Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02629g6.22ON54854828310.0
KAFR0A050706.22ON56454821490.0
NCAS0D021606.22ON56355220740.0
NDAI0C026306.22ON58055320600.0
KNAG0F028906.22ON56356320580.0
Kpol_1037.276.22ON54654520370.0
Suva_15.1776.22ON54453620310.0
Smik_15.1716.22ON54453620300.0
ZYRO0C07744g6.22ON54754620250.0
TPHA0J003506.22ON55954620180.0
Skud_15.1636.22ON54453620110.0
YOR002W (ALG6)6.22ON54453620090.0
TBLA0G009706.22ON55954419980.0
TDEL0G044706.22ON54254419850.0
SAKL0E01364g6.22ON54154719440.0
KLTH0C11176g6.22ON53652919280.0
Kwal_56.224376.22ON53653919180.0
KLLA0D01221g6.22ON56654719100.0
Ecym_30276.22ON54952918610.0
ACR004W6.22ON56354718600.0
TPHA0J013805.669ON5752743084e-29
KLTH0F17666g5.669ON5552712979e-28
YOR067C (ALG8)5.669ON5772602961e-27
CAGL0L10450g5.669ON5502692942e-27
Smik_15.2475.669ON5772632915e-27
Skud_15.2345.669ON5772812908e-27
Suva_8.1185.669ON5762632891e-26
Kpol_1018.735.669ON6212632891e-26
Kwal_55.217425.669ON5552762872e-26
TBLA0A093105.669ON5464242827e-26
KLLA0F16621g5.669ON5612692792e-25
TDEL0B025405.669ON5692692721e-24
ADR210C5.669ON5722732693e-24
KAFR0D024405.669ON5752772693e-24
NDAI0F005105.669ON5702592694e-24
KNAG0L019205.669ON5684242694e-24
NCAS0G004505.669ON5702562694e-24
ZYRO0A11506g5.669ON5562722668e-24
SAKL0G00836g5.669ON5612712651e-23
Ecym_40515.669ON6042622454e-21
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02629g
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...  1095   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   832   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   803   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   798   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   797   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   789   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   786   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   786   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   784   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   781   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   779   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   778   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   774   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   769   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   753   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   747   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   743   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   740   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   721   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   721   0.0  
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   123   4e-29
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   119   9e-28
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   118   1e-27
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   117   2e-27
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   116   5e-27
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   116   8e-27
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   115   1e-26
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   115   1e-26
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   115   2e-26
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   113   7e-26
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   112   2e-25
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   109   1e-24
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   108   3e-24
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   108   3e-24
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   108   4e-24
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   108   4e-24
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   108   4e-24
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   107   8e-24
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   106   1e-23
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    99   4e-21

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score = 1095 bits (2831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/548 (97%), Positives = 536/548 (97%)

Query: 1   MSSEKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIG 60
           MSSEKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIG
Sbjct: 1   MSSEKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIG 60

Query: 61  LGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKL 120
           LGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKL
Sbjct: 61  LGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKL 120

Query: 121 GTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQ 180
           GTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQ
Sbjct: 121 GTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQ 180

Query: 181 FIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMS 240
           FIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMS
Sbjct: 181 FIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMS 240

Query: 241 LYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRR 300
           LYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRR
Sbjct: 241 LYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRR 300

Query: 301 IFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRK 360
           IFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRK
Sbjct: 301 IFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRK 360

Query: 361 HLLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLW 420
           HLLPYALAACSMSFYLFSFQVHEK            FTSRDWNVLSMVSWINNVALFTLW
Sbjct: 361 HLLPYALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLW 420

Query: 421 PLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHS 480
           PLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHS
Sbjct: 421 PLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHS 480

Query: 481 IFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTL 540
           IFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTL
Sbjct: 481 IFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTL 540

Query: 541 LKKNIQDL 548
           LKKNIQDL
Sbjct: 541 LKKNIQDL 548

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/548 (69%), Positives = 457/548 (83%), Gaps = 1/548 (0%)

Query: 2   SSEKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGL 61
           +  K + K  SK  +E  EE FYASPLYDFL+PFRPAG+QWL ++II+ FA+IIRCAIGL
Sbjct: 17  AKSKSNPKKASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGL 76

