Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02651g6.14ON48548524590.0
Kwal_56.223876.14ON54341711431e-151
KLTH0C11396g6.14ON55043011281e-149
ACR012C6.14ON54142011021e-145
SAKL0E01012g6.14ON54442210971e-144
KLLA0D00979g6.14ON56142010851e-142
TBLA0A073006.14ON57342910851e-142
Skud_5.296.14ON60843410711e-140
Smik_5.276.14ON60841610711e-140
YEL060C (PRB1)6.14ON63541610681e-139
Ecym_30186.14ON57542410621e-139
TDEL0G045506.14ON56441310591e-138
Suva_5.76.14ON66441610611e-137
ZYRO0C07942g6.14ON54841710381e-136
NCAS0F002206.14ON69541410421e-134
Kpol_1032.56.14ON68041610401e-134
CAGL0B03619g6.14ON46842310211e-134
NDAI0K028806.14ON70443010381e-134
KAFR0L003606.14ON50243610171e-133
KNAG0E009206.14ON53141410151e-132
YOR003W (YSP3)6.14ON47842310101e-132
Skud_15.1646.14ON48241410071e-132
Kpol_1045.756.14ON47742010021e-131
Smik_15.1726.14ON4784279921e-130
Suva_15.1786.14ON4764149821e-128
TPHA0M002306.14ON5854209211e-118
KAFR0B065506.14ON4564178991e-116
NCAS0D026306.14ON4514158961e-116
KNAG0F02970singletonON4204208511e-109
NDAI0I022806.14ON4824268001e-101
CAGL0L13266gsingletonON5794256091e-71
SAKL0A02002g6.313ON4794094432e-48
Kwal_23.61836.313ON4933234344e-47
KLTH0A06094g6.313ON4963134328e-47
Smik_3.1496.313ON4913204142e-44
YCR045C (RRT12)6.313ON4913284126e-44
Kpol_1018.56.313ON4653244099e-44
ZYRO0D08822g6.313ON4903144091e-43
Kpol_1028.616.313ON5183154083e-43
Skud_3.1246.313ON5403284084e-43
NCAS0D043906.313ON4923174021e-42
TDEL0A072806.313ON4363243955e-42
Suva_3.846.313ON5273503987e-42
KNAG0I024706.313ON4753183941e-41
NDAI0I005606.313ON4833243941e-41
TBLA0F039706.313ON7343164022e-41
CAGL0L10802g6.313ON5173343925e-41
Ecym_21056.313ON6103123886e-40
AAR069W6.313ON7682973901e-39
KLLA0F06028g6.313ON5083243741e-38
TPHA0D037606.313ON6072623683e-37
KAFR0J024506.313ON4782753581e-36
TBLA0A067006.313ON4973093212e-31
Kwal_33.133721.78ON3773033101e-30
KLTH0F02288g1.78ON3803102703e-25
Kpol_2000.691.78ON3863082474e-22
TDEL0C062301.78ON3643022252e-19
ZYRO0F16764g1.78ON3863162173e-18
TPHA0B045201.78ON3883151909e-15
TBLA0A054101.78ON3823501596e-11
TDEL0A054308.598ON67979830.16
Ecym_64862.6ON78194810.27
KLTH0H00418g2.6ON81197790.46
CAGL0L08624g8.69ON208457790.51
Kwal_56.248002.6ON80396761.0
TBLA0B001302.6ON842109741.9
Skud_14.1012.6ON81993742.1
YNL238W (KEX2)2.6ON81493732.4
Smik_14.972.6ON81494705.8
Suva_14.1062.6ON80990706.2
Kpol_1015.82.6ON84391696.9
NDAI0F038902.6ON83394697.1
NCAS0A008802.6ON83395688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02651g
         (485 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   951   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   444   e-151
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   439   e-149
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   429   e-145
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   427   e-144
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   422   e-142
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   422   e-142
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   417   e-140
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   417   e-140
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   416   e-139
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   413   e-139
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   412   e-138
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   413   e-137
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   404   e-136
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   405   e-134
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   405   e-134
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   397   e-134
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   404   e-134
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   396   e-133
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   395   e-132
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   393   e-132
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   392   e-132
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   390   e-131
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   386   e-130
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   382   e-128
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   359   e-118
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   350   e-116
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     349   e-116
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              332   e-109
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   312   e-101
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   239   1e-71
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   175   2e-48
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   171   4e-47
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   171   8e-47
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   164   2e-44
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   163   6e-44
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   162   9e-44
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   162   1e-43
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   161   3e-43
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   161   4e-43
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   159   1e-42
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   156   5e-42
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   157   7e-42
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   156   1e-41
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    156   1e-41
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   159   2e-41
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   155   5e-41
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   154   6e-40
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   154   1e-39
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   148   1e-38
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   146   3e-37
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   142   1e-36
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   128   2e-31
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   124   1e-30
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   108   3e-25
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   100   4e-22
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    91   2e-19
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...    88   3e-18
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    78   9e-15
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    66   6e-11
TDEL0A05430 Chr1 (950727..952766) [2040 bp, 679 aa] {ON} Anc_8.5...    37   0.16 
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    36   0.27 
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    35   0.46 
CAGL0L08624g Chr12 (940058..946312) [6255 bp, 2084 aa] {ON} simi...    35   0.51 
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    34   1.0  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    33   1.9  
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    33   2.1  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    33   2.4  
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    32   5.8  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    32   6.2  
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    31   6.9  
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    31   7.1  
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    31   8.9  

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/485 (95%), Positives = 464/485 (95%)

Query: 1   MFSFYLITSVYYFWIFTSVDAATIPVDLSHRESASHDYTLINRLLNLWRGKGIEYNFNTG 60
           MFSFYLITSVYYFWIFTSVDAATIPVDLSHRESASHDYTLINRLLNLWRGKGIEYNFNTG
Sbjct: 1   MFSFYLITSVYYFWIFTSVDAATIPVDLSHRESASHDYTLINRLLNLWRGKGIEYNFNTG 60

Query: 61  SKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYN 120
           SKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYN
Sbjct: 61  SKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYN 120

Query: 121 DISTRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHV 180
           DISTRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHV
Sbjct: 121 DISTRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHV 180

Query: 181 PWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVEN 240
           PWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVEN
Sbjct: 181 PWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVEN 240

Query: 241 DNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND 300
           DNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND
Sbjct: 241 DNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND 300

Query: 301 LKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWS 360
           LKKTKSNLKGAAGNMSLGAWKS                     GNESDDACNSSPASAWS
Sbjct: 301 LKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWS 360

Query: 361 PITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVL 420
           PITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVL
Sbjct: 361 PITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVL 420

Query: 421 AYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLS 480
           AYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLS
Sbjct: 421 AYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLS 480

Query: 481 KFWGT 485
           KFWGT
Sbjct: 481 KFWGT 485

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  444 bits (1143), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 219/417 (52%), Positives = 286/417 (68%), Gaps = 7/417 (1%)

Query: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSD--FGKATQYNDI----STRGI 127
           IP+RYIV+FKD V  +E+  H+  + E ++ S+   D++  F +AT   ++    ++R  
Sbjct: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139

Query: 128 GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRI 187
           G+   F +   + GYIGYFT+    FI  +PLV  VE DS+V  N +  Q   PWGL RI
Sbjct: 140 GILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRI 199

Query: 188 SQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLN 247
           S REKL +     Y YDD  GK   ++VIDTGI +DH+DFEGRA+WGKT+  ND D D N
Sbjct: 200 SHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGN 259

Query: 248 GHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKTKS 306
           GHGTHCAGTIASKHYG+AK A V+AVKVLRS+GSGSMSDV++GVE+  +++ D +KK K 
Sbjct: 260 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKK 319

Query: 307 NLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGG 366
             KG+  NMSLG  KS                     GNE+ DACNSSPA+A + ITVG 
Sbjct: 320 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGA 379

Query: 367 STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSL 426
           STL+DD A+FSN+G+CVDIFAPG+N++STYIGS+ AT +LSGTSM+SPHVAG+L Y+LSL
Sbjct: 380 STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSL 439

Query: 427 QPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
           QPD  S+++H    I+P  LKKK++ Y+T   L  LP +TVN L+YNGGG++L  FW
Sbjct: 440 QPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  439 bits (1128), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 220/430 (51%), Positives = 284/430 (66%), Gaps = 17/430 (3%)

Query: 72  MIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI---------------FLQDSDFGKA 116
           + IP+RYIV+FK  ++ +E+  H   + E +  S+               F++D DF   
Sbjct: 77  LAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELD 136

Query: 117 TQYN-DISTRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYK 175
            Q +    TR  G+Q  F +   +TGYIGYFT+    FI  +PLV+ VE DS+V    + 
Sbjct: 137 YQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFG 196

Query: 176 MQEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGK 235
            Q   PWGL RIS REKL +     Y YDD  GK   ++VIDTG+ VDH+DFEGRASWGK
Sbjct: 197 TQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGK 256

Query: 236 TIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTV 295
           TI  ND D D NGHGTHCAGTIASKHYG+AK A V+AVKVLRS+GSGSMSDV++GVE+  
Sbjct: 257 TIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAA 316

Query: 296 EAYND-LKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSS 354
           +++ D +K+ K   KG+  NMSLG  KS                     GNE+ DACNSS
Sbjct: 317 KSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSS 376

Query: 355 PASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSP 414
           PASA + +TVG STL+DD A+FSN+G+CVDIFAPG+N++STYIGS  AT +LSGTSM+SP
Sbjct: 377 PASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASP 436

Query: 415 HVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNG 474
           HVAG+L Y+LSLQPD  S+++H    I+P  LKKK++ Y+T   L  +P +TVN L++NG
Sbjct: 437 HVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNG 496

Query: 475 GGKNLSKFWG 484
           GG+ L  FWG
Sbjct: 497 GGEGLDDFWG 506

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  429 bits (1102), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 214/420 (50%), Positives = 285/420 (67%), Gaps = 10/420 (2%)

Query: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQD-------SDFGKATQYNDISTRG 126
           IP++YIV+F++ V+D+E   H+  +E  ++ S+   D       S  G+  ++   +TR 
Sbjct: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130

Query: 127 IG-LQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLG 185
            G ++ EF++G  + GY+GYFTE     + ++P V  VE DS+V  +++  Q   PWGL 
Sbjct: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLA 190

Query: 186 RISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYD 245
           R+S REKL       Y YDD  G+   ++VIDTGI +DH DFE RA WGKTI  ND DYD
Sbjct: 191 RVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250

Query: 246 LNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKT 304
            NGHGTHCAGTIASK YG+AK+A V+AVKVLRS+G+GSMSDV+RGVEY V+A+    +K 
Sbjct: 251 GNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310

Query: 305 KSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITV 364
               KG+  NMSLG  +S                     GNE+ DACN+SPA++   ITV
Sbjct: 311 DKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITV 370

Query: 365 GGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYL 424
           G STL+DD A+FSN+GRCVD+FAPG+NI+STYIGS  A  +LSGTSM+SPHVAG+L Y+L
Sbjct: 371 GASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFL 430

Query: 425 SLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFWG 484
           SLQPD  S+F ++ + ISP++LKKKV+++ T   LS LPA T N+L+YNGGG +LS FWG
Sbjct: 431 SLQPDGDSEFRNKQT-ISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWG 489

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  427 bits (1097), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 218/422 (51%), Positives = 283/422 (67%), Gaps = 12/422 (2%)

Query: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSD-------FGKATQYN--DIS 123
           IIP+RYI++FK   T +EI  H   I E ++ S+   DS         G A +Y     S
Sbjct: 77  IIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKS 136

Query: 124 TRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWG 183
           + G G+Q  F I   + GYIGYFT+    FI  +  VE +E DS+V  + +  Q   PWG
Sbjct: 137 SEG-GIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWG 195

Query: 184 LGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDND 243
           L RIS RE+L +     Y YDD  GK   ++VIDTGI V+H+DF GRA WGKT+ +ND D
Sbjct: 196 LSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDED 255

Query: 244 YDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDL-K 302
            D NGHGTHCAGTIAS+HYG+AK AEV+A+KVLRS+GSG+MSDV++GVE+  +++ +  K
Sbjct: 256 ADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASK 315

Query: 303 KTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPI 362
           K K   KG+  NMSLG  KS                     GNE+ DACN+SPA+A + I
Sbjct: 316 KNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAI 375

Query: 363 TVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAY 422
           TVG STLSDD A+FSN+G+CVDIFAPG+N++STYIGS+ AT +LSGTSM+SPHVAG+L Y
Sbjct: 376 TVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTY 435

Query: 423 YLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKF 482
           +LSLQPD  S+F+ + S I+P  LKKK++ Y+T   L  LP +T N L+YNGGG++LS F
Sbjct: 436 FLSLQPDSDSEFF-QASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDF 494

Query: 483 WG 484
           WG
Sbjct: 495 WG 496

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  422 bits (1085), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 209/420 (49%), Positives = 281/420 (66%), Gaps = 9/420 (2%)

