  + G+ ++ YSR   + T
Sbjct: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGT-MRIYSRNGENMT 446

Query: 326 YLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGI 385
             Y        + +FI      K+ +LDCE V +D     +LPF ++ +  +  +    +
Sbjct: 447 ERYPEI----KITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDV 502

Query: 386 DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIK 445
             +     L  FDVL  NG  L++    +RRE L ++        +    I  ++   ++
Sbjct: 503 KVR---VCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQ 559

Query: 446 KSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR--D 500
           K L+++++   EG+++K  +   S Y  + RS +W+K+K +YLE  G+++DL ++G    
Sbjct: 560 KFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYG 619

Query: 501 PSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDR 560
             K+     G L          +   +Q + E       F + C I  G S+E  +++  
Sbjct: 620 RGKRTGTYGGFL----------LGCYNQDTGE-------FETCCKIGTGFSDESLQQLHE 662

Query: 561 KTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERKFAAG 617
           +      D    P   ++   S  P  W +P  + + E+    L  +   ++    FA G
Sbjct: 663 RLTPTIIDG---PKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFAKG 717

Query: 618 CTL-FGGYCRQIREDKN 633
            +L F  + R IREDK 
Sbjct: 718 VSLRFPRFLR-IREDKG 733

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 93/389 (23%), Positives = 169/389 (43%), Gaps = 37/389 (9%)

Query: 211 LLKNRPLGGHEHKLLNCWHPDAQ--DYLSVVSDLETVAKRLWDPSQRLGNQDLKINIGLA 268
           LL N    G E  +      +A+  D    V + E V     D      ++  ++  G+ 
Sbjct: 282 LLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIP 341

Query: 269 FAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLY 328
             P LA       + +    G  F  E K DGER Q+H    G+ ++ YSR   + T  Y
Sbjct: 342 LKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERY 400

Query: 329 GNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQ 388
                  ++ +F+   ++ K  +LDCE V +D   + +LPF ++ +  +  +    +  +
Sbjct: 401 PEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVR 456

Query: 389 GFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSL 448
                L  FD++  NG   ++    +RRE L Q+  P A   +    +  +  + ++K L
Sbjct: 457 ---VCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFL 513

Query: 449 EKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR--DPSK 503
           ++++    EG+++K  D   S Y  + RS +W+K+K +YL+  G+++DL ++G      K
Sbjct: 514 DQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGK 573

Query: 504 KDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEI-DRKT 562
           +     G L          +   +Q S E       F + C I  G S+E  +++ +R +
Sbjct: 574 RTGTYGGFL----------LGCYNQDSGE-------FETCCKIGTGFSDEMLQQLYERFS 616

Query: 563 KGLWNDSEKIPPLEYMKFGSKVPRQWIDP 591
           K   +     P   Y+   S  P  W +P
Sbjct: 617 KTTLDG----PKATYVFDSSAEPDVWFEP 641

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 124/269 (46%), Gaps = 11/269 (4%)

Query: 233 QDYLSVVSDLETVAKRLWDPSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDF 292
           +D    V + E V     D      ++   I  G+   P LA       + +    G  F
Sbjct: 324 RDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTF 383

Query: 293 FIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVL 352
             E K DGER Q+H    G+ ++ YSR   + T  Y        + +F+    +    +L
Sbjct: 384 TSEYKYDGERAQVHLLKDGT-MRIYSRNGENMTERYPEI----QIKDFLADPASTTSLIL 438

Query: 353 DCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPY 412
           DCE V +D     +LPF ++ +  +  ++   I+       L  FD+L  N   L++ P 
Sbjct: 439 DCEAVAWDKEQNKILPFQVLTTRKRKDVN---INEVKVRVCLFAFDILLHNDMRLINEPL 495

Query: 413 YKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYD---SRYV 469
            KRRE L ++  P     +    +  ++   ++K L++++    EG+++K  D   S Y 
Sbjct: 496 SKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYE 555

Query: 470 IASRSDDWIKIKPEYLEQFGENMDLVLMG 498
            + RS +W+K+K +YLE  G+++DL ++G
Sbjct: 556 PSKRSRNWLKLKKDYLEGVGDSLDLCVLG 584

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 93/381 (24%), Positives = 165/381 (43%), Gaps = 42/381 (11%)

