Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02673g6.15ON26326311921e-167
KAFR0A050606.15ON2692137931e-106
KNAG0F028806.15ON2692147861e-105
KLLA0D01023g6.15ON2682107761e-103
ZYRO0C07920g6.15ON2932127601e-101
NDAI0I022506.15ON2712137561e-100
SAKL0E01056g6.15ON2692337521e-100
KLTH0C11352g6.15ON2682107501e-99
Kpol_1045.746.15ON2572107472e-99
Suva_15.1796.15ON2592107448e-99
Skud_15.1656.15ON2572107334e-97
Kwal_56.223996.15ON2742177327e-97
NCAS0D026606.15ON2612107282e-96
Smik_15.1736.15ON2512107272e-96
YOR004W (UTP23)6.15ON2542097221e-95
ACR011C6.15ON2532117194e-95
TDEL0G045406.15ON2452106872e-90
Ecym_30196.15ON2662136666e-87
TPHA0J002806.15ON2712116642e-86
TBLA0A072906.15ON2592126101e-78
Kwal_55.200895.392ON1891461767e-15
ZYRO0A06754g5.392ON1891461768e-15
KLTH0E02860g5.392ON1891461768e-15
Kpol_1055.185.392ON1891461751e-14
TDEL0E023305.392ON1891461705e-14
NDAI0C045505.392ON1891461706e-14
NCAS0F030905.392ON1891461698e-14
TPHA0D023105.392ON1891461681e-13
CAGL0M01056g5.392ON1891461671e-13
AEL102W5.392ON1891461672e-13
SAKL0G07766g5.392ON1891461662e-13
Ecym_74695.392ON1891461653e-13
KAFR0D042805.392ON1891461635e-13
KNAG0C052705.392ON1891461636e-13
YDR339C (FCF1)5.392ON1891461627e-13
Smik_4.5995.392ON1891461627e-13
Suva_2.5095.392ON1891461627e-13
Skud_4.6065.392ON1891461628e-13
TBLA0H017505.392ON1891461611e-12
KLLA0A07018g5.392ON1891431513e-11
NCAS0A080505.616ON49956711.7
TPHA0F024306.31ON79865683.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02673g
         (263 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   463   e-167
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   310   e-106
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   307   e-105
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   303   e-103
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   297   e-101
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   295   e-100
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   294   e-100
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   293   1e-99
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   292   2e-99
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   291   8e-99
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   286   4e-97
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   286   7e-97
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   285   2e-96
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   284   2e-96
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   282   1e-95
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   281   4e-95
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   269   2e-90
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   261   6e-87
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   260   2e-86
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   239   1e-78
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    72   7e-15
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    72   8e-15
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    72   8e-15
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    72   1e-14
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    70   5e-14
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    70   6e-14
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    70   8e-14
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    69   1e-13
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    69   1e-13
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    69   2e-13
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    69   2e-13
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    68   3e-13
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    67   5e-13
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    67   6e-13
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    67   7e-13
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    67   7e-13
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    67   7e-13
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    67   8e-13
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    67   1e-12
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    63   3e-11
NCAS0A08050 Chr1 (1589715..1591214) [1500 bp, 499 aa] {ON} Anc_5...    32   1.7  
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    31   3.9  

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  463 bits (1192), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 228/263 (86%), Positives = 228/263 (86%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
           CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLSMXXXXXXXXXXXXXXXXSADQSQPTXXXXXX 240
           G      QSKEQTVAKKRKIGPKQPNPLSM                SADQSQPT      
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQQTETSADQSQPTKRRRSR 240

Query: 241 XXXXXXXNSTDTNENGNLSEEEN 263
                  NSTDTNENGNLSEEEN
Sbjct: 241 KHKHGSKNSTDTNENGNLSEEEN 263

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  310 bits (793), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 176/213 (82%), Gaps = 5/213 (2%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D++IV  S+ S +DLVK LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQALYET++++AID+ K FERRRC H P E  +P EC+L+VV+V GKNKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD++IRR LR+VPGVPL+HISRSVMIMEPLSD SAK+S   E+ KL++GLNDPKYAGLK
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 181 GXXXXXXQ---SKEQTVAKKRKIGPKQPNPLSM 210
                  +   S E+T  KKR  GPK PNPLS+
Sbjct: 181 LDEEEATETQGSGEKTAKKKR--GPKGPNPLSV 211

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  307 bits (786), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/214 (66%), Positives = 174/214 (81%), Gaps = 4/214 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVYNHTF+FREPYQV+LDD+IV+ +T SK+DL KAL+RT+QAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQALY T N  AID+ K +ERRRC H P +  SP ECI +VVD+KG+NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
           CQ++++RR LR+VPGVPL+H+SR+VMIMEPLSDASA++S+  E+ KLF GLND K AG+K
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 GXXXXXXQSKEQTV----AKKRKIGPKQPNPLSM 210
                  + K +       KKRK+GPKQPNPLSM
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSM 214