Query: 74  IPNRYIVLFKDFVTDKEIQSH--LSAIEEINSSSIFLQDSDFGKAT--QYNDISTRGI-- 127
           IPNRYI++FK   +  E++ H  L ++E   +      +  F  AT  ++++   +    
Sbjct: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156

Query: 128 --GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLG 185
             G+Q  F I  S++GY+GYFT+    FI  SPLVE VE DS+V  N++  Q   PWGL 
Sbjct: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216

Query: 186 RISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYD 245
           RIS REKL +     Y YDD  GK    +V+DTG+ V+H+DF+GRA WGKTI ++D D D
Sbjct: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276

Query: 246 LNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKT 304
            NGHGTHCAGTI S HYG+AK A+++AVKVLRS+GSG+MSDV++GVEY  EA+   +++ 
Sbjct: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336

Query: 305 KSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITV 364
           K   KG+  NMSLG  KS                     GNE+ DACN+SPA+A + ITV
Sbjct: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396

Query: 365 GGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYL 424
           G STLSD+ A+FSN+G+CVDIF PG+NI+STYIGS  AT +LSGTSM++PHV G+L Y+L
Sbjct: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFL 456

Query: 425 SLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFWG 484
           SLQPD  S+++H    I+P  LKKK+++++T   LS LP +TVN L+YNGGG++L   WG
Sbjct: 457 SLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWG 516

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  422 bits (1085), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 221/429 (51%), Positives = 279/429 (65%), Gaps = 11/429 (2%)

Query: 61  SKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYN 120
           + +Y  S     IIP+RYI+ FK  V  +EI  H  +I E+   SI     D      +N
Sbjct: 112 APLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDH---PYFN 168

Query: 121 DISTRGIGLQH----EFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKM 176
             S  G+ LQ      F+I   + GYIGYFT+    FI  +PLV+ VE DS V IN +  
Sbjct: 169 --SVEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDT 226

Query: 177 QEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKT 236
           Q   PWGL RIS RE+L +     Y +DD+ G+    +VIDTG+ V+H DFEGRASWGKT
Sbjct: 227 QNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKT 286

Query: 237 IVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVE 296
           I  ND D D NGHGTHCAGTIASKHYG+AK A V+AVKVLRS+GSGSMSDV++GVEY   
Sbjct: 287 IPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATA 346

Query: 297 AY-NDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSP 355
           ++  D+K  KS  KG+  NMSLG  KS                     GNE+ DACN+SP
Sbjct: 347 SHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSP 406

Query: 356 ASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPH 415
           ASA   ITVG STLSDD A+FSN+G+CVD+FAPG+NI+STYIGS +AT +LSGTSM+SPH
Sbjct: 407 ASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPH 466

Query: 416 VAGVLAYYLSLQPDHKSQFY-HEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNG 474
           VAG+L+Y+LSLQP+  S+F       I+P  LKK++++Y T   L  +P  T N+LV+NG
Sbjct: 467 VAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNG 526

Query: 475 GGKNLSKFW 483
            G++LS FW
Sbjct: 527 AGQDLSDFW 535

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  417 bits (1071), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 215/434 (49%), Positives = 282/434 (64%), Gaps = 17/434 (3%)

Query: 61  SKIYFDSAKNDMIIPNRYIVLFK--------DFVTDKEIQSHLSAIEEINSSSIFLQDSD 112
           S   FD A    IIPNRYI++FK        DF  +   Q+ L ++E +++   F     
Sbjct: 139 STAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFF---- 194

Query: 113 FGKATQYNDISTRGIG-LQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRI 171
              +T+ + +ST   G +Q  F+I    +GYIGYFT+     I  +PLV+ VE DS+V  
Sbjct: 195 --ISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEA 252

Query: 172 NNYKMQEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRA 231
            ++  Q   PWGL RIS RE+L +     Y YDD  G+   ++VIDTG+ V+H+DFE RA
Sbjct: 253 TDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRA 312

Query: 232 SWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGV 291
            WGKTI  ND D D NGHGTHCAGTIASKHYG+AK A V+AVKVLRS+GSG+MSDV++GV
Sbjct: 313 IWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGV 372

Query: 292 EYTVEAYN-DLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDA 350
           EY   A+    ++ K   KG+  NMSLG  KS                     GNE+ DA
Sbjct: 373 EYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDA 432

Query: 351 CNSSPASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTS 410
           CN+SPASA   ITVG STLSDD A+FSN+G+CVDIFAPG+NI+STYIGS +AT +LSGTS
Sbjct: 433 CNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTS 492

Query: 411 MSSPHVAGVLAYYLSLQPDHKSQFYHE-HSAISPKILKKKVLNYATNGTLSYLPAETVNL 469
           M+SPHVAG+L Y+LSLQP   S+F+     +++P+ LK K+++Y+T   L  +P +T N 
Sbjct: 493 MASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNA 552

Query: 470 LVYNGGGKNLSKFW 483
           L+YNGGG++LS FW
Sbjct: 553 LIYNGGGQDLSAFW 566

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  417 bits (1071), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 210/416 (50%), Positives = 277/416 (66%), Gaps = 5/416 (1%)

Query: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDIST-RGIGL 129
           IIPNRYIV+FK  V ++E+  H  ++ +    S+     +  F  +T+   +ST    G+
Sbjct: 151 IIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGI 210

Query: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189
           Q  F+I    +GYIGYFT+     I  +PLV+ VE DS+V    +  Q   PWGL RIS 
Sbjct: 211 QDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISH 270

Query: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249
           RE+L +     Y YDD  G+   ++VIDTG+ ++H+DFE RA WGKTI  ND D D NGH
Sbjct: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 330

Query: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYN-DLKKTKSNL 308
           GTHCAGTIASKHYG+AK A V+AVKVLRS+GSG+MSDV++GVEY  +A+    ++ K   
Sbjct: 331 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKKGF 390

Query: 309 KGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGST 368
           KG+  NMSLG  KS                     GNE+ DACN+SPASA   ITVG ST
Sbjct: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450

Query: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428
           LSDD A+FSN+G+CVD+FAPG+NI+STYIGS  AT +LSGTSM+SPHVAG+L Y+LSLQP
Sbjct: 451 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQP 510

Query: 429 DHKSQFYH-EHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
              S+F+     +++P+ LKKK+++Y+T   L  +P +T N L+YNGGG++LS FW
Sbjct: 511 GSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  416 bits (1068), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 210/416 (50%), Positives = 278/416 (66%), Gaps = 5/416 (1%)

Query: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDIST-RGIGL 129
           IIPNRYI++FK     +EI  H   +++    S+     +  F  +T+   +ST    G+
Sbjct: 178 IIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGI 237

Query: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189
           Q  F+I    +GYIGYFT+     I  +PLV+ VE DSIV    +  Q   PWGL RIS 
Sbjct: 238 QDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISH 297

Query: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249
           RE+L +     Y YDD  G+   ++VIDTG+ ++H+DFE RA WGKTI  ND D D NGH
Sbjct: 298 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 357

Query: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYN-DLKKTKSNL 308
           GTHCAGTIASKHYG+AK A V+AVKVLRS+GSG+MSDV++GVEY  +A+  + ++ K   
Sbjct: 358 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKGF 417

Query: 309 KGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGST 368
           KG+  NMSLG  KS                     GNE+ DACN+SPASA   ITVG ST
Sbjct: 418 KGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGAST 477

Query: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428
           LSDD A+FSN+G+CVD+FAPG+NI+STYIGS +AT +LSGTSM+SPHVAG+L Y+LSLQP
Sbjct: 478 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 537

Query: 429 DHKSQFYH-EHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
              S+F+     +++P+ LKKK+++Y+T   L  +P +T N+L+YNGGG++LS FW
Sbjct: 538 GSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  413 bits (1062), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 214/424 (50%), Positives = 275/424 (64%), Gaps = 15/424 (3%)

Query: 70  NDMIIPNRYIVLFKDFVTDKEI--------QSHLSAIEEINSSSIFLQDSDFGKATQYND 121
           N   IP+RYIV+FKD VTD ++         +H+  I +++    F    D  +   +  
Sbjct: 105 NSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFF---DATEGMHHEG 161

Query: 122 ISTRGI--GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEH 179
           IS R +  G++  F I  S+ GY GYFT+     I  S LV+L+E DSIV  ++++ Q  
Sbjct: 162 ISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTG 221

Query: 180 VPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVE 239
            PWGL R+S RE+L +     Y YDD  GK    +VIDTGI +DH +FEGRA WGKTI  
Sbjct: 222 APWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPS 281

Query: 240 NDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYN 299
           ND DYD NGHGTHCAGTIASK YG+AK A+V+AVKVLR++G+G+MSDV+RGVEY V  + 
Sbjct: 282 NDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHR 341

Query: 300 DLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAW 359
                  N KG+  NMSLG  KS                     GNE+ DACN+SPAS+ 
Sbjct: 342 K-ASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSK 400

Query: 360 SPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGV 419
             ITV  STLSDD A+FSN+G CVDIFAPG+NI+STYIGS  A  +LSGTSM+SPHVAG+
Sbjct: 401 KCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGL 460

Query: 420 LAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNL 479
           LAY+LSLQPD  S++Y   S+ISP+ LKKK++ Y +   L+ +PA T N L++NGGG +L
Sbjct: 461 LAYFLSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSL 519

Query: 480 SKFW 483
             FW
Sbjct: 520 DSFW 523

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  412 bits (1059), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 214/413 (51%), Positives = 271/413 (65%), Gaps = 9/413 (2%)

Query: 75  PNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDISTRGIGLQHE 132
           P+RYIV+ K   + +EI  H+ AI +    S+    QD  F  A     + T G G+Q  
Sbjct: 112 PHRYIVVLK-HSSPEEIALHMEAITQSQLQSVGELAQDDPFFSA---QGVRTTG-GIQDS 166

Query: 133 FSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREK 192
           F +   + GY+GYFT+   + I  SP+V+ VE DS V  + +  Q   PWGL RIS RE+
Sbjct: 167 FDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRER 226

Query: 193 LPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHGTH 252
           L +     Y +DD  GK   ++VIDTGI V H+DFEGRA WGKTI  ND D D NGHGTH
Sbjct: 227 LNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTH 286

Query: 253 CAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKTKSNLKGA 311
           CAGTIASKHYG+AK A+V+AVKVLRS+GSGSMSDVI+GVE+  +++   +K  K   KG+
Sbjct: 287 CAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFKGS 346

Query: 312 AGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGSTLSD 371
             NMSLG  KS                     GNE+ DACN+SPA+A   +TVG STLSD
Sbjct: 347 TANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSD 406

Query: 372 DVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDHK 431
           D A+FSNYG+CVDIFAPG+NI+STYIGS +AT +LSGTSM+SPHVAG+L Y+LSLQPD  
Sbjct: 407 DRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSD 466

Query: 432 SQFYHEHS-AISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
           S F+   S  ++P+ LKKK++ Y+T   L  LP +T N L+YNGGG  L  FW
Sbjct: 467 SDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  413 bits (1061), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 209/416 (50%), Positives = 274/416 (65%), Gaps = 5/416 (1%)

Query: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI---FLQDSDFGKATQYNDISTRGIGL 129
           IIPNRYI++FK  V  +E   H   +++    S+     +D+ F         S+   G+
Sbjct: 206 IIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGI 265

Query: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189
           Q  F+I    +GYIGYFT+     I  +PLV+ VE DS+V   ++  Q   PWGL R+S 
Sbjct: 266 QDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH 325

Query: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249
           RE+L +     Y YDD  G+   ++VIDTG+ V+H+DFE RA WGKTI  ND D D NGH
Sbjct: 326 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 385

Query: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYN-DLKKTKSNL 308
           GTHCAGTIASKHYG+AK A V+AVKVLRS+GSG+MSDV++GVEY  +A+    ++ K   
Sbjct: 386 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKKGF 445

Query: 309 KGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGST 368
           KG+  NMSLG  KS                     GNE+ DACN+SPASA   ITVG ST
Sbjct: 446 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 505

Query: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428
           LSDD A+FSNYG+CVD+FAPG+NI+STYIGS  AT +LSGTSM+SPHVAG+L Y+LSLQP
Sbjct: 506 LSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQP 565

Query: 429 DHKSQFYHE-HSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
              S+F+     +++P+ LKKK+++Y+T   L  +P +T N L+YNGGG++LS FW
Sbjct: 566 GSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  404 bits (1038), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 208/417 (49%), Positives = 271/417 (64%), Gaps = 5/417 (1%)

Query: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDISTRGIG-L 129
           ++ NRYI+LFK  V  +EI  H   IE+++   +    ++  F +  + + +    +G +
Sbjct: 88  VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGI 147

Query: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189
            H F I   + GY GYF       I  SPL+E+VE DS+V       +   PWGL RIS 
Sbjct: 148 DHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISH 207

Query: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249
           RE+L +     Y YD++GG    ++VIDTG+ V H  F GRA WGKTI   D D D NGH
Sbjct: 208 RERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGH 267