Query: 263 INIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRAT 322
           +  G+   P LA       + +    G  F  E K DGER Q+H    GS ++ YSR   
Sbjct: 354 LTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGE 412

Query: 323 DYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQ 382
           + T  Y        +++FI         +LDCE V +D     +LPF ++ +  +  ++ 
Sbjct: 413 NMTERYPEI----RISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAV 468

Query: 383 DGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQ 442
           + +  +     L  FD+L  N   L+  P  +RR  L++ L P    +++   +      
Sbjct: 469 EDVKVRV---CLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLD 525

Query: 443 MIKKSLEKALSVGSEGI---ILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR 499
            ++  L++A+    EG+   IL+  +S Y  + RS +W+K+K +YL+  G+++DL ++G 
Sbjct: 526 ELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGA 585

Query: 500 --DPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKE 557
                K+     G L          +   +Q S E       + + C I  G S E  + 
Sbjct: 586 YYGRGKRTGTYGGFL----------LGCYNQDSGE-------YETCCKIGTGFSEEMLQT 628

Query: 558 I-DRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERK 613
           + DR    L   +   P   Y+   S  P  W +P  +L+ E+    L  +   ++    
Sbjct: 629 LFDR----LSPTAIPTPKAFYVHSESAPPDVWFEP--TLLFEVLTADLSLSPVYKAGTSS 682

Query: 614 FAAGCTL-FGGYCRQIREDKN 633
           +  G +L F  + R +R+DK 
Sbjct: 683 YGKGISLRFPRFIR-LRDDKT 702

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 95/377 (25%), Positives = 166/377 (44%), Gaps = 40/377 (10%)

Query: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325
           G+   P LA       +         F  E K DGER Q+H  N GS ++ YSR   + T
Sbjct: 343 GIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIYSRNGENMT 401

Query: 326 YLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGI 385
             Y     T  + + +NL K++   ++DCE V +D   K +LPF ++ +  +  +    I
Sbjct: 402 ERYPEINVTDFIKD-LNLTKSL---IIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDI 457

Query: 386 DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIK 445
             +     L  FD+L  N   L++    +RRE L  +           K +  N+   ++
Sbjct: 458 KVR---ICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQ 514

Query: 446 KSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR--D 500
             L++++    EG+++K  D   S Y  + RS +W+K+K +YL+  G+++DL ++G    
Sbjct: 515 LFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYG 574

Query: 501 PSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDR 560
             K+     G L          +   +Q + E       F + C I  G S+E  + +  
Sbjct: 575 RGKRTGTYGGFL----------LGCYNQDTGE-------FETACKIGTGFSDEVLQSLYD 617

Query: 561 KTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERKFAAG 617
           + K    D    P   Y+   S  P  W +P  +L+ E+    L  +   ++    ++ G
Sbjct: 618 RLKSTTIDG---PKATYIYDSSAQPDVWFEP--TLLFEVLTADLSMSPIYKAGASTYSKG 672

Query: 618 CTL-FGGYCRQIREDKN 633
            +L F  + R +REDK+
Sbjct: 673 ISLRFPRFIR-LREDKS 688

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 96/383 (25%), Positives = 176/383 (45%), Gaps = 45/383 (11%)

Query: 262 KINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRA 321
           ++  G+   P LA       + +    G  F  E K DGER Q+H    G+ ++ YSR  
Sbjct: 362 QLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGT-MRIYSRNG 420

Query: 322 TDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLS 381
            + T  Y        + +F++ + + +  +LDCE V +D     +LPF ++  S +    
Sbjct: 421 ENMTERYPEI----DIRDFLS-DPSTESLILDCEAVAWDKEQGKILPFQVL--STRKRKD 473

Query: 382 QDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEII-KSIRAND 440
            D  D +     L  FD+L  NG  L++    +R++ L+++  P         K I AN 
Sbjct: 474 VDAKDVK-VRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANI 532

Query: 441 EQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLM 497
           E++ +  L++++    EG+++K  D   S Y  + RS +W+K+K +YL   G+++DL ++
Sbjct: 533 EEL-QHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVL 591

Query: 498 GR--DPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEY 555
           G      K+     G L          +   +Q + E       + + C I  G S E  
Sbjct: 592 GAYYGRGKRTGTYGGFL----------LGCYNQDTGE-------YETCCKIGTGFSEELL 634