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  303 bits (776), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 172/210 (81%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTFKFR+PYQVL+DDQ+V+++  S +D VK L+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQ+LY+T N+ AID GK+FERRRC H P E  S  EC+ +VVDV GKNKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QDVEIRR LRK+PGVPL++++RSVM+MEPLS+AS KVSR  EE KL++GLNDPK+AG+ 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
                   ++ Q    K++ GPK+PNPLSM
Sbjct: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSM 210

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  297 bits (760), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 169/212 (79%), Gaps = 3/212 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVYN+ F+FREPYQVL+DDQ+V D   S YDLV  LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQALY TKN+ AI+LGK FERRRC H P EA  P ECI +VV+V G NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QDV +RR LRKVPGVPL+H+SRSVM+MEPLS+AS++V+ M E  KL +GLNDPK AGLK
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 GXXXXXX--QSKEQTVAKKRKIGPKQPNPLSM 210
                    +S+ Q  AKKRK GPK PNPLS+
Sbjct: 181 TTPSVENELESESQPPAKKRK-GPKGPNPLSV 211

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  295 bits (756), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 167/213 (78%), Gaps = 3/213 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVYNHTFKFR PYQVL+D+QIV+D + S YDL K LK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQALYE  N+ AI+L + FERRRC H P E  +  ECI +VV++ G+NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD+  RR LR+VPGVPL+HISR+VMIMEPLSD SA+VSR +E  KL++GLNDPK+ G+K
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 181 -GXXXXXXQSKEQT--VAKKRKIGPKQPNPLSM 210
                   + KE T    KKRKIGPK PNPLSM
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSM 213

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  294 bits (752), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 142/233 (60%), Positives = 177/233 (75%), Gaps = 1/233 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTFKFREPYQVL+DDQIVM +  S +DL K LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQALY TK++ AI++ K +ERRRC H P E+ +  ECI +VV+  GKNKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD++IRR LR+VPGVPL++++RSVM+MEPLS+AS ++S++ EE KLF+GLNDPK+AGL 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 181 -GXXXXXXQSKEQTVAKKRKIGPKQPNPLSMXXXXXXXXXXXXXXXXSADQSQ 232
                    S +Q    K+K GPK+PNPLS+                +A+QS+
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKRDQREENTKAPAETAEQSE 233

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  293 bits (750), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 138/210 (65%), Positives = 164/210 (78%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH FKFREPYQVL+DDQIV D+  + +DLVK L+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCC+QA+YETKN+ AI+L K FERRRC H P EA  P EC+ +VV V G NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD  IR+ LR+VPGVPL++++RSVM+MEPLS AS   SR +E+ KLF+GLNDPKYAGL 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
                        V+K ++ GPK PNPLS+
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLSI 210

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  292 bits (747), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 167/210 (79%), Gaps = 2/210 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQ+RAKSYRKQ+LVYNHTFKFREPYQ ++DDQ+V+D   SK+D++K LKRTLQAEVK M
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQALY+T N+ AI + KEFERRRC H P +  SP ECI ++VD+KG NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD++IRR LRK+PGVP++H+SR+VMI+EPLSDAS K+S   E+ KL++GLND K+    
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTA-- 178

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
           G      +  E+T   K+  GPKQPNPLSM
Sbjct: 179 GLDEPKSEKSEKTSESKKNKGPKQPNPLSM 208

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  291 bits (744), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 167/210 (79%), Gaps = 3/210 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V + + S +DL   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCC+QALYET+NE AIDL K+FERRRC H   +  SP ECI +VV+V G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD+++RR LR VPGVPL+H++RSVMIMEPLS ASAK SRM EE KL++GLNDP    ++
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 177

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
                   S++++  KKRK GPK PNPLSM
Sbjct: 178 KAEAISKGSEKESTPKKRKAGPKAPNPLSM 207

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  286 bits (733), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 138/210 (65%), Positives = 166/210 (79%), Gaps = 3/210 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V + + S ++L   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCC+QALYET+NE AIDL K+FERRRC H   +  SP ECI +VVDV G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD+ +RR LR VPGVPL+H++RSVMIMEPLS ASAK S+  EE KLF+GLNDP    ++
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 177

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
                  +S +++  KKRKIGPK PNPLS+
Sbjct: 178 KTEKVSSESGKESAPKKRKIGPKAPNPLSV 207