Query: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAY-NDLKKTKSNL 308
           GTHCAGTI S  YG+AK A+++AVKVLRS+GSGSMSDV++GVE+  + + N +K+ K   
Sbjct: 268 GTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGF 327

Query: 309 KGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGST 368
           KG+  NMSLG  KS                     GNE  DACN+SPASA  PITVG ST
Sbjct: 328 KGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGAST 387

Query: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428
           LSDD A+FSNYG+CVD+FAPG+NI+STYIGS ++T +LSGTSM+SPHVAG+LAY+LSLQP
Sbjct: 388 LSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQP 447

Query: 429 DHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFWGT 485
              S+F    S+ISP  LKKK+L ++T   LS +P+ T NLL+YNGGG +LS FWG+
Sbjct: 448 GSDSEF-DAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGS 503

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  405 bits (1042), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 211/414 (50%), Positives = 269/414 (64%), Gaps = 4/414 (0%)

Query: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEIN--SSSIFLQDSDFGKATQYNDISTRGIGLQ 130
           IIPNRYIV+FK  +  +E+  H   I +I   S++   +D  F  A+   D S    G+ 
Sbjct: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGIL 157

Query: 131 HEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQR 190
             F+I   + GY+GYFT+   + I  +PLVE VE DS+V+   +  Q + PWGL RIS R
Sbjct: 158 TTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHR 217

Query: 191 EKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHG 250
           E+L +     Y YDD  GK    +VIDTGI  +H DF  RA WGKTI  ND D D NGHG
Sbjct: 218 ERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHG 277

Query: 251 THCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAY-NDLKKTKSNLK 309
           THCAGTIAS HYG+AK AEV+AVKVLRS+GSGSMSDVI+GVE+  E++    K+ K   K
Sbjct: 278 THCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFK 337

Query: 310 GAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGSTL 369
           G+  NMSLG  KS                     GNE+ DACN+SPASA   ITVG STL
Sbjct: 338 GSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTL 397

Query: 370 SDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPD 429
           SDD A+FSN+G+CVDIFAPG+NI+STYIG  +AT +LSGTSM+SPHVAG+L Y+LSLQP 
Sbjct: 398 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPG 457

Query: 430 HKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
             S+F+ + + ++P  +KKK++NY++   L  LP  T N L++NG G NL   W
Sbjct: 458 SDSEFF-DPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLW 510

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  405 bits (1040), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 210/416 (50%), Positives = 276/416 (66%), Gaps = 14/416 (3%)

Query: 71  DMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGIG-L 129
           +++IPN+YI++FK  V+ K++Q H   I            + F  A+  ++ S+  +G +
Sbjct: 229 NLVIPNKYIIVFKKDVSVKDMQIHKDLIAR----------AQFQYASVSDETSSSILGGI 278

Query: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189
           +  F++     GYIG+F E   +FI  SP+V+ VE DSIV  N    Q + PWGL RIS 
Sbjct: 279 EEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISH 338

Query: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249
           R+ L +     Y YDD  G+    +VIDTGI + H++F GRA WGKTI END D D NGH
Sbjct: 339 RDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGH 398

Query: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKTKSNL 308
           GTHCAGTIASK+YG+AK AEV+AVKVLRSDGSG+MSDV++GVEY   ++   L++ K   
Sbjct: 399 GTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGF 458

Query: 309 KGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGST 368
           KG+  NMSLG  KS                     GNE+ DACNSSPA++ + ITVG ST
Sbjct: 459 KGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGAST 518

Query: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428
           LSDD A+FSN+G+CVD+FAPG+NI+STYIGS  AT +LSGTSM+SPHVAG+L+Y+LS+QP
Sbjct: 519 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQP 578

Query: 429 DHKSQFYHEHS-AISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
           D  S+F+   S +ISP  LKKK++ Y+T      LP +T NLLVYN  G N+S FW
Sbjct: 579 DADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFW 633

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  397 bits (1021), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 281/423 (66%), Gaps = 17/423 (4%)

Query: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDISTRGI--- 127
           ++P++YIV+ K  V+ + + + L+ +   ++++I    ++ DF     +N ++  G+   
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDF-----FNFVNAEGLPRG 55

Query: 128 GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRI 187
           G++  F+I     G IGYF E   K +  S +VE VE DS+V  +N+  Q + PWGL RI
Sbjct: 56  GIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARI 115

Query: 188 SQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLN 247
           S R++L +     Y YD+ GG+    +VIDTGI V H +F+GRA WGKTI  ND D D N
Sbjct: 116 SHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGN 175

Query: 248 GHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSN 307
           GHGTHCAGTIASKHYGIAK+A V+AVKVL+SDGSG+MSDVI+GVEY  +A+  LK++K+N
Sbjct: 176 GHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAH--LKESKNN 233

Query: 308 --LKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVG 365
              KG+  NMSLG  KS                     GNE+ DACN+SPASA   ITVG
Sbjct: 234 KKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVG 293

Query: 366 GSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKN-ATESLSGTSMSSPHVAGVLAYYL 424
            STLSDD A+FSN+G+CVDIFAPG+NI+STYIG  N  T SLSGTSM+SPHVAG+L Y+L
Sbjct: 294 ASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFL 353

Query: 425 SLQPDHKSQFYHEHS-AISPKILKKKVLNYATNGTLSYLP-AETVNLLVYNGGGKNLSKF 482
           SLQPD  S+FY      ++P  LKKK++ Y+T   L+ LP  ++ NLL+YNG G +L  F
Sbjct: 354 SLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVF 413

Query: 483 WGT 485
           W +
Sbjct: 414 WNS 416

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  404 bits (1038), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/430 (50%), Positives = 280/430 (65%), Gaps = 6/430 (1%)

Query: 60  GSKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSH---LSAIEEINSSSIFLQDSDFGKA 116
           G  I+    K+  I+PN+YI++FKD +   EI  H   +S I++ ++S +      F   
Sbjct: 225 GDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHST 284

Query: 117 TQYNDISTRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKM 176
           ++  + S R  G+   F+I   ++GY GYFT+     I  +PLV+ VE DSIV+   +  
Sbjct: 285 SEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNT 344

Query: 177 QEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKT 236
           Q + PWGL RIS RE+L +     Y YDD  GK    FVIDTGI V+H DF  RA WGKT
Sbjct: 345 QNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKT 404

Query: 237 IVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVE 296
           I  ND D D NGHGTHCAGTIAS HYG+AK AEV+AVKVLRS+GSGSMSDVI+GVE+  E
Sbjct: 405 IPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAE 464

Query: 297 AYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPA 356
            + + +K K + KG+  NMSLG  KS                     GNE+ DACNSSPA
Sbjct: 465 THLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPA 524

Query: 357 SAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKN-ATESLSGTSMSSPH 415
           SA + ITVG STLSDD A+FSN+GRCVD+FAPG+NI+STY+G  N  T +LSGTSM+SPH
Sbjct: 525 SAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPH 584

Query: 416 VAGVLAYYLSLQPDHKSQFYHEHS--AISPKILKKKVLNYATNGTLSYLPAETVNLLVYN 473
           VAG+L Y+LSLQPD KS F++  S   I+P+ LKKK++ Y+T+  L  LP  T N L+YN
Sbjct: 585 VAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYN 644

Query: 474 GGGKNLSKFW 483
           G G ++S  W
Sbjct: 645 GAGGDISDLW 654

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  396 bits (1017), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 214/436 (49%), Positives = 283/436 (64%), Gaps = 16/436 (3%)

Query: 57  FNTGSKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIE--EINSSSIFLQDSDFG 114
           F++ + ++   A+N  IIP+RYI++FKD V+ ++IQ H   I    +  SS F   +DF 
Sbjct: 43  FSSLAPVHNADAEN--IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAF--SNDFT 98

Query: 115 KATQYNDI----STRGI--GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSI 168
           +  Q  DI    S R    G+  +F I   ++GYI Y ++    FI  +PL+  +EHD++
Sbjct: 99  EYLQ-TDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTM 157

Query: 169 VRINNYKMQEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFE 228
           V   ++  Q + PWGL RIS RE L +     Y YDD  GK+   +VIDTG+ V+H +F 
Sbjct: 158 VHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFH 217

Query: 229 GRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVI 288
            RA WGKTI  ND D D NGHGTH AGTI S+HYG+AK   +IAVKVLRS+GSGSMSDV+
Sbjct: 218 SRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVV 277

Query: 289 RGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESD 348
           +GVE+ V ++ +  K + NLKG+  NMSLG  KS                     GNE+ 
Sbjct: 278 KGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ 337

Query: 349 DACNSSPASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSK-NATESLS 407
           +ACNSSPASA   +TVG ST+SD+ A+FSN+G CVDIFAPG+NI+STYIG+  + T +LS
Sbjct: 338 NACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLS 397

Query: 408 GTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETV 467
           GTSM+SPHVAG+LAYYLSLQP+  S+F     AIS   LKKK++ YAT   L  LP  T 
Sbjct: 398 GTSMASPHVAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEYATKDVLEDLPEGTP 455

Query: 468 NLLVYNGGGKNLSKFW 483
           N+L+YNGGG++LS FW
Sbjct: 456 NVLIYNGGGQDLSDFW 471

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  395 bits (1015), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 209/414 (50%), Positives = 272/414 (65%), Gaps = 22/414 (5%)

Query: 76  NRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGI--GLQHEF 133
           N+YI+LFK+ VT ++I +H   ++++      L+ SD         +S +GI   +   F
Sbjct: 96  NKYIILFKEGVTAEQISAHKQLLQQV-----LLETSD---------VSAQGIVADVLDSF 141

Query: 134 SIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREKL 193
            +   ++GY+   +    + +  SP V+LVE DS V  N +  Q + PWGL RIS R+ L
Sbjct: 142 DLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPL 201

Query: 194 PILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHGTHC 253
            +     Y YDD  G+   +++IDTGI V H++FEGRA WGKTI +ND D D NGHGTHC
Sbjct: 202 SLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHC 261

Query: 254 AGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSN---LKG 310
           AGTIASKHYG+AK+A VIAVKVLRS+GSGSMSDVI GVE+  + +    K KSN    KG
Sbjct: 262 AGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQH--ASKAKSNDKKFKG 319

Query: 311 AAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGSTLS 370
           +  NMSLG  KS                     GNE+ DACN+SPA++   ITVG STLS
Sbjct: 320 STANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLS 379

Query: 371 DDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDH 430
           DD A+FSN+G CVDIFAPG+NI+STY GS +AT +LSGTSM+SPHVAG+L Y+LSLQP+ 
Sbjct: 380 DDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEK 439

Query: 431 KSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFWG 484
            SQF    + I+P+ LKKK+L+Y+T G L  LP +T N L+YNGGG +LS FWG
Sbjct: 440 SSQF-GTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWG 492

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  393 bits (1010), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 206/423 (48%), Positives = 275/423 (65%), Gaps = 24/423 (5%)

Query: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGI------ 127
           +P RY+++F + ++ ++IQSH+  +++ +S+S+       GK T+ ND   R I      
Sbjct: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSV-------GKLTE-NDAFWRVISSSVSS 118

Query: 128 -----GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPW 182
                G+ + F I     GY GYFT+   K I+  P+++ VE ++ V+I+N  +QE  PW
Sbjct: 119 KSQFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPW 178

Query: 183 GLGRISQREKLPILGKRF-YHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVEND 241
           GL R+S REK P  G+   Y Y+D  GK   ++V+DTGI  +HEDFEGRA WG  I  ND
Sbjct: 179 GLHRVSHREK-PKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPAND 237

Query: 242 NDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEY-TVEAYND 300
              DLNGHGTHCAG I SKH+G+AK  +++AVKVLRS+G G++SDVI+G+EY T E    
Sbjct: 238 EASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIES 297

Query: 301 LKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWS 360
            KK     KG+  N+SLG+ KS                     GNE +DAC SSPA A  
Sbjct: 298 SKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEK 357

Query: 361 PITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVL 420
            ITVG ST SDD AFFSN+G CVD+FAPG+NIMSTYIGS+NAT SLSGTSM+SPHVAG+L
Sbjct: 358 SITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGIL 417

Query: 421 AYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLS 480
           +Y+LSLQP   S+F+++  A SP+ LK+KVL ++T G L  +  +T N L+YNGGGK L 
Sbjct: 418 SYFLSLQPAPDSEFFND--APSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLD 475

Query: 481 KFW 483
            FW
Sbjct: 476 GFW 478

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  392 bits (1007), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 200/414 (48%), Positives = 265/414 (64%), Gaps = 6/414 (1%)

Query: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEE---INSSSIFLQDSDFGKATQYNDISTRGIGLQ 130
           +P RYI++F + +T++ I+SH   I++   ++ S I   DS     +     + +  G+ 
Sbjct: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128

Query: 131 HEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQR 190
             F I     GY GYFT+   + +   PLV+ +EH+S VRI+N   QE  PWGL RIS R
Sbjct: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188

Query: 191 EKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHG 250
           E+        Y Y+D  G    ++V+DTGI  +HEDFEGRA WG  I END   DLNGHG
Sbjct: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248