Query: 62  GPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLG 121
           G YSG    PM GDFEAQRHWMEITQHLPISKWY++DL+YWGLDYPPLTA+HSY+LGK+G
Sbjct: 77  GSYSGMGHSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIG 136

Query: 122 TFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQF 181
           +F  P WF L+ SRGIE +G+K+YMR TVL+SEA+FY PA++YF+KW G+ RNQSPIGQ+
Sbjct: 137 SFIYPKWFTLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQY 196

Query: 182 IAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSL 241
           IAA AILFQPSLMLIDHGHFQYNS+MLG TVYAINNLLD+FY+ A++CFVLSICFKQMSL
Sbjct: 197 IAATAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSL 256

Query: 242 YYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIF-GGLDGLAQTVRR 300
           YYAPIFF YLL +S+FFP+LFNIPR + I+  T+VTF AM+SP YIF GGL+ L Q+V R
Sbjct: 257 YYAPIFFGYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHR 316

Query: 301 IFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRK 360
           IFPFARGIFEDKVANFWCV N ++K+K+ FT DQL++YSL  TV+GF PA+++I+LYP+K
Sbjct: 317 IFPFARGIFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKK 376

Query: 361 HLLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLW 420
           HLLPYALAACSMSF+LFSFQVHEK            +TS DWNVLSMV WINNVALFTLW
Sbjct: 377 HLLPYALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLW 436

Query: 421 PLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHS 480
           PLLK++GL LQY VCF LSNWL+GNFSF+TP+FLPK +TPGPSIS++ +NY RRSLLPH+
Sbjct: 437 PLLKKDGLILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHN 496

Query: 481 IFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTL 540
           I WK++IVSSY+ M  +H+LD F+E P  +PD+W+ LNC IGF SF  FW+WTYY   TL
Sbjct: 497 ILWKVVIVSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTL 556

Query: 541 LKKNIQDL 548
             K + DL
Sbjct: 557 RNKTLMDL 564

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/552 (68%), Positives = 453/552 (82%), Gaps = 4/552 (0%)

Query: 1   MSSEKKDKKAVSKFESEQ-GEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAI 59
           +SS+KK  K     +     EESFYASPLYD L+PFRPAGSQW+TE+ I++F++IIRCA+
Sbjct: 12  LSSQKKSGKTKETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAV 71

Query: 60  GLGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGK 119
           GLGP+SGY   PM GDFEAQRHWMEITQHLPI KWY++DLKYWGLDYPPLTA+HSY+ GK
Sbjct: 72  GLGPFSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGK 131

Query: 120 LGTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIG 179
           +G+F NP+WFALDSSRG E Q LK +MR TVL+SEA+FY+P VVYF KWLG+ R QSPIG
Sbjct: 132 IGSFFNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIG 191

Query: 180 QFIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQM 239
           QFIAAAAIL QPSL+LIDHGHFQYNS+ LG TVYAINNLLDEFYA AA+CFVLSICFKQM
Sbjct: 192 QFIAAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQM 251

Query: 240 SLYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLA---Q 296
           +LYY+PIFFAYLL +S+F PKLFNIPRF++I+IAT+ +F  M+ P Y+FGG  GL    Q
Sbjct: 252 TLYYSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQ 311

Query: 297 TVRRIFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIIL 356
           ++ RIFPFARGIFEDKVANFWCV N I K+K+LFT  +L++YSL+LTVVGF PAM++I+ 
Sbjct: 312 SIHRIFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILF 371

Query: 357 YPRKHLLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVAL 416
           YP+K+LLPYAL+ACSM+FYLFSFQVHEK            +TS D NVLS VSW+NN+ L
Sbjct: 372 YPKKYLLPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGL 431

Query: 417 FTLWPLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSL 476
           FTLWPLLK++GL LQY+VC  LSNWLIGNFSFITP FLPK +TPGPS+S + +NY  RSL
Sbjct: 432 FTLWPLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSL 491

Query: 477 LPHSIFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYK 536
           LP +IFWK+IIV SYI M A H LD F+  P  +PDLWVILNCT+GF  F LFW+W YYK
Sbjct: 492 LPRNIFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYK 551

Query: 537 FCTLLKKNIQDL 548
             +++KK++  L
Sbjct: 552 LFSMIKKSLHHL 563

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/553 (68%), Positives = 451/553 (81%), Gaps = 6/553 (1%)