Query: 556 KEI-DRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSE 611
           +++ DR    L   + + P   Y+   ++ P  W +P  +L+ E+ A  L  +   ++  
Sbjct: 635 QQLYDR----LKPTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADLSLSPVYKAGS 688

Query: 612 RKFAAGCTL-FGGYCRQIREDKN 633
            ++  G +L F  + R IR+DK+
Sbjct: 689 AQYDKGISLRFPRFLR-IRDDKS 710

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 83/354 (23%), Positives = 153/354 (43%), Gaps = 48/354 (13%)

Query: 292 FFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCV 351
           F  E K DGER Q+H    G+ ++ YSR   + T  Y        + +F+    + K  +
Sbjct: 386 FTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEI----HIRDFVTDLSHTKSLI 440

Query: 352 LDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLP 411
           LDCE V +D     +LPF ++ +  +  +  + I  +     L  FD+L  N   L++  
Sbjct: 441 LDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRV---CLFAFDILLHNDEKLINKS 497

Query: 412 YYKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYD---SRY 468
             +RR+ L  I        +    +   + + ++  L++++    EG+++K  +   S Y
Sbjct: 498 LQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHY 557

Query: 469 VIASRSDDWIKIKPEYLEQFGENMDLVLM------GRDPSKKDSLMLGLLDYEEVIQDSP 522
             + RS +W+K+K +YL   G+++DL ++      G+        +LG            
Sbjct: 558 EPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGC----------- 606

Query: 523 IMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGS 582
              N  + E        F + C I  G S+E  +++  + K    D   +P   Y+   S
Sbjct: 607 --YNQDTGE--------FETACKIGTGFSDEVLQQLHERLKSTVID---LPKATYVFDPS 653

Query: 583 KVPRQWIDPKKSLILEIKARSLDNT---RSSERKFAAGCTL-FGGYCRQIREDK 632
             P  W +P  +L+ E+    L  +   ++    +  G +L F  + R +REDK
Sbjct: 654 AEPDVWFEP--TLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLR-LREDK 704

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 95/418 (22%), Positives = 179/418 (42%), Gaps = 57/418 (13%)

Query: 242 LETVAKRLWDPSQRLGNQDLKIN-----------------IGLAFAPQLATKLHVSYQKI 284
           LET  +++ D   ++ N ++ IN                  G+   P LA       + +
Sbjct: 346 LETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEIL 405

Query: 285 GEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLN 344
               G  F  E K DGER Q+H  + G+ ++ YSR   + T  Y        + +FI   
Sbjct: 406 DRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRNGENMTERYPEI----HIRDFIADP 460

Query: 345 KNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNG 404
                 +LDCE V +D+    +LPF ++ +  +  +    +  +     L  FD+L  N 
Sbjct: 461 LVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKDVKVKV---CLFAFDILCHND 517

Query: 405 ATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRY 464
             L++    +RR+ L+++        +    + +++   ++K L++++    EG+++K  
Sbjct: 518 EKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKML 577

Query: 465 D---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR--DPSKKDSLMLGLLDYEEVIQ 519
           D   S Y  + RS +W+K+K +YLE  G+++DL ++G      K+  +  G L       
Sbjct: 578 DGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFL------- 630

Query: 520 DSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMK 579
              +   +Q + E       F + C I  G S+E  +++  +      D    P   ++ 
Sbjct: 631 ---LGCYNQDTGE-------FETCCKIGTGFSDEMLQQLYTRLTPTVLDG---PKATFVY 677

Query: 580 FGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERKFAAGCTL-FGGYCRQIREDKN 633
             S  P  W +P  +L+ E+    L  +   ++    +  G +L F  + R  REDK 
Sbjct: 678 DSSAEPDVWFEP--TLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIR-TREDKG 732

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 12/104 (11%)

Query: 678 KALEDFAEL-EHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQNVITR 736
           +  E++ EL E    +F+G   Y+     +G  R    + +++K IV +GGQ VQ +  +
Sbjct: 75  RLCEEYEELGEKFRRVFEGCKVYI-----NG--RTDPDREQLRKEIVLHGGQFVQYLTKK 127

Query: 737 NYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIM 780
           +    D+  I ++N      +  R + ++ P W+  C+  GK++
Sbjct: 128 S----DVTHIVAQNLSAAKCIEFRNFKVVQPGWIGACVRIGKML 167