Query: 251 THCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAY-NDLKKTKSNLK 309
           THCAG I S+H+G+AK   ++AVKVLRS+G G++SDVI+G+EY  + +    KK  S  K
Sbjct: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGSKFK 308

Query: 310 GAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGSTL 369
           G+  N+SLG+ KS                     GNE +DAC SSPA A   ITVG ST 
Sbjct: 309 GSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368

Query: 370 SDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPD 429
           SDD AFFSN+G CVD+FAPG+NIMSTYIGS+NAT SLSGTSM++PHVAG+L+Y LSLQP 
Sbjct: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428

Query: 430 HKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
             S+F+++   +SP+ LK+K+L ++T G L  +  ET N LVYNGGGK L +FW
Sbjct: 429 QDSEFFYD--TVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  390 bits (1002), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 205/420 (48%), Positives = 270/420 (64%), Gaps = 7/420 (1%)

Query: 70  NDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDISTRGI 127
           N  +IP  YIV+F + VT  EI  H+  + ++   S+     D +F   +  +D+++ G+
Sbjct: 31  NSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGL 90

Query: 128 --GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLG 185
             G++  F IG  + GY G FT+   +F+  SPLV+ +E DS+V       Q + PWGL 
Sbjct: 91  LGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLA 150

Query: 186 RISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYD 245
           RIS R +L +     Y YDD GGK    +VIDTGI + + DF GRA WGKTI   + + D
Sbjct: 151 RISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVD 210

Query: 246 LNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTK 305
            NGHGTH AGTIAS HYG+AKQ +V AVKVLRS+G+GSMSDV++GVEY V A+     T 
Sbjct: 211 GNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQRDVGT- 269

Query: 306 SNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVG 365
           +  KG+  NMSLG  KS                     GNE+ DACN+SPA+A   ITVG
Sbjct: 270 AGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVG 329

Query: 366 GSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLS 425
            STLSD  A+FSN+G+CV IFAPG+NI+STYIGS +AT +LSGTSM+SPH+AG++AY+LS
Sbjct: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLS 389

Query: 426 LQPDHKSQFYH--EHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
           LQP  KSQFY   + +AI+P  LKKK++ + T   L  LPA T N++ YNG GK+L  FW
Sbjct: 390 LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFW 449

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  386 bits (992), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 199/427 (46%), Positives = 270/427 (63%), Gaps = 14/427 (3%)

Query: 65  FDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDIST 124
            D+     +IP RYIV+F + ++ K I+SH   ++E +S S+    S   +   + ++ +
Sbjct: 58  LDNTHKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSV----SKLAEDDVFLEVVS 113

Query: 125 RGI-------GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQ 177
             I       G+   F I     GY GYFT+     ++  PL++ +E +S VR++N  MQ
Sbjct: 114 SSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQ 173

Query: 178 EHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTI 237
           +  PWGL RIS REK        Y Y+D  G+   ++V+DTGI  +HEDFEGRA WG  I
Sbjct: 174 KDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVI 233

Query: 238 VENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEA 297
             ND   DLNGHGTHCAG I SKHYG+AK  +++AVKVLRS+G G++SDVI+G+EY    
Sbjct: 234 PGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVARE 293

Query: 298 YNDLKKTKS-NLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPA 356
           + +  + KS   KG+  N+SLG+ KS                     GNE++DAC SSPA
Sbjct: 294 HIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPA 353

Query: 357 SAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHV 416
            A   ITVG ST SDD AFFSN+G CVD+FAPG+NIMSTYIGS+NAT SLSGTSM++PHV
Sbjct: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHV 413

Query: 417 AGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGG 476
           AG+L+Y+LSLQP   S+++   +A+SP+ LK+KVL ++T+G L  +   T N L+YNGGG
Sbjct: 414 AGMLSYFLSLQPAPDSEYF--DNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGG 471

Query: 477 KNLSKFW 483
           K L   W
Sbjct: 472 KILDDLW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  382 bits (982), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 194/414 (46%), Positives = 264/414 (63%), Gaps = 8/414 (1%)

Query: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI---FLQDSDFGKATQYNDISTRGIGLQ 130
           +P RYI+ F +  + + I+SH   I+E+ + S+      D+ F   +  +D+   GI   
Sbjct: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGI--D 124

Query: 131 HEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQR 190
             F I     GY GYFTE   K +   P+++ +E +S V++ N   QE  PWGL RIS R
Sbjct: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184

Query: 191 EKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHG 250
           EK        Y Y+D  G+   ++V+DTGI ++HEDFEGRA WG  I +ND   DLNGHG
Sbjct: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244

Query: 251 THCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKTKSNLK 309
           THCAG I S+H+G+ K   ++AVKVLRS+G G++SDVI+G+EY V+ + D  KK     K
Sbjct: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFK 304

Query: 310 GAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGSTL 369
           G+  N+SLG+ KS                     GNE +DAC SSPA A   ITVG ST 
Sbjct: 305 GSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364

Query: 370 SDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPD 429
           SDD AFFS++G CVD+FAPGVNI+STYIGS+NA+ SLSGTSM++PHVAG+L+Y+LSLQP 
Sbjct: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424

Query: 430 HKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
             S+F+   S +SP+ LK+K++N++T G L  +  +T N L+YNGGG+ L  FW
Sbjct: 425 SDSEFF--DSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  359 bits (921), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/420 (47%), Positives = 267/420 (63%), Gaps = 17/420 (4%)

Query: 76  NRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGIGLQH---E 132
           +RYI++FK  V  +++  HL  +     S++F + S+  +       S    G       
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLKMM-----SALFRRLSEEQRPAAAPGASALRDGFDRVMDT 188

Query: 133 FSIGRSMTGYIGYF-TETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQRE 191
           F +  + +GYI    +     FI  +PLV+ VE DS+V   + + Q + PWGL RIS RE
Sbjct: 189 FEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHRE 247

Query: 192 KLPILG-KRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHG 250
            L +    ++ +  +  GK    +V+DTGI V H +F  RA WGKTI  ND D D NGHG
Sbjct: 248 GLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHG 307

Query: 251 THCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEY-TVEAYNDLKKTK---- 305
           THCAGTI S+HYG+AK A ++AVKVLRSDGSG+MSDV++GVE+  +E    L++++    
Sbjct: 308 THCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKN 367

Query: 306 SNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVG 365
           SN KGA  NMSLG  KS                     GNE+ DACNSSPA+A + ITVG
Sbjct: 368 SNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVG 427

Query: 366 GSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLS 425
            STLSDD A+FSNYG+CVDIFAPG+NI+STYIG+ +AT +LSGTSM+SPHVAG+L Y LS
Sbjct: 428 ASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLS 487

Query: 426 LQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFWGT 485
           LQPD  S+FY  +S ++P  +KKK+++YAT   L+ LPA+T N L+YN GG N + FW +
Sbjct: 488 LQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYN-GGFNSTDFWAS 546

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  350 bits (899), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/417 (44%), Positives = 253/417 (60%), Gaps = 16/417 (3%)

Query: 67  SAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRG 126
           SAK + II ++YIV+FK+     E + H   ++    +  +  D      +  N      
Sbjct: 53  SAKQNDIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLN------ 106

Query: 127 IGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGR 186
                 F IG +++GYI      T + +   P+V+L+E DS V     K+QE  PWGL R
Sbjct: 107 -----IFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSR 161

Query: 187 ISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDL 246
           ISQR ++ I   + Y+YDD    +   +V+DTGI + HE F GRA WGKTIV ND D D 
Sbjct: 162 ISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDN 221

Query: 247 NGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKS 306
           +GHGTH AG IAS  +G+AK  EV+AVKVLRS+G G MSDV++G+E+ V+   D  K K+
Sbjct: 222 SGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVD---DHSKNKN 278

Query: 307 NLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGG 366
             KG+  N+SLGA KS                     GNE+ DAC +SPA A   ITVG 
Sbjct: 279 YSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGA 338

Query: 367 STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSL 426
           S  SD+ AFFSN+G CVD+FAPG+N+MSTYIGS NAT SLSGTS ++P+ AG++AYYLSL
Sbjct: 339 SIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSL 398

Query: 427 QPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
           QPD  S ++     ++P  LK+K++ + +   L  LP  T N+++YNG G+NLS FW
Sbjct: 399 QPDKDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  349 bits (896), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/415 (45%), Positives = 251/415 (60%), Gaps = 23/415 (5%)

Query: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGIGLQHEF 133
           IPN+YIVLFK   TD + ++HL+ +        +L ++D     QY         + H F
Sbjct: 53  IPNQYIVLFKSDTTDIQRETHLATLNS------WLLNTD----PQYT--------ILHSF 94

Query: 134 SIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREKL 193
            +   + GY     E   + +A  P+++ +E DS V     + Q   PWGL RISQRE+L
Sbjct: 95  QLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERL 154

Query: 194 PILGKRFYHYDDRGGK-DTVTFVIDTGIYVDHEDFEGRASWGKTIVEND-NDYDLNGHGT 251
            +L  +FYHYDD G   +T  +++DTGI  +H +F+GRA WG      + N  D NGHGT
Sbjct: 155 KLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGT 214

Query: 252 HCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAY-NDLKKT-KSNLK 309
           HCAG I S  YG+AK   +IAVKVL + G G MS VIRG+EY  + +  D+KK  ++  K
Sbjct: 215 HCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFK 274

Query: 310 GAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGSTL 369
           G+  N+SLGA KS                     GNE DDAC++SPA +   +TVG S+ 
Sbjct: 275 GSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSF 334

Query: 370 SDDVAFFSNYGRCVDIFAPGVNIMSTYIGS-KNATESLSGTSMSSPHVAGVLAYYLSLQP 428
           SDD  FFSN+G CVD+FAPG+NIMSTYIG   N T SLSGTSMS+P V G++AY+LSLQP
Sbjct: 335 SDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQP 394

Query: 429 DHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483
           D KSQFY   ++ +P  LK K+++++T G L  +P  T N +VYNGGG +L  FW
Sbjct: 395 DTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  332 bits (851), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/420 (44%), Positives = 255/420 (60%), Gaps = 34/420 (8%)

Query: 59  TGSKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQ 118
           +G   +F S K+ ++  N ++V+FK  V  +E++  LS +      + F Q         
Sbjct: 28  SGEHRFFMSGKSTIL--NEFLVMFKPMVDREEVEVGLSVLAGRFPLAQFEQ--------- 76

Query: 119 YNDISTRGIGLQHEFSIGRSMTGY-IGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQ 177
                         F I   + G+ +  F      F+   P VE+VE +S V   N  +Q
Sbjct: 77  --------------FHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQ 122

Query: 178 EHVPWGLGRISQREKLPILGKRFYHYDDRG-GKDTVTFVIDTGIYVDHEDFEGRASWGKT 236
           E VPWGL R+SQR+++ I  ++ Y YD RG  KD   +++DTGI VDHE+FEGRA WGKT
Sbjct: 123 EDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKT 182

Query: 237 IVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVE 296
           I  ND D D NGHGTHCAG +    YG+AK+A +IAVKVL + G G MSDVIRG+E+ V 
Sbjct: 183 IAWNDPDRDDNGHGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVN 242

Query: 297 AYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPA 356
            +  L + +  ++G+  N+SLGA +S                     GNE D+AC SSPA
Sbjct: 243 EH--LTRNQDEVRGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPA 300

Query: 357 SAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIG-SKNATESLSGTSMSSPH 415
           +    +TVGGST SDD AFFSN+G C+D+FAPGVN+ S+Y+G +KN T SLSGTS S+PH
Sbjct: 301 NIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPH 360

Query: 416 VAGVLAYYLSLQPDHKSQFYHEHSAIS-PKILKKKVLNYATNGTLSYLPAETVNLLVYNG 474
           VAG++AY LSL+PD KSQF   H+A S P  LK+K+++ AT G L  +P +T NL+++NG
Sbjct: 361 VAGLMAYLLSLEPDTKSQF---HTAWSNPAQLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  312 bits (800), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 254/426 (59%), Gaps = 29/426 (6%)

Query: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGIGLQHEF 133
           IP++YIVLF++  TD +I    S  E+  SS I   +  +     Y+ + +R       F
Sbjct: 63  IPDQYIVLFENDTTDLQI----SRFEQFLSSLIEEDNQKYNVNDNYSKVLSR-------F 111

Query: 134 SIGRSMTGYI-----GYFTETTAKFIAN-SPLVELVEHDSIVRINNYKMQEHVPWGLGRI 187
            I     G I       F E     I N   +++++E DS V +N +  Q    WGL RI
Sbjct: 112 QISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRI 171

Query: 188 SQREKLPILGKRFYHYDDRG-GKDTVTFVIDTGIYVDHEDFEGRASWGKTI-VENDNDYD 245
           SQR  L +L  +FY YDD G GK    +++DTGI  +H +FEGRASWG ++ V   +  D
Sbjct: 172 SQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLED 231

Query: 246 LNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND----- 300
            NGHGTHCAG I SK YG+AK+  +IAVKVL   G GSMSDVI G+E+   ++ +     
Sbjct: 232 SNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNI 291