Query: 2   SSEKKDKKAVSK--FESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAI 59
              KK KK  +    E+E  +ESFYASPLYDFL+PFRPAGSQW+TE+II++FA+IIRCA+
Sbjct: 28  EDTKKSKKMNNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAV 87

Query: 60  GLGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGK 119
           GLGPYSG+   PM GDFEAQRHWMEITQ+LPIS+WY++DL+YWGLDYPPLTAFHSYL GK
Sbjct: 88  GLGPYSGFNTPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGK 147

Query: 120 LGTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIG 179
           +G+F  P+WF L  SRG E Q LK +MR TVL SE++ Y+PAVVYFTKWLG+RRNQSPIG
Sbjct: 148 IGSFFQPNWFTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIG 207

Query: 180 QFIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQM 239
           QFIA AAILFQPSL+LIDHGHFQ+NS+MLG TVY +NNLLDEFYA AA+CFVLSICFKQM
Sbjct: 208 QFIAVAAILFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQM 267

Query: 240 SLYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDG----LA 295
           +LYY+PIFFAYLL +S+F P+LFNIPRF +IS AT+ TF +MF P Y FGG +G    L 
Sbjct: 268 ALYYSPIFFAYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLL 327

Query: 296 QTVRRIFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILII 355
           Q+++RIFPFARGIFEDKVANFWCV N I K+K  FT +QL++YSLILT++ F PAM++I+
Sbjct: 328 QSIKRIFPFARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVIL 387

Query: 356 LYPRKHLLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVA 415
           LYPRK+LL YAL+ACSMSFYLFSFQVHEK            +TS D NVLS VSW+NN+ 
Sbjct: 388 LYPRKYLLLYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIG 447

Query: 416 LFTLWPLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRS 475
           LFTLWPLLK++GL LQY+VC  LSNWLIGNFSFITPRFLPK +TPGPSI  + +NYRR +
Sbjct: 448 LFTLWPLLKKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPT 507

Query: 476 LLPHSIFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYY 535
           LLP +  WK+IIV SY+ M   HF+D FIE P  +PDLWVILNCT+GF  F LFWLW YY
Sbjct: 508 LLPSNWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYY 567

Query: 536 KFCTLLKKNIQDL 548
           K  ++ KKNI  L
Sbjct: 568 KLFSMTKKNIHQL 580

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/563 (66%), Positives = 456/563 (80%), Gaps = 15/563 (2%)

Query: 1   MSSEKKD---------KKAVSKFESEQGE------ESFYASPLYDFLFPFRPAGSQWLTE 45
           MSSEKK+          K++SK +  + E      E FYASP+YDFL+PFR  GSQW+TE
Sbjct: 1   MSSEKKEPQGEDASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTE 60

Query: 46  WIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLD 105
           +II++F +II+ AIGLG YSG++  PM GDFEAQRHWMEITQHLP+S+WY++DL+YWGLD
Sbjct: 61  YIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLD 120

Query: 106 YPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYF 165
           YPP TA+HSYLLGK+GTF  P WF LD+SRG+ET G+K+YMRFTVLLSE IFY+PA+VYF
Sbjct: 121 YPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYF 180

Query: 166 TKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAP 225
           TKW+GRR+ QSPIGQF+AAAAILFQP+LMLIDHGHFQYN +MLG TVYAINNLLD FYA 
Sbjct: 181 TKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAM 240

Query: 226 AAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPF 285
           AA+CFVLSICFKQM+LYYAPIFFA LL +S+FFP+LFNIPRF+S++ ATL +   MF+P 
Sbjct: 241 AAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPL 300

Query: 286 YIFGGLDGLAQTVRRIFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVV 345
           YIFGG+  + Q++ RIFPFARGIFEDKVANFWCV N   K+K +FT  +L+ YSL+ TVV
Sbjct: 301 YIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVV 360

Query: 346 GFAPAMILIILYPRKHLLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVL 405
           GF PA +++I YP+K L+PY LAACSM+F+LFSFQVHEK            FTS +WN L
Sbjct: 361 GFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNL 420

Query: 406 SMVSWINNVALFTLWPLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSIS 465
           SMV W+NNVALFTLWPLLK++GL+LQY VC  + NWL+GNFSFITPRFLPK +TPGPSIS
Sbjct: 421 SMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSIS 480