>NCAS0A09420 Chr1 (1869312..1871666) [2355 bp, 784 aa] {ON}
           Anc_1.276 YJL090C
          Length = 784

 Score = 32.7 bits (73), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 30/58 (51%)

Query: 727 GQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEP 784
            Q +++  + N + N + I  S   +  N+   +G  I+  KW+ DC + G +++ +P
Sbjct: 153 SQFLKDAKSLNPSRNIVFITDSATGIRVNAARDQGIPIVHQKWIVDCQIRGAMLQFDP 210

>Kpol_1036.37 s1036 (92633..100114) [7482 bp, 2493 aa] {ON}
            (92633..100114) [7482 nt, 2494 aa]
          Length = 2493

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 59/130 (45%), Gaps = 21/130 (16%)

Query: 254  QRLGNQDLK-INIGL----AFAPQLATK-LHVSYQKIGEKLGWDFFIEE----------- 296
            Q L + D   I+IG+    ++  Q+  + L+  ++ IG +L WD FI +           
Sbjct: 1035 QALADTDASDIDIGVQKVSSYLRQITMRCLYNIFETIGNELSWDEFIVDMFQLVIEPRLA 1094

Query: 297  KMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEV 356
            K +GE +Q   ++    I ++S     Y +LY N+            N NVK+ VL   V
Sbjct: 1095 KFEGENLQ-QPSSILKLISYWSTSEQLYPFLYYNDYSAPAALMRTMSNPNVKESVL---V 1150

Query: 357  VTFDSNNKIV 366
            V  ++ N I+
Sbjct: 1151 VILEAANNII 1160

>ZYRO0D04664g Chr4 (387336..389789) [2454 bp, 817 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346W REV1
           Deoxycytidyl transferase forms a complex with the
           subunits of DNA polymerase zeta Rev3p and Rev7p involved
           in repair of abasic sites in damaged DNA
          Length = 817

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 11/90 (12%)

Query: 691 DIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQNVITRNYNLNDLRIISSRN 750
           DIF G+  YV     +G  +    + ++ ++++ANGG+    + ++      +  I + N
Sbjct: 75  DIFSGVSIYV-----NGFTKP--GRMQLHEMVIANGGKFAHFLSSKG----QVSHIIASN 123

Query: 751 TVECNSLIVRGYDIISPKWVFDCLLSGKIM 780
                 + +  Y I  P+W+ D L  GK++
Sbjct: 124 LPLKKRVELANYKICRPEWIVDSLQRGKLL 153

>TPHA0J00910 Chr10 complement(214418..216256) [1839 bp, 612 aa] {ON}
           Anc_7.247 YER065C
          Length = 612

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 491 NMDLVLMGRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGI 550
           N DLVL+ R  S+  +L+   +D     +D   +V + + E + Q +  ++   I +   
Sbjct: 253 NSDLVLVARTDSEAATLITSTIDK----RDHYFVVGATNPEVDEQSYVDYMDEAISSGNY 308

Query: 551 SNEEYKEIDRK 561
           SNEE  ++++K
Sbjct: 309 SNEELAQVEKK 319

>SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]
           {ON} similar to uniprot|P41695 Saccharomyces cerevisiae
           YGR188C BUB1 Protein kinase that forms a complex with
           Mad1p and Bub3p that is crucial in the checkpoint
           mechanism required to prevent cell cycle progression
           into anaphase in the presence of spindle damage
           associates with centromere DNA via Skp1p
          Length = 982

 Score = 32.0 bits (71), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 35/78 (44%), Gaps = 12/78 (15%)

Query: 290 WDFFI----EEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNK 345
           W+F+I    E+++ GERI     N  S   F      D +YL  N    GT+ + INL K
Sbjct: 716 WEFYILKQVEKRLQGERILKSIINVSSLHCF-----EDESYLVLNYASQGTVLDLINLEK 770

Query: 346 NVKDCVLD---CEVVTFD 360
                 LD   C  +T +
Sbjct: 771 ERSGSSLDELLCMFITVE 788

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,890,687
Number of extensions: 4808513
Number of successful extensions: 14365
Number of sequences better than 10.0: 61
Number of HSP's gapped: 14545
Number of HSP's successfully gapped: 61
Length of query: 946
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 827
Effective length of database: 39,836,145
Effective search space: 32944491915
Effective search space used: 32944491915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)