Query: 301 --LKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASA 358
                  S  KG+  N+SLGA KS                     GNE +DAC +SPA +
Sbjct: 292 SSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADS 351

Query: 359 WSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIG-SKNATESLSGTSMSSPHVA 417
            + ITVG S+ SDD AFFSN+G CVD+FAPG+NI STYIG + N T SLSG+SMSSP V+
Sbjct: 352 PAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVS 411

Query: 418 GVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGK 477
           G+ AYYLSLQPD  SQF+   S ++P  LK+K+++++TNG L  LP +T N LVYNGGGK
Sbjct: 412 GLTAYYLSLQPDVSSQFH--DSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGK 469

Query: 478 NLSKFW 483
           +LS FW
Sbjct: 470 DLSGFW 475

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  239 bits (609), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 143/425 (33%), Positives = 237/425 (55%), Gaps = 12/425 (2%)

Query: 66  DSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEIN-SSSIFLQDSD-FGKATQYNDIS 123
           D  +N+ I+P RYIV+FK+F    EI+ H+  + ++    SI L  +D F   T+  + S
Sbjct: 62  DEIQNN-IVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKEFS 120

Query: 124 TRGIG-LQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPW 182
           T  +G + + F IG    GY+GYFT+   +FI    +V+ VE DSI+ I++ +   +  W
Sbjct: 121 TEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHW 180

Query: 183 GLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDN 242
            L RIS R KL +     Y +D  GG++   +++DTG+Y  H  +  R   G  I  N++
Sbjct: 181 HLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNED 240

Query: 243 DYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLK 302
           + D+NGHGT  AG +  +  G+A++A +I VKVL   G G++S++I+G+ + V  ++  +
Sbjct: 241 ERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSF-VNHHHPQR 299

Query: 303 KTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPI 362
             K+ + GA    S+   KS                     G +  +ACNSSPAS+  PI
Sbjct: 300 IEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPI 359

Query: 363 TVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIG-SKNATE---SLSGTSMSSPHVAG 418
           TV G +++D+     N+G CVDI+ PG  + +TY    +N      S++G+S ++  VAG
Sbjct: 360 TVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAG 419

Query: 419 VLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKN 478
           +LAY+ SLQP   +    +   ++P+ LK++++++ T G L+ L   + N++ +NG G N
Sbjct: 420 LLAYFASLQPGLGTP---DVIPLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGN 476

Query: 479 LSKFW 483
           L  F+
Sbjct: 477 LDSFF 481

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  175 bits (443), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 134/409 (32%), Positives = 204/409 (49%), Gaps = 53/409 (12%)

Query: 92  QSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGIGLQHEFSIGRSMTGYIGYFTETTA 151
           + +L  ++   S + F++ S  G  +  + +STR   +   FS G+   G+   F +   
Sbjct: 19  EEYLVRLKSPKSLTKFME-SKIGDMSLKSFVSTR---ISKTFSFGK-FEGFTADFPKDFV 73

Query: 152 KFIANSPLVELVEHDSIVRI------------NNYKMQEHVPWGLGRISQREKLPILG-- 197
           + +  +PLV  V  +S+  +              YK+QE  P  L R+S+R  LP     
Sbjct: 74  EKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLARLSRRGPLPYSEED 133

Query: 198 ---KRF-YHYDDRGGKDTV-TFVIDTGIYVDHEDFEGRASWGKTIV-ENDNDYDLNGHGT 251
              + F Y+YD +   D+V  ++IDTGIY  H+D  GRA +G  +V E   DY  NGHGT
Sbjct: 134 GWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADMVGEGPGDY--NGHGT 191

Query: 252 HCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSNLKGA 311
           H AG + S+ +G+AK+  ++ VK L + G G+++ VI  +E++V   N  KK+       
Sbjct: 192 HVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSV---NHCKKSG---MLC 245

Query: 312 AGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGG-STLS 370
             N+SLG+ ++                     GN + +AC +SPASA S ITVG     +
Sbjct: 246 VANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAISAITVGAFDDRT 305

Query: 371 DDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDH 430
           D +A FSN+G CVD+FA GV +MS          + SGTSM+SP VAG+ A  L      
Sbjct: 306 DTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSVAGLAAVLLD----- 360

Query: 431 KSQFYHEHSAISPKILKKKVLNYATNG-----TLSYLPAETVNLLVYNG 474
                   S I P  +K+K+++ AT       TL + P  T N + +NG
Sbjct: 361 --------SGIDPPDIKQKIIDLATENVFQKRTLVFKPG-TPNRIAFNG 400

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  171 bits (434), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 114/323 (35%), Positives = 166/323 (51%), Gaps = 36/323 (11%)

Query: 173 NYKMQEHVPWGLGRISQREKLPILGKRF--------YHYDDR-GGKDTVTFVIDTGIYVD 223
           ++  Q++ P  L RIS+R  LP   +          Y+YDD   G     +VIDTGI+ +
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 224 HEDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGS 283
           H  F+GRA +G  +V  +   DLNGHGTH AG I S+ YG+AK   +I VK L + G G+
Sbjct: 189 HRQFQGRAKFGADLV-GEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 284 MSDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXX 343
           ++ VI  +E+TV   N  +K+K   +G   N+SLG++++                     
Sbjct: 248 LTSVISAIEFTV---NHCRKSK---RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAA 301

Query: 344 GNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNA 402
           GN + +AC SSPAS+ S I+VG     +D +A FSN+G CVD+FAPGV I S        
Sbjct: 302 GNSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFK 361

Query: 403 TESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYL 462
           + + SGTSM+SP V G++A  L              S I P  +K++++N AT+      
Sbjct: 362 SVAYSGTSMASPLVTGMVAVLLD-------------SGIHPFDIKEELINTATDSVFHK- 407

Query: 463 PAETVNLLVYNGGGKNLSKFWGT 485
                  L++  G  N   F G 
Sbjct: 408 -----RALLFKPGTPNRVAFTGV 425

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  171 bits (432), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 115/313 (36%), Positives = 163/313 (52%), Gaps = 36/313 (11%)

Query: 177 QEHVPWGLGRISQREKLP-------ILGKRF-YHYDDR-GGKDTVTFVIDTGIYVDHEDF 227
           Q+  P  L RIS+R  LP       +    F Y+YDD   G     +VIDTGIY +H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 228 EGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDV 287
           EGRA +G  +V  +   D NGHGTH AG I S+ +G+AK   +I VK L + G G+++ V
Sbjct: 195 EGRAKFGADLV-GEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 288 IRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNES 347
           I  +E+TV   N  +K++   +G   N+SLG++++                     GN +
Sbjct: 254 ISAIEFTV---NHCRKSR---RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSN 307

Query: 348 DDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESL 406
            +AC SSPAS+ S ITVG     +D +A FSN+G CVDIFAPGV I S          + 
Sbjct: 308 ANACWSSPASSLSAITVGAFDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKPVAF 367

Query: 407 SGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNG-----TLSY 461
           SGTSM+SP V+G++A  L              S I P  +K ++++ AT+      TL +
Sbjct: 368 SGTSMASPIVSGMVANLLD-------------SGIHPFDIKTELIDLATDSVFHKRTLLF 414

Query: 462 LPAETVNLLVYNG 474
            P  T N + + G
Sbjct: 415 KPG-TPNRVAFTG 426

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  164 bits (414), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 118/320 (36%), Positives = 165/320 (51%), Gaps = 32/320 (10%)

Query: 173 NYKMQEHVPWGLGRISQREKLP--ILGKR-------FYHYDDRGGKDTVTFVIDTGIYVD 223
           N   Q   P  L RIS+  +LP  I  K        +Y+ DD  G+D   +++DTGI+ D
Sbjct: 121 NITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFAD 180

Query: 224 HEDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGS 283
           H +FE R   G  + + +   D NGHGTH AG + SK YG AK+  ++ VKVL  DGSG 
Sbjct: 181 HPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGE 239

Query: 284 MSDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXX 343
            S+V+ G+E+ VE    + + +   K    N+SLG+++S                     
Sbjct: 240 ASNVLSGLEFIVEHCTRVSRPQG--KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAA 297

Query: 344 GNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNA 402
           GN + DA  +SPASA + ITVG      D +A FSN+G CV+IFAPGV I S    + N 
Sbjct: 298 GNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFND 357

Query: 403 TESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNG----- 457
           T  LSGTSMS+P V GV A  LS               I P+++ +++   +T       
Sbjct: 358 TLVLSGTSMSTPIVTGVAAVLLS-------------KGIEPEMIAQELEYLSTRNVFHRR 404

Query: 458 TLSYLPAETVNLLVYNGGGK 477
           TL + P+ T N ++YNG  K
Sbjct: 405 TLFFKPS-TPNQILYNGVDK 423

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  163 bits (412), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 168/328 (51%), Gaps = 32/328 (9%)

Query: 165 HDSIVRINNYKMQEHVPWGLGRISQREKLPI-LGKR--------FYHYDDRGGKDTVTFV 215
           ++ +    N   Q   P  L RIS+  +LP  +G +        +Y+  D  G+D   ++
Sbjct: 113 YEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYI 172

Query: 216 IDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKV 275
           +DTGI+ DH +FE R   G  + + +   D NGHGTH AG + SK YG AK+  ++ VKV
Sbjct: 173 MDTGIFADHPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKV 231

Query: 276 LRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXX 335
           L  DGSG  S+V+ G+E+ VE    + + +   K    N+SLG+++S             
Sbjct: 232 LGKDGSGEASNVLSGLEFIVEHCTKVSRPQG--KKCVANLSLGSFRSPIINMAVEGAIEE 289

Query: 336 XXXXXXXXGNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMS 394
                   GN + DA  +SPASA + ITVG      D +A FSN+G CV+IFAPGV I S
Sbjct: 290 GIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIES 349

Query: 395 TYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYA 454
               + N T  LSGTSMS+P V GV A  LS               I P+++ +++   +
Sbjct: 350 LSHLNYNDTLILSGTSMSTPIVTGVAAILLS-------------KGIEPEMIAQEIEYLS 396

Query: 455 TNG-----TLSYLPAETVNLLVYNGGGK 477
           T       TL + P+ T N ++YNG  K
Sbjct: 397 TRNVFHRRTLFFKPS-TPNQILYNGVDK 423

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  162 bits (409), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 159/324 (49%), Gaps = 35/324 (10%)

Query: 176 MQEHVPWGLGRISQREKLPILGKRFYHYDDR---------GGKDTVTFVIDTGIYVDHED 226
           +Q   P  L R+S+R +LP        YD+           G     ++IDTGIY +H +
Sbjct: 114 IQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPE 173

Query: 227 FEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSD 286
           FEGR  +   + + +   D NGHGTH AG + SK +G+AK+  +I VK L   G G +S 
Sbjct: 174 FEGRVKFAIDLTQ-EGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLST 232

Query: 287 VIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNE 346
           +++ +E+T+    +     S  K    N+S GA ++                     GN 
Sbjct: 233 ILKALEFTIRHCKE-----SVDKKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNS 287

Query: 347 SDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATES 405
           + DAC +SPAS+   ITVG     ++ +A FSN+G CVD+FAPGV + S    + +    
Sbjct: 288 NIDACWNSPASSKDVITVGAFDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSDVLL 347

Query: 406 LSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYAT-----NGTLS 460
           LSGTSM+SP V+G+ A  L                ++PK +K K++  +T      GT+ 
Sbjct: 348 LSGTSMASPSVSGIAAILLD-------------KGLNPKFVKSKIIESSTKNIFHQGTIM 394

Query: 461 YLPAETVNLLVYNGGGKNLSKFWG 484
             P  T NL+V+NG  K    F G
Sbjct: 395 IKP-NTPNLIVFNGIEKMDDSFEG 417

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  162 bits (409), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 157/314 (50%), Gaps = 33/314 (10%)

Query: 175 KMQEHVPWGLGRISQREKLPIL---------GKRFYHYDDRGGKDTVTFVIDTGIYVDHE 225
           K+Q   P  L R+S+R  LP              +Y+Y    G++   ++IDTGIY +H+
Sbjct: 124 KVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHK 183

Query: 226 DFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMS 285
           DF GRA +G+     +   D NGHGTH AG + S ++G+AK+  +I VK L + G G+++
Sbjct: 184 DFCGRAIFGRDFT-GEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLT 242

Query: 286 DVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGN 345
            VI  VE+ V   N  K   S  KG   N+SLGA ++                     GN
Sbjct: 243 TVISAVEFAV---NHCK--SSGKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGN 297

Query: 346 ESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATE 404
            + +AC +SPASA   ITVG     +D +A FSN+G CVDIFA GV + S      +   
Sbjct: 298 SNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPI 357

Query: 405 SLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLS---- 460
           + SGTSM+SP V G++A  L                + P+ +K K++  AT+  L     
Sbjct: 358 AFSGTSMASPSVTGLVAILLD-------------KGVEPENIKAKLVELATHDLLQRRTL 404

Query: 461 YLPAETVNLLVYNG 474
           +    T N + +NG
Sbjct: 405 FFKPGTPNRIAFNG 418

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  161 bits (408), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 111/315 (35%), Positives = 159/315 (50%), Gaps = 32/315 (10%)