Query: 466 SVSDNYRRRSLLPHSIFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVS 525
           ++++NYRRRSLLPH+I WK+II+ SY+ M   H L+  I AP ++PDLWV LNCT+GF  
Sbjct: 481 NIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGC 540

Query: 526 FSLFWLWTYYKFCTLLKKNIQDL 548
           F LFW+WTYYK  TL  K IQ+L
Sbjct: 541 FVLFWMWTYYKLITLRNKTIQEL 563

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/545 (68%), Positives = 446/545 (81%), Gaps = 4/545 (0%)

Query: 7   DKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSG 66
            KK +S+  ++  EESF+ASPLYDFL PFRP  +QWLTE+II++FA+I+RCAIGLG YSG
Sbjct: 3   SKKKISRI-NKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSG 61

Query: 67  YKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNP 126
             + PM GDFEAQRHWMEITQHLPISKWY++DL+YWGLDYPPLTA+HSY+LG +G+F N 
Sbjct: 62  MGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNK 121

Query: 127 DWFALDSSRGIETQG--LKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAA 184
            WFAL+ SRG E++   LK YMR TV++SE IFY+P V+YFTKW+GR R QS IGQ+IAA
Sbjct: 122 SWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAA 181

Query: 185 AAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYA 244
           AAILFQPSLMLIDHGHFQYNS+MLG TVYAINNLLDEFYAPAA+CFVLSICFKQM+LYYA
Sbjct: 182 AAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYA 241

Query: 245 PIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGG-LDGLAQTVRRIFP 303
           PIFF YLLGRS+F  K FNI RF+SI+I+T+  F +M++P Y+FGG L  + Q+V RIFP
Sbjct: 242 PIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFP 301

Query: 304 FARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLL 363
           FARG+FEDKVANFWCV N  +K+K+L+T  +L++YSLI TVVGF PA++ I+ YP+KHLL
Sbjct: 302 FARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLL 361

Query: 364 PYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLL 423
           PYALAACSMSFYLFSFQVHEK            +TS DWNVLS VSW+NNV LFTLWPLL
Sbjct: 362 PYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLL 421

Query: 424 KREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFW 483
           K++GL LQY VCFFLSNWLIGNFSFITP+FLPK +TPGP + +  D Y RRSLLPH+I W
Sbjct: 422 KKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILW 481

Query: 484 KLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKK 543
           K+IIVSSYI M   H  ++F+  PP +PD+WV++NC +GF  F LFWLW YYK  TL  K
Sbjct: 482 KIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANK 541

Query: 544 NIQDL 548
            +Q L
Sbjct: 542 TLQYL 546

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/536 (69%), Positives = 444/536 (82%), Gaps = 4/536 (0%)

Query: 16  SEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGD 75
           ++  EESFYASP+YDFL+PFRP G+QWL E+II + A+I+RCAIGLGPYSG    P+HGD
Sbjct: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGD 69

Query: 76  FEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSR 135
           FEAQRHWMEITQHLP+SKWY+YDL+YWGLDYPPLTAFHSYLLG +GTF NP WFALD SR
Sbjct: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSR 129

Query: 136 GIET--QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSL 193
           G E+   GLK YMR TV++S+ +FY PAV+YFTKWLGR RNQSPIGQ IAAAAILFQPSL
Sbjct: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSL 189

Query: 194 MLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLG 253
           MLIDHGHFQYNS+MLG T YAINNLLDE+YA AA+CFVLSICFKQM+LYYAPIFFAYLL 
Sbjct: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLS 249

Query: 254 RSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGG-LDGLAQTVRRIFPFARGIFEDK 312
           RS+FFPK FNI R   I+ ATL TF+ MF+P Y  GG L  + Q + R+FPFARGIFEDK
Sbjct: 250 RSLFFPK-FNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARGIFEDK 308

Query: 313 VANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSM 372
           VANFWCV N  VK+K  F+  QL++YSL+ TV+GF PAM++ +L+P+KHLLPY L ACSM
Sbjct: 309 VANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSM 368

Query: 373 SFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQY 432
           SF+LFSFQVHEK            ++S DWNVLS+VSWINNVALFTLWPLLK++GL+LQY
Sbjct: 369 SFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428

Query: 433 FVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYI 492
            V F L+NWLIGNFSFITPRFLPK +TPGPSISS++ +YRRRSLLP+++ WK  I+ +YI
Sbjct: 429 VVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488