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  286 bits (732), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 141/217 (64%), Positives = 165/217 (76%), Gaps = 8/217 (3%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH FKFREPYQVL+DDQIV D+  + +DLVK LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCC+QA+YET ++ AI+L K FERRRC H P EA  P EC+ +VV+V G NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGL- 179
            Q+ EIR  LRKVPGVPL+ ++RSVM+MEPLS AS  VSR++E  KLF+GLNDPK+AGL 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 180 ------KGXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
                         +      AKKRK GPK PNPLS+
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRK-GPKGPNPLSI 216

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  285 bits (728), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 138/210 (65%), Positives = 164/210 (78%), Gaps = 1/210 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVYNHTF+FREPYQ+L+D+QIV D +TS YDL K L RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQALYE  +++AI+L + FERRRC H P +  +P ECI +VV++ G+NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QDV IRR LR+VPGVPL+HISR+VMIMEPLSDASAKVS+ +E  KL++GLNDPKY G+K
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
                     +    K +    K PNPLSM
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGP-KSPNPLSM 209

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  284 bits (727), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 166/210 (79%), Gaps = 3/210 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V++   S ++L   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCC+QALYET+NE AIDL K+FERRRC H   +  SP +CI +VVD+ G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD+ +RR LR VPGVPL+H++RSVM+MEPLS ASAK S+M EE KL++GLNDP    ++
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
                   S +++V KKRK GPK PNPLS+
Sbjct: 181 ---EISEGSGKESVTKKRKFGPKAPNPLSV 207

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  282 bits (722), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 167/209 (79%), Gaps = 3/209 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D+Q+V++   S ++L   LKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCC+QALYET+N+ AI+L K+FERRRC H   +  SP ECI +VV++ G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD+++RR LR VPGVPL+H++RSVM+MEPLS ASAK S++ EE KL++GLNDP    L+
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLS 209
                   S ++++ KKRK+GPK PNPLS
Sbjct: 181 ---ESGDGSGKESITKKRKLGPKAPNPLS 206

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  281 bits (719), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 165/211 (78%), Gaps = 3/211 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTFKFREPYQVL+DDQIV+++  S +DL+K LKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQ LY+TKN+ AI  GK +ERRRC H+  E   P EC+ +VV V G+N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHV-KEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGL- 179
            QD+ IRR LRKVPGVPL++I+R+VM+MEPLS  S +VSR  E+ KLF+GLNDPKY G+ 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 180 KGXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
           +       Q  E     KRK GPK PNPLSM
Sbjct: 180 ENSAPAGAQPAEGAPTLKRK-GPKAPNPLSM 209

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  269 bits (687), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 159/210 (75%), Gaps = 10/210 (4%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAK+YRKQ+LVYNHTFKFREPYQVL+D+QIV+D   S +DLVK L+RTLQAEVK M
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCCMQALYET  + AI+L K FERRRC H P E   P EC+ ++V V G NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD++ RR+LR+ PGVPL+H  RSVM+MEPLSDASAKVS   E  KL +GLNDP+ AG+K
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 GXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
                      QT  KKR    KQPNPLS+
Sbjct: 181 T-------ENPQTSIKKR---TKQPNPLSV 200

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  261 bits (666), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 132/213 (61%), Positives = 164/213 (76%), Gaps = 4/213 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTFKFR+PYQVL+DDQ+V+++  S +DL+K LKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120
           ITQCC+Q LYE+KN+ AI   K +ERRRC H   E   P ECI +VVD+ G+N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHY-KEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180
            QD+EIRR+LR+VPGVPL++++RSVM+MEPLS  S +VS+  E  KL +GLNDPKYAG  
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 GXXXXXXQSKEQTVAK--KRKI-GPKQPNPLSM 210
                     +   A   KRKI GPK+PNPLS+
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSI 212

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  260 bits (664), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 124/211 (58%), Positives = 162/211 (76%), Gaps = 2/211 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAE-VKP 59
           MRQKRAKSY+KQ++VYNHTFKFREPYQ+L+D+QIV DS  S Y+L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVV 119
           MITQCCMQ LY T N+  ID  K FERRRC H   +   P ECI ++V++ G+NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ACQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGL 179
           A Q++E+RR LR+VPGVP+LH+SRSVMIMEP+SD+S +++R  E+SKL++GLNDPKY+  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 KGXXXXXXQSK-EQTVAKKRKIGPKQPNPLS 209
                    ++  Q  A K++ G K+PNPLS
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLS 211

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  239 bits (610), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 118/212 (55%), Positives = 155/212 (73%), Gaps = 13/212 (6%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAE--VK 58
           MRQKRAKSY+KQL+VYNHTFKFREPYQV++DD +V ++  +KY+L+K L   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  PMITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYV 118
           PMITQCC+ ALY+++++ +I +GK FERRRC H   E +SP EC+L++VDV GKNKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VACQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAG 178
           VA QD+E+RR LRK+PGVPL+H  RSVM+MEPLSDAS + +   E  KL  GLN  K A 
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK-AS 179