Query: 176 MQEHVPWGLGRISQREKLPI------LGKRFYHY---DDRGGKDTVTFVIDTGIYVDHED 226
           +Q   P  LGRIS R +LP         K F HY   D   G +   +++DTGIY +H D
Sbjct: 153 VQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPD 212

Query: 227 FEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSD 286
           FE R   G  +   +   D NGHGTH AG + SK +G+AK   ++ VKVL   GSG+++ 
Sbjct: 213 FENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTT 271

Query: 287 VIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNE 346
           V+ G+++ V+    +++T+   K    NMSLG  ++                     GN 
Sbjct: 272 VLSGIQFAVDHCRLMRETQG--KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNS 329

Query: 347 SDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNI--MSTYIGSKNAT 403
           +  AC +SPASA + ITVG     ++ +A+FSN+G CVDIFAPGV I  +S    S +  
Sbjct: 330 NVSACWTSPASAKNAITVGAFDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESHHKH 389

Query: 404 ESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYAT----NGTL 459
            + SGTSM+SP VAG+ A  L                + P  +K K+L+ +T    N   
Sbjct: 390 VTHSGTSMASPVVAGLAAILLD-------------KGVEPFDVKDKLLHLSTKDVFNKLT 436

Query: 460 SYLPAETVNLLVYNG 474
            +    T N + YNG
Sbjct: 437 LFFKYGTPNKIAYNG 451

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  161 bits (408), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 118/328 (35%), Positives = 166/328 (50%), Gaps = 32/328 (9%)

Query: 165 HDSIVRINNYKMQEHVPWGLGRISQREKLP--ILGKR-------FYHYDDRGGKDTVTFV 215
           ++ I    N   Q   P  L RIS+  +LP  I  K        +Y+ DD  G+D   ++
Sbjct: 162 YEDIDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYI 221

Query: 216 IDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKV 275
           +DTGI+ DH +FE R   G  + + +   D NGHGTH AG + SK YG AK+  ++ VKV
Sbjct: 222 MDTGIFSDHPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKV 280

Query: 276 LRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXX 335
           L  DGSG  S+V+ G+E+ VE    + + +   K    N+SLG+++S             
Sbjct: 281 LGKDGSGEASNVLSGLEFIVEHCTRVSRPQG--KKCVANLSLGSFRSPIINMAVEGAIEE 338

Query: 336 XXXXXXXXGNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMS 394
                   GN + DA  +SPASA + ITVG      D +A FSN+G CV+IFAPGV I S
Sbjct: 339 GIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIES 398

Query: 395 TYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYA 454
               +   T  LSGTSMS+P V GV A  LS               I P ++ +++   +
Sbjct: 399 LSHLNYEDTLILSGTSMSTPIVTGVAAVLLS-------------KGIEPALIAQEIEYLS 445

Query: 455 TNG-----TLSYLPAETVNLLVYNGGGK 477
           T       TL + P+ T N ++YNG  K
Sbjct: 446 TRNVFHRRTLFFKPS-TANQILYNGVDK 472

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  159 bits (402), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 114/317 (35%), Positives = 161/317 (50%), Gaps = 38/317 (11%)

Query: 175 KMQEHVPWGLGRISQREKLPI--------LGKRFYHYDDRG-GKDTVTFVIDTGIYVDHE 225
           K+Q   P  L R+S+R++LP         L    Y YD R  G     ++ID+GIY++HE
Sbjct: 127 KVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLEHE 186

Query: 226 DFEGRASWGKTIV-ENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSM 284
           +F GRA  G  +  E   DY  NGHGTH AG + SK YG+AK+ ++I +KVL   G GS+
Sbjct: 187 EFNGRAIPGIDLTGEGSGDY--NGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSL 244

Query: 285 SDVIRGVEYTVEAYNDLKKTKSNLKG-AAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXX 343
           + V+ G+E+ V+   +  K     KG    N+SLG+ ++                     
Sbjct: 245 AMVLGGIEFAVKHCQETSK-----KGRCVANLSLGSMRTAILNKAIKAAIDAGLVVVVAA 299

Query: 344 GNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNA 402
           GN + +AC  SPASA   ITVG      D +A FSN+G+C+DIFAPGV I S  I     
Sbjct: 300 GNNNLNACWYSPASAPEAITVGAFDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKDKE 359

Query: 403 TESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNG----- 457
             + SGTSM+SP VAG+ A  L                +S + +K  +L   T+      
Sbjct: 360 DVTYSGTSMASPTVAGLAALTLD-------------QGVSAEEVKDYILEMGTDNVFHRR 406

Query: 458 TLSYLPAETVNLLVYNG 474
           +L + P  T N + +NG
Sbjct: 407 SLLFKPG-TPNKICFNG 422

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  156 bits (395), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 159/324 (49%), Gaps = 36/324 (11%)

Query: 175 KMQEHVPWGLGRISQREKLPI---------LGKRFYHYDDRGGKDTV-TFVIDTGIYVDH 224
           + Q   P  L R+S+R +LP           G   Y+YD++   D +  ++IDTGIY +H
Sbjct: 112 RRQRGAPRHLSRLSRRSQLPYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEH 171

Query: 225 EDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSM 284
            +F GRA +G+ +   +   D NGHGTH AG + S  YG+AK   ++ VK L + G G++
Sbjct: 172 AEFGGRAVFGEDLT-GEGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNL 230

Query: 285 SDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXG 344
           + VI  +E+ V   N  + ++   KG   N+SLGA ++                     G
Sbjct: 231 TTVISAMEFAV---NHCRSSEG--KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAG 285

Query: 345 NESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNAT 403
           N + +AC +SPASA   ITVG     +D +A FSN+G CVDIFAPGV + S         
Sbjct: 286 NSNINACLNSPASAPEAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKP 345

Query: 404 ESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNG-----T 458
              SGTSM+SP + G+ A  L                +    +K  +L  ATN      T
Sbjct: 346 ILFSGTSMASPSITGLAAILLD-------------EGVPYDKIKDYILKMATNDVFQRRT 392

Query: 459 LSYLPAETVNLLVYNGGGKNLSKF 482
           L + P  T N + +NG  KN  KF
Sbjct: 393 LVFKPG-TPNRVAFNGVKKNDDKF 415

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  157 bits (398), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 173/350 (49%), Gaps = 42/350 (12%)

Query: 143 IGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREKLPI-LGKR-- 199
           + Y   TTAK+           +  I    N   Q   P  L RIS+  +LP  L  +  
Sbjct: 137 LSYMFNTTAKY----------AYQDIDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDR 186

Query: 200 ------FYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHGTHC 253
                 +Y+ D+  G+    +++DTGI+ +H +FE R   G  + + +   D NGHGTH 
Sbjct: 187 YKSWFNYYYEDEYQGQGVNAYIMDTGIHAEHPEFEDRVIQGVDLTK-EGFGDENGHGTHV 245

Query: 254 AGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSNLKGAAG 313
           AG + S+ +G AK+  ++ VKVL  DGSG  S+V+ G+E+ VE    + + +   K    
Sbjct: 246 AGLVGSRTFGAAKKVSLVEVKVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQG--KKCVA 303

Query: 314 NMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGG-STLSDD 372
           N+SLG+++S                     GN + DA  +SPASA + ITVG      D 
Sbjct: 304 NLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDT 363

Query: 373 VAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDHKS 432
           +A FSN+G CV+IFAPGV I S    + N +  LSGTSMS+P V GV A  LS       
Sbjct: 364 IAKFSNWGPCVNIFAPGVEIESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS------- 416

Query: 433 QFYHEHSAISPKILKKKVLNYATNG-----TLSYLPAETVNLLVYNGGGK 477
                   I P+++ +++   +T       TL + P+ T N ++YNG  K
Sbjct: 417 ------KGIEPELIAQEIEYLSTRNVFHRRTLFFKPS-TPNQILYNGVDK 459

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  156 bits (394), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 161/318 (50%), Gaps = 35/318 (11%)

Query: 175 KMQEHVPWGLGRISQREKLPI-------LGKRFYHYDDR--GGKDTVTFVIDTGIYVDHE 225
           K Q   P  L RIS+R +LP            F +Y DR   G  T  +++DTG+  DH+
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 226 DFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMS 285
           +FE R  +G T    + + DLNGHGTH AG + SK +G+AK  +++ VK L + G+G++ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 286 DVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGN 345
            ++  +E+ V+   + + ++  L     NMSLG+ KS                     GN
Sbjct: 228 SILSALEFAVQDCQEHEDSQCVL-----NMSLGSVKSNILNQAINEVEKKGIVVVVAAGN 282

Query: 346 ESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATE 404
            + +AC +SP+SA   ITVG      D +A FSN+G CVDIFAPGVN+ S       +  
Sbjct: 283 FNMNACWTSPSSATGAITVGAFDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDWPSFV 342

Query: 405 SLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNG-----TL 459
             SGTSM+SP V G++A  L                + P+ ++  +   AT+G     TL
Sbjct: 343 KYSGTSMASPIVCGMVALLLD-------------DGVPPEDIRDYLQELATDGVFKKRTL 389

Query: 460 SYLPAETVNLLVYNGGGK 477
            + P  T N ++YNG  K
Sbjct: 390 VFKPG-TPNSVLYNGNKK 406

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  156 bits (394), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 114/324 (35%), Positives = 157/324 (48%), Gaps = 37/324 (11%)

Query: 175 KMQEHVPWGLGRISQREKLPILGKRFYHYDDRG---------------GKDTVTFVIDTG 219
           K+Q   P  L R+S+R  LP      Y +DD+                G D   ++ID+G
Sbjct: 127 KVQNGAPRHLARLSRRMPLP------YDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSG 180

Query: 220 IYVDHEDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSD 279
           I ++ E+FEGRA+ G  +   +   D NGHGTH AG + SK YG+AK   ++ VK L   
Sbjct: 181 IDINQEEFEGRATHGLDLT-GEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQ 239

Query: 280 GSGSMSDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXX 339
           GSGS+  VI  +E+ V   N   K+KS  K    N+SLGA+                   
Sbjct: 240 GSGSLITVISALEFVV---NHCGKSKS--KKCVANLSLGAFMMPLLNEAIKATVDSGVVV 294

Query: 340 XXXXGNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIG 398
               GN + DAC  SPAS  S ITVG      D +A FSN+G CVDIFAPGV I S  I 
Sbjct: 295 VVAAGNGNIDACWCSPASEKSAITVGAFDDRIDTIAKFSNWGSCVDIFAPGVAISSLSIK 354

Query: 399 SKNATESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGT 458
               +   SGTSM+SP VAG+++  L    +++    +     +  + +K+        T
Sbjct: 355 DNQKSVEFSGTSMASPQVAGIVSILLDQGVENEDIRDYLFELATDDVFQKR--------T 406

Query: 459 LSYLPAETVNLLVYNGGGKNLSKF 482
           L + P  T N + +NG  K    F
Sbjct: 407 LLFKP-RTPNRITFNGISKKDEDF 429

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  159 bits (402), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 160/316 (50%), Gaps = 34/316 (10%)

Query: 174 YKMQEHVPWGLGRISQREKLPIL---GKRF-----YHYDDRG-GKDTVTFVIDTGIYVDH 224
           +K+Q   P  L RIS R+KLP       +F     Y+YDD   G+  + +VIDTGI  +H
Sbjct: 284 FKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKEH 343

Query: 225 EDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSM 284
           +DFE R  +G T +  +   DLNGHGTH AG I SK YG+ K+ ++I VK +   GS  +
Sbjct: 344 KDFEDRVEFG-TDLTGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQL 402

Query: 285 SDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXG 344
           S +I  +EYTV   N    ++ + K    NMSLG++                       G
Sbjct: 403 SHIIEAIEYTVNDCN----SRVDKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAAG 458

Query: 345 NESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNAT 403
           N + DAC SSP S+ + ITVG      D +A FSN+G CVDIFA GV + S         
Sbjct: 459 NNNIDACWSSPGSSKNAITVGAFDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQVPYKY 518

Query: 404 ESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNG-----T 458
              SGTSM+SP V G ++  LS               + P  ++++++  +T G     +
Sbjct: 519 IKYSGTSMASPIVCGFVSILLS-------------QGVKPNDVQEEMVKLSTKGDFTRRS 565

Query: 459 LSYLPAETVNLLVYNG 474
           L + P  T N +++NG
Sbjct: 566 LIFKPF-TSNRILFNG 580

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  155 bits (392), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 111/334 (33%), Positives = 155/334 (46%), Gaps = 48/334 (14%)

Query: 175 KMQEHVPWGLGRISQREKLPILGK---------RFYHYDDRGGKDTVTFVIDTGIYVDHE 225
           K Q   P  L R+S+R +LP              +Y+Y    G+    +V+D+G+ +DH 
Sbjct: 158 KTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHC 217

Query: 226 DFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMS 285
           DFEGRA +G   + + N  D NGHGTH AG I SK YG++K+  +I VKVL S GSG++ 
Sbjct: 218 DFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLD 277

Query: 286 DVIRGVEYTVEAYN-------------------DLKKTKSNLKGAAGNMSLGAWKSXXXX 326
            V+ G+E+     N                   D        K    N+SLG ++S    
Sbjct: 278 TVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIIN 337

Query: 327 XXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDI 385
                            GN + +AC +SPAS    ITVG      D +A FSN+G CVDI
Sbjct: 338 EAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGAFDDRIDSIAKFSNWGNCVDI 397

Query: 386 FAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKI 445
           FAPGV + S            +GTSM++P V G++A  L              S I P  
Sbjct: 398 FAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD-------------SGIKPTQ 444

Query: 446 LKKKVLNYATNG-----TLSYLPAETVNLLVYNG 474
           +KK++   AT+      TL + P  T N + +NG
Sbjct: 445 IKKRLNELATDNIFPRRTLLFKPG-TPNRIAFNG 477

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  154 bits (388), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 108/312 (34%), Positives = 154/312 (49%), Gaps = 33/312 (10%)

Query: 176 MQEHVPWGLGRISQREKLPI--LGKRFYHYD-----DRGGKDTVTFVIDTGIYVDHEDFE 228
           MQ   P  L R  +R  LP    G + Y ++     +  G+    +++D+GI+  H +FE
Sbjct: 269 MQSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFE 328

Query: 229 GRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVI 288
           GRA +G     N+   DLNGHGTH AG + SK YG AK+A +  VKV+  DG GS S++I
Sbjct: 329 GRAVFGIDTT-NEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNII 387

Query: 289 RGVEYTVEAYNDLKKTKSNLKGAAGNMSLG--AWKSXXXXXXXXXXXXXXXXXXXXXGNE 346
            GVE+ V      K  + + K    NMSLG  ++                       GN 
Sbjct: 388 AGVEFAV------KHCQQSGKKCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAGNS 441

Query: 347 SDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATES 405
            + AC  SPA   + ITVG     SD +A FSNYG+CVDIFAPGV + S      N    
Sbjct: 442 KERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVRV 501

Query: 406 LSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTL---SYL 462
           L+GTSMS+P  AGV+A  L     H+              +K+++++ +T G       +
Sbjct: 502 LNGTSMSAPITAGVVAVLLDQGVKHED-------------VKERLIDLSTKGVFHRRRLV 548

Query: 463 PAETVNLLVYNG 474
            + T +  ++NG
Sbjct: 549 SSRTPDRTLFNG 560

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  154 bits (390), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 149/297 (50%), Gaps = 30/297 (10%)

Query: 171 INNYKMQEHVPWGLGRISQREKLPILG---KRF---YHYDDRG-GKDTVTFVIDTGIYVD 223
           ++ Y +Q   P  L R  +R  LP      K +   Y+YD+   G+    +V+D+GIY  
Sbjct: 422 LHQYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKS 481

Query: 224 HEDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGS 283
           H +F+GRA +G    + +   DLNGHGTH AG + S+ +GIAK+A +  +KV+  DG GS
Sbjct: 482 HPEFDGRAHFGIDTTK-EGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGS 540

Query: 284 MSDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLG--AWKSXXXXXXXXXXXXXXXXXXX 341
            S++I GVE+ V      K  + + K    NMSLG  ++                     
Sbjct: 541 TSNIIAGVEFAV------KHCQQSGKRCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVV 594

Query: 342 XXGNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSK 400
             GN  + AC  SPA   + ITVG     SD +A FSNYG+CVDIFAPGV + S      
Sbjct: 595 AAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPS 654

Query: 401 NATESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNG 457
           N    L+GTSMS+P  AGV+A  L                I P  +K  +L+ +T G
Sbjct: 655 NTMRVLNGTSMSAPITAGVVAVLLD-------------QGIEPHEVKDHLLSISTKG 698

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  148 bits (374), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 159/324 (49%), Gaps = 34/324 (10%)

Query: 172 NNYKMQEHVPWGLGRISQREKLPIL-------GKRFYHYDDRGGKDTVTFVIDTGIYVDH 224
           +++  Q   P  L RIS+R +LP++       G +++++++  G+    +V+D+G+  DH
Sbjct: 149 DDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDH 208

Query: 225 EDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSM 284
            DFEGRA  G      +   DL GHGTH AG I SK YG+AK+  ++ VKVL S G G++
Sbjct: 209 PDFEGRAMKGID-TTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTV 267

Query: 285 SDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKS-XXXXXXXXXXXXXXXXXXXXX 343
           +++I G+EY V      KK K  +     NMSLGA  +                      
Sbjct: 268 TNIIEGLEYVVNQCIG-KKRKCVI-----NMSLGAPGTHSILDKAVSAVIEEGVVVVVAG 321

Query: 344 GNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNA 402
           GN   +AC  SPA     ITV      +D +A FSN+G C+DI+APGVN+ S        
Sbjct: 322 GNSGLNACWYSPAKVRKAITVAAMDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-NKGRG 380

Query: 403 TESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLS-- 460
           T  LSGTSM+SP VAG  A YL    D             P  ++K +   AT G     
Sbjct: 381 TFVLSGTSMASPIVAGAAAIYLDQGAD-------------PAEVRKILSKTATRGVFKKR 427

Query: 461 --YLPAETVNLLVYNGGGKNLSKF 482
              +   T N ++Y G  +   +F
Sbjct: 428 AIAVRPRTPNKVLYTGNNQEDDEF 451

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  146 bits (368), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 139/262 (53%), Gaps = 17/262 (6%)

Query: 176 MQEHVPWGLGRISQREKLPI------LGKRFYHYD-DR--GGKDTVTFVIDTGIYVDHED 226
           +Q   P  LG++S R +LP         K F HY  DR   G ++V ++IDTG+Y +H++
Sbjct: 149 IQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKE 208

Query: 227 FEGRASWGKTIV-ENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMS 285
           F  R  +G   + E   DY  NGHGTH AG I SK +G+AK   +  VKVL   G G+++
Sbjct: 209 FGNRVHFGGDFIGEGKGDY--NGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 286 DVIRGVEYTVEAYNDLKKTKSNL-KGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXG 344
            V+ G+E+ V   N+ K  +  + K    NMSLG  ++                     G
Sbjct: 267 SVLEGIEFAV---NNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 345 NESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNAT 403
           N +  AC +SPAS+   ITVG     +D +A FSN+G+CVDIFAPGV I S         
Sbjct: 324 NNNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENG 383

Query: 404 ESLSGTSMSSPHVAGVLAYYLS 425
              SGTSM+SP VAG++A  + 
Sbjct: 384 VIHSGTSMASPIVAGLVAILME 405

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  142 bits (358), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 141/275 (51%), Gaps = 28/275 (10%)

Query: 170 RINNYKMQEHV--------PWGLGRISQREKLPI-------LGKRFYHY--DDRGGKDTV 212
            +NN + QE+V        P  L RIS+R+KLP          K F +Y   +  G D  
Sbjct: 104 ELNNEQTQEYVSHVVQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVR 163

Query: 213 TFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIA 272
            +++D+G+  +  DFEGR  +G      D + D NGHGTH AG + SK YG+AK   ++ 
Sbjct: 164 AYILDSGVSRNLTDFEGRVEFGFDFT-GDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMVD 222

Query: 273 VKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXX 332
           VK L   G G++  V+  +E+ V   ND  +     K    N+SLG++K+          
Sbjct: 223 VKCLDEIGFGTLITVLSAIEFAV---NDCHEHPE--KRCVANLSLGSFKNAIINKAIQAA 277

Query: 333 XXXXXXXXXXXGNESDDACNSSPASAWSPITVGG-STLSDDVAFFSNYGRCVDIFAPGVN 391
                      GN + +AC +SPASA   ITVG      D +A FSN+G CVDI+APGV 
Sbjct: 278 TEDGVVMVVAAGNFNINACWTSPASAEEAITVGAFDDRIDTIAKFSNWGPCVDIYAPGVA 337

Query: 392 I--MSTYIGSKNATESLSGTSMSSPHVAGVLAYYL 424
           +  ++ +   KN   S SGTSM+SP V G +A  L
Sbjct: 338 VESLANFPMVKNI--SYSGTSMASPIVCGQVAILL 370

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  128 bits (321), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 101/309 (32%), Positives = 145/309 (46%), Gaps = 21/309 (6%)

Query: 174 YKMQEHVPWGLGRISQREKLPILGKRFYHY---DDRGGKDTVTFVIDTGIYVDHEDFEGR 230
           Y  Q + P  L R S+  KLP      Y+Y    D  G +   +V+D+GI +DH +FEGR
Sbjct: 142 YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 231 ASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRG 290
                   ++    D  GHGT  AG I SK YG+AK   +I +KVL + G G++  +++G
Sbjct: 202 ILEAYDFTDSGVG-DNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQG 260

Query: 291 VEYTVEAYNDLKKTKSNLKG-AAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDD 349
           +++        K  + N  G    N SLGA                        GN + +
Sbjct: 261 LQFIT------KHCEENTNGNCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVN 314

Query: 350 ACNSSPASAWSPITVGGSTLSDD-VAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSG 408
           AC  +PA +    TVG     DD +A FSN+GRCVD+ APGV + +    ++  +   SG
Sbjct: 315 ACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSG 374

Query: 409 TSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVN 468
           TS+S+P V G+ A  LS +   K   Y E   +  + L +       N   S LP  T N
Sbjct: 375 TSVSTPIVTGLAAILLS-KGVPKENLYDEIRKMGSRDLLR-------NKEFSRLPG-TPN 425

Query: 469 LLVYNGGGK 477
           L+V  G  K
Sbjct: 426 LIVNIGPQK 434

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  124 bits (310), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 94/303 (31%), Positives = 142/303 (46%), Gaps = 21/303 (6%)

Query: 133 FSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREK 192
            S+G S     G F +   + +     +  +  D I+    Y +QEH P  L R+SQ+  
Sbjct: 49  ISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKST 108

Query: 193 LPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDY-DLNGHGT 251
           L       Y Y   GG     +++DTGI   H + EGR      +  N   + D +GHGT
Sbjct: 109 LR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGT 167

Query: 252 HCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTK------ 305
             AG I S  +G AK+  +  V+V  S G+ ++  VIR +E+  +  +  ++        
Sbjct: 168 AVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASKLASVTQRPSVVVIPF 227

Query: 306 SNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVG 365
           +  K    N ++ A                        GN + +AC+SSPASA+  +T+G
Sbjct: 228 TMRKNVILNSAIEAV-----------IRDQSLPVVVAGGNFNQNACDSSPASAYGALTIG 276

Query: 366 G--STLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYY 423
               T  D +A F+NYG C+D FA GVNI S   G   +    SGTS+S+   +GV+AYY
Sbjct: 277 SIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYY 336

Query: 424 LSL 426
           +SL
Sbjct: 337 MSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  108 bits (270), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 145/310 (46%), Gaps = 32/310 (10%)

Query: 133 FSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREK 192
            ++G S     G F +   +    S  +  +  D  + +  Y +Q+H P  L R+SQ+  
Sbjct: 49  ITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLARLSQKSS 108

Query: 193 L-----PILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDY--- 244
           L        G   YH +   G D   +++DTGI   H  FEGR       V+   D+   
Sbjct: 109 LRGGNGSDNGAYIYHSNAGNGVDV--YLLDTGIDGTHPAFEGR-------VQKAADFSSD 159

Query: 245 -----DLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYN 299
                D +GHGT  AG I S  +G+AK+  +  V+V  S G  S+  V+R +E+  +   
Sbjct: 160 PVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASKLAA 219

Query: 300 DLKKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAW 359
             K  + +L      M      +                     GNE+  AC+ SPA A+
Sbjct: 220 VTK--RPSLITIPLEMP---RNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAY 274

Query: 360 SPITVGGSTLS--DDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATE-SLSGTSMSSPHV 416
             +T+G   ++  D +A F+N+  CVD+F  GV++ +  +G  +++E  LSGTS+S+   
Sbjct: 275 GALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGVA 332

Query: 417 AGVLAYYLSL 426
           +G++AYY+S+
Sbjct: 333 SGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score = 99.8 bits (247), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 85/308 (27%), Positives = 141/308 (45%), Gaps = 25/308 (8%)

Query: 135 IGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ---RE 191
           IG    G+ G F +     +   P V  +  D ++ +  Y  Q   P  L R+S      
Sbjct: 57  IGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNS 116

Query: 192 KLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDY---DLNG 248
           ++    +  + +    G     +++D+GI   H  F  R    K I   DN     D +G
Sbjct: 117 RVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHG 175

Query: 249 HGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSG-SMSDVIRGVEYTVEAYNDLKKTKSN 307
           HGT  AG + S  +G+ K+A +  V+V+ ++ +G  +S +++ +E+ +E +     +++ 
Sbjct: 176 HGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENH-----SRAT 229

Query: 308 LKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASA---WSPITV 364
           ++ +   +     K+                     GN+   ACN SPASA    S ++V
Sbjct: 230 MRPSVAVLPFSMSKNAILNSAIESMPNSIAIVVPA-GNQHHMACNFSPASARNSQSILSV 288