Query: 179 LKGXXXXXXQSKEQTVAKKRKIGPKQPNPLSM 210
           ++G        +E  + KK+  G    NPLSM
Sbjct: 180 VEG-------GQENGIKKKKVKG---VNPLSM 201

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 72.4 bits (176), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K DLV+ +  TL A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +C++N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSH---KGTYADDCLVNRV-----LQHKCYIVATNDAALKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RKVPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 72.4 bits (176), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYETK 73
           L + +    R PYQVL+D   +  S   K D+VK +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NEHAIDL----GKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            ++ I L        +R  C H   +     +C++N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTH---KGTYADDCLVNRV-----MQHKCYIVATNDAPLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L DA
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 72.4 bits (176), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+V+ +  TL A+  PMIT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +C++N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSH---KGTYADDCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RKVPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 72.0 bits (175), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYETK 73
           L + +    + PYQVL+D   +  S   K D++K +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NEHAIDL----GKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            ++ I L        +R  C H   +     +CI+N V      +H+ Y+VA  DV +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCIVNRV-----LQHKCYIVATNDVGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RKVPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 70.1 bits (170), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K DLV+ +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +CI+N V      +H+ Y+VA  D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTH---KGTYADDCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +      +E L DA
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 70.1 bits (170), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K DLV+ +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +CI+N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 69.7 bits (169), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 72/146 (49%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYETK 73
           L + +    + PYQVL+D   +  S   K DLVK +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NEHAIDL----GKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            ++ I L        +R  C H   +     +CI+N V      +H+ ++VA  D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCIVNRV-----LQHKCFIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 71/146 (48%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYETK 73
           L +      R PYQVL+D   +  S   K D++K +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NEHAIDL----GKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            ++ I L        +R  C H   +     +CI+N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCIVNRV-----LQHKCYIVATNDQGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+VK +   L A+  P+IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +CI+N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTH---KGTYADDCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K DLV+ +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +C++N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSH---KGTYADDCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RKVPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 72/146 (49%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYETK 73
           L + +    + PYQVL+D   +  S   K D+V+ +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  NEHAIDL----GKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            ++ I L        +R  C H   +     +C++N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSH---KGTYADDCLVNRV-----LQHKCYIVATNDAALKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RKVPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+V+ +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H         +C++N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSH---RGTYADDCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RKVPG+PLL +     ++E L D 
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPDV 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.4 bits (163), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+V+ +   L A+  P+IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +CI+N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+V+ +   L A+  P+IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +C++N V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+V+ +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +C+++ V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+V+ +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +C+++ V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+V+ +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +C+++ V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.0 bits (162), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+V+ +   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +C+++ V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+V+ +   L A+  P+IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H         +CI+N V      +H+ Y+VA  D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSH---RGTYADDCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPLSDA 154
            +RK+PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPDV 188

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 72/143 (50%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S   K D+VK +   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 73  -KNEHAIDLGKE--FERRRCGHMPGEAVSPKECILNVVDVKGKNKHR-YVVACQDVEIRR 128
            K   A+ L ++   +R  C H   +     +CI++ V      +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCIVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 LLRKVPGVPLLHISRSVMIMEPL 151
            +RKVPG+PL+ +     ++E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>NCAS0A08050 Chr1 (1589715..1591214) [1500 bp, 499 aa] {ON}
           Anc_5.616 YDR257C
          Length = 499

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 94  GEAVSPKECILNVVDVKGKNKHRYVVACQDVEIRRLLRKVPGVPLLHISRSVMIME 149
           G  +SPK   + + D +  N+ R+++A +D++   LL ++P   +L++  S ++ E
Sbjct: 22  GYKLSPK---IKIADGRDTNQGRFILATEDIKTDELLFEIPRESILNVLTSSLVSE 74

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 30.8 bits (68), Expect = 3.9,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 12  QLLVYNHTFKFREPYQVLLDDQIVMD--STTSKYDLVKALKRTLQAEVKPMITQCCMQAL 69
           Q L Y+H  KF + ++  L+  I+++     S  DL+K  K   +AEVK M TQ C    
Sbjct: 145 QNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVCGAIN 204

Query: 70  YETKN 74
           Y   N
Sbjct: 205 YMHSN 209

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,260,870
Number of extensions: 820925
Number of successful extensions: 1966
Number of sequences better than 10.0: 46
Number of HSP's gapped: 1954
Number of HSP's successfully gapped: 46
Length of query: 263
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 156
Effective length of database: 41,212,137
Effective search space: 6429093372
Effective search space used: 6429093372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)