Query: 365 GGSTL--SDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATES----LSGTSMSSPHVAG 418
           G      S ++A FSNYG CVD+F  GV  M T   + N+ E+    +SGTSMS    AG
Sbjct: 289 GSLDYRSSIEIASFSNYGECVDVFTSGVQ-MDTLHATTNSDENYISKVSGTSMSCAIAAG 347

Query: 419 VLAYYLSL 426
            + YY+SL
Sbjct: 348 TVGYYMSL 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 135/302 (44%), Gaps = 24/302 (7%)

Query: 133 FSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREK 192
            ++G       G F+    +++ +   V  +  D  +++  YK+Q   P  L ++S    
Sbjct: 47  ITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSS--- 103

Query: 193 LPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEG-----RASWGKTIVENDNDYDLN 247
               G  F  +D   G     +V DTGI   H   +       A +  + V    D   +
Sbjct: 104 ----GGSFT-FDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRGADP--H 156

Query: 248 GHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSN 307
           GHGT  AG IAS+ +G+ K   ++ V+V   DG   +S +++G+  +V A+    K  S 
Sbjct: 157 GHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGISASV-AHARFTKRPSV 215

Query: 308 LKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAWSPITVGGS 367
                  M++G  K                      GN+  DAC+ SP +  + + +G  
Sbjct: 216 F---VLPMTIG--KKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSL 270

Query: 368 TLSDDVAFFSNYGRCVDIFAPGVNIM---STYIGSKNATESLSGTSMSSPHVAGVLAYYL 424
              + +A FSNYG CVD++  G +I+   ST  G++   +S +GTS S    AG++ Y++
Sbjct: 271 DRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHM 330

Query: 425 SL 426
           S+
Sbjct: 331 SM 332

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 87/316 (27%), Positives = 135/316 (42%), Gaps = 39/316 (12%)

Query: 133 FSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVP---WGLGRISQ 189
           F +G S   + G F+    + + N P V  +  D  +++    +Q + P    GL  IS 
Sbjct: 49  FELG-SFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLSSISP 107

Query: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEG-----RASWGKTIVENDNDY 244
               P      + Y   GG     +++DTGI + H +         A   ++ V    D 
Sbjct: 108 LSHQP------FIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGTDP 161

Query: 245 DLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKT 304
              GHGT  AG IAS+ +G+ K+  ++ V+V  S+G   +S +++ +  T       K+ 
Sbjct: 162 Q--GHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTLTQRHIEGTKRP 219

Query: 305 KS---NLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASA-WS 360
                 L+   GN  +                          GN + DA N SPA+    
Sbjct: 220 SVVVIPLEVEDGNNPI--------LTEAIASFDQSVPIIIPAGNNAQDALNFSPANVNPK 271

Query: 361 P---ITVGGSTLSDDVAFFSNYGRCVDIFAPGVNI---MSTYIGSKNATESL----SGTS 410
           P   I VG   ++++   F+NYG  VD+F  G  I    ST + S+  + SL    SGTS
Sbjct: 272 PKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTS 331

Query: 411 MSSPHVAGVLAYYLSL 426
            SS   AGV+ YY+SL
Sbjct: 332 ASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 131/315 (41%), Gaps = 34/315 (10%)

Query: 133 FSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREK 192
             IG S   + G  ++     +        +  +  + +  Y  Q   P  LGR+++   
Sbjct: 53  IEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLTKDS- 111

Query: 193 LPILGKRFYHY-------DDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDY- 244
              +    YHY        D  G     +++DTGI + H  +  + +  K I    +   
Sbjct: 112 ---IKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYL-QNNIHKLIDLTTSPIP 167

Query: 245 --DLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGS-GSMSDVIRGVEYTVEAYNDL 301
             D NGHGT  AG I S  +G+ K A ++ V+V+ ++    +MS V+  +   +E     
Sbjct: 168 SGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSL-IE----- 221

Query: 302 KKTKSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPA---SA 358
           K  +  ++ +   +     K+                     GN+  +AC  SP      
Sbjct: 222 KHEQKTMRPSIIVLPFQTEKNTILESAIENISKKIPVIIPA-GNKHQNACKLSPMGIKKL 280

Query: 359 WSPITVGGSTLSD-----DVAFFSNYGRCVDIFAPGVNIMSTYI---GSKNATESLSGTS 410
            + + VG    S+     D+A FSNYG CVDI+  GV+I +      G K    +++GTS
Sbjct: 281 SNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTS 340

Query: 411 MSSPHVAGVLAYYLS 425
            S   VAGV+ YY+S
Sbjct: 341 YSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 79/350 (22%), Positives = 137/350 (39%), Gaps = 43/350 (12%)

Query: 133 FSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREK 192
           +S+G++   +     +   + + N   +  +  D  +      +Q+  P  L ++ + E 
Sbjct: 53  YSVGKNFQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLETEA 112

Query: 193 LPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHE--------DFEGRASWGKTIVENDNDY 244
               G   + YD   G     ++ DTGI  +          D  G    G  I     D 
Sbjct: 113 ----GDNEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDMPGMP--GPPI----RDQ 162

Query: 245 DLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKT 304
           ++  HGT  +G I S  +G+ K+  +I V V   +G   MS V++G+    +        
Sbjct: 163 EILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLNLVQQ------HV 216

Query: 305 KSNLKGAAGNMSLGAWKSXXXXXXXXXXXXXXXXXXXXXGNESDDACNSSPASAW---SP 361
           K   + +  N S    K+                     GN     C+ SP       S 
Sbjct: 217 KHTNRPSVINFSYCTLKNAILNSAFDNFPRDVPIAVAA-GNYKQPGCSFSPVGCQRNKSL 275

Query: 362 ITVGGSTLSDD---VAFFSNYGRCVDIFAPGVNIMSTYI------GSKNATESLSGTSMS 412
           +  G   ++DD   ++ FSNYG CV  +APG  +++  I       S++    +SGTS S
Sbjct: 276 LAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRPNSRDTVIIISGTSGS 335

Query: 413 SPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYL 462
           S   AGV+ YY++           E    S +I++  + +Y  N  ++ L
Sbjct: 336 SALGAGVIGYYMA------QGIPGEEVVDSLRIVQPNLTSYGKNNGINIL 379

>TDEL0A05430 Chr1 (950727..952766) [2040 bp, 679 aa] {ON} Anc_8.598
           YPL109C
          Length = 679

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 3   SFYLITSVYYFWIFTSVDAATIPVDLS---HRESAS--HDYTLINRLLNLWRGKGIEYNF 57
           S+ LI       I T    +++P+       RES+S  HD + ++ +L +W G  + Y  
Sbjct: 601 SYVLINGFPTLIILTECILSSLPILREFGLQRESSSLLHDASTLS-MLKIWFGLEVRYLM 659

Query: 58  NTGSKIYFDSAKNDMIIPN 76
           +T +K  FD  K D + PN
Sbjct: 660 STSAKKIFDLVKTDQLCPN 678

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 23/94 (24%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWG--------KTIVENDNDYDLNGHG 250
           Y++  G   V  ++D G+  + ED    F    SW         K I+ +DN      HG
Sbjct: 154 YNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGDDN------HG 207

Query: 251 THCAGTIASKH-----YGIAKQAEVIAVKVLRSD 279
           T CAG IA+        G+A  A+V  +++L +D
Sbjct: 208 TRCAGEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 29/97 (29%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWGKTIVENDNDYDLNG---------- 248
           Y++  G + V  V+D G+  + ED    F    SW         D++ NG          
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSW---------DFNDNGPMPKPRLSDD 205

Query: 249 -HGTHCAGTIASKH-----YGIAKQAEVIAVKVLRSD 279
            HGT CAG IA+        G+A  A+V  +++L ++
Sbjct: 206 YHGTRCAGEIAAVKNKACGIGVAYNAKVAGIRILSAE 242

>CAGL0L08624g Chr12 (940058..946312) [6255 bp, 2084 aa] {ON} similar
           to uniprot|P43583 Saccharomyces cerevisiae YFL007w
          Length = 2084

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 11/57 (19%)

Query: 379 YGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFY 435
           +G  VDIF P + I     GS+N    ++ + +SS      LAY LS QP + SQ Y
Sbjct: 527 HGDIVDIFLPLIKI-----GSQNKNSDITNSYISS------LAYLLSTQPPNSSQIY 572

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 27/96 (28%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWGKTIVENDN----------DYDLNG 248
           Y++  G + V  V+D G+  + ED    F    SW      NDN          DY    
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDF----NDNVALPKPRLSDDY---- 207

Query: 249 HGTHCAGTIASKH-----YGIAKQAEVIAVKVLRSD 279
           HGT CAG IA+        G+A  A+V  +++L ++
Sbjct: 208 HGTRCAGEIAAGKNQFCGVGVAYNAKVAGLRILSAE 243

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 22/109 (20%)

Query: 208 GKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDN----------DYDLNGHGTHCAGTI 257
           GK+    ++D G+  ++ED + +  +  +   NDN          DY    HGT CAG I
Sbjct: 167 GKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDY----HGTRCAGEI 222

Query: 258 ASKH-----YGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDL 301
           A+        G+A  A +  +++L   G  ++ D    + Y ++ YND+
Sbjct: 223 AAVRNDYCGVGVAFDAHISGLRILS--GELTVEDEAAALIYGLK-YNDI 268

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 20/93 (21%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWGKTIVEN------DNDYDLNGHGTH 252
           Y++  G   V  ++D G+  ++ED    F    SW      N       +DY    HGT 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY----HGTR 216

Query: 253 CAGTIASKH------YGIAKQAEVIAVKVLRSD 279
           CAG IA+K        G+   A++  +++L  D
Sbjct: 217 CAGEIAAKKGNNFCGVGVGYNAKISGIRILSGD 249

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 20/93 (21%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWGKTIVEN------DNDYDLNGHGTH 252
           Y++  G   V  ++D G+  ++ED    F    SW      N       +DY    HGT 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY----HGTR 216

Query: 253 CAGTIASKH------YGIAKQAEVIAVKVLRSD 279
           CAG IA+K        G+   A++  +++L  D
Sbjct: 217 CAGEIAAKKGNNFCGVGVGYNAKISGIRILSGD 249

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 28/94 (29%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWGKTIVENDN----------DYDLNG 248
           Y++  G   V  ++D G+  ++ED    F    SW      NDN          DY    
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDF----NDNTNLPKPRLLDDY---- 212

Query: 249 HGTHCAGTIASKH------YGIAKQAEVIAVKVL 276
           HGT CAG IA+K        G+   A++  +++L
Sbjct: 213 HGTRCAGEIAAKKGNNFCGIGVGYNAKISGIRIL 246

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 20/90 (22%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWGKTIVEN------DNDYDLNGHGTH 252
           Y++  G   V  ++D G+  ++ED    F    SW      N       +DY    HGT 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY----HGTR 216

Query: 253 CAGTIASKH------YGIAKQAEVIAVKVL 276
           CAG IA+K        G+   A++  +++L
Sbjct: 217 CAGEIAAKKGNDFCGVGVGYNAKISGIRIL 246

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 23/91 (25%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWGKTIVENDN--------DYDLNGHG 250
           Y+   GK  V  ++D G+  + ED    F    SW     EN N        DY    HG
Sbjct: 157 YEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWD--FNENQNLPKPLLYDDY----HG 210

Query: 251 THCAGTIASKH-----YGIAKQAEVIAVKVL 276
           T CAG IA+        G+A  ++V  +++L
Sbjct: 211 TRCAGEIAAAKNEYCGLGVAYGSKVSGIRIL 241

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 28/94 (29%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWGKTIVENDN----------DYDLNG 248
           Y++  G+  V  ++D G+  ++ D    F    SW      NDN          DY    
Sbjct: 175 YENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDF----NDNTQLPKPRLADDY---- 226

Query: 249 HGTHCAGTIASKH------YGIAKQAEVIAVKVL 276
           HGT CAG IA+         G+A  A+V  +++L
Sbjct: 227 HGTRCAGEIAATKDNGFCGIGVAYNAKVAGIRIL 260

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 30/95 (31%)

Query: 203 YDDRGGKDTVTFVIDTGIYVDHED----FEGRASWGKTIVENDNDYDLNG---------- 248
           Y++  G   V  ++D G+  D+++    F    SW         D++ NG          
Sbjct: 186 YENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSW---------DFNDNGPLPKPKLKDD 236

Query: 249 -HGTHCAGTIASKH------YGIAKQAEVIAVKVL 276
            HGT CAG IA+         G+A  A+V  +++L
Sbjct: 237 YHGTRCAGEIAASKNNGICGVGVAYDAKVAGIRIL 271

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,002,055
Number of extensions: 2275480
Number of successful extensions: 6364
Number of sequences better than 10.0: 81
Number of HSP's gapped: 6306
Number of HSP's successfully gapped: 88
Length of query: 485
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 371
Effective length of database: 40,409,475
Effective search space: 14991915225
Effective search space used: 14991915225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)