Query: 493 GMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548
            M  YHFLDLF+  P ++PDLWV+LNC +GF+ FS+FW+W+YYK  T   K+++DL
Sbjct: 489 AMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/536 (69%), Positives = 440/536 (82%), Gaps = 4/536 (0%)

Query: 16  SEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGD 75
           ++  EESFYASP+YDFL+PFRP G+QWL E+II + A+I+RC IGLGPYSG    P+HGD
Sbjct: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGD 69

Query: 76  FEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSR 135
           FEAQRHWMEITQHLP+SKWY+YDL+YWGLDYPPLTAFHSYLLG +G+F NP WFALD SR
Sbjct: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSR 129

Query: 136 GIET--QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSL 193
           G E+   GLK YMR TV++S+ +FY PAV+YFTKWLGR RNQSPIGQ IAA+AILFQPSL
Sbjct: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSL 189

Query: 194 MLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLG 253
           MLIDHGHFQYNS+MLG T YAINNLLDE+YA AA+CFVLSICFKQM+LYYAPIFFAYLL 
Sbjct: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLS 249

Query: 254 RSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGG-LDGLAQTVRRIFPFARGIFEDK 312
           RS+ FPK FNI R   IS ATL TF  M +P Y  GG L  + Q + RIFPFARGIFEDK
Sbjct: 250 RSLLFPK-FNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARGIFEDK 308

Query: 313 VANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSM 372
           VANFWCV N  VK+K  F+  QL++YSL+ TV+GF PAM++ +L+P+KHLLPY L ACSM
Sbjct: 309 VANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSM 368

Query: 373 SFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQY 432
           SF+LFSFQVHEK            ++S DWNVLS+VSWINNVALFTLWPLLKR+GL+LQY
Sbjct: 369 SFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQY 428

Query: 433 FVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYI 492
            V F LSNWLIGNFSFITPRFLPK +TPGPSISS++ +YRRRSLLP+++ WK  I+ +YI
Sbjct: 429 AVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488

Query: 493 GMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548
            M  YHFLDLF+  P ++PDLWV+LNCT+GF  FS+FW+W+YYK  T   K+++DL
Sbjct: 489 AMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/546 (69%), Positives = 449/546 (82%), Gaps = 3/546 (0%)

Query: 5   KKDKKAVSKFESEQ-GEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGP 63
            K  K V K +++   EESFYASPLYDFL+PF+P GSQWL E+III+FA+IIRCAIGLGP
Sbjct: 3   SKTSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGP 62

Query: 64  YSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTF 123
           YSG    PMHGDFEAQRHW+EITQHLPIS+WYY+DL+YWGLDYPPLTA+HSY+LGKLG+ 
Sbjct: 63  YSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSL 122

Query: 124 CNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIA 183
            NPDWFAL+ SRG+E+  LK YMRFTV+LSE IFY+PAVVYFTKW+GR R  SP+GQFIA
Sbjct: 123 INPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIA 182

Query: 184 AAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYY 243
           AAAILFQP+LMLIDHGHFQYN +MLGFTVYAIN+L+DEFYAPAA CFVLSICFKQM+LYY
Sbjct: 183 AAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYY 242

Query: 244 APIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFG-GLDGLAQTVRRIF 302
           +PIFFAYLLGR +F   +   PRF+SI++AT+ TF  M+ P YI G G   + Q+V RIF
Sbjct: 243 SPIFFAYLLGRCVFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIF 301

Query: 303 PFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHL 362
           PFARGIFEDKVANFWCV N  VK+K LFT  QL++YSL+ T +GF PA++L++LYP+KHL
Sbjct: 302 PFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHL 361

Query: 363 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPL 422
           +P+ALAACSMSF+LFSFQVHEK            +TS +W+VLS+VSWINNV LFTLWPL
Sbjct: 362 VPFALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPL 421

Query: 423 LKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIF 482
           LK++GL LQY VCF   NWLIGNFSF+TP FLPKF+TPGPS+SSV  NYRRRSLLP SI 
Sbjct: 422 LKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSII 481

Query: 483 WKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLK 542
           WKLIIV SYI M A H LD+F+  P  +PDLWVILNCT+GF  F LFWLW YYK  +L  
Sbjct: 482 WKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAG 541

Query: 543 KNIQDL 548
           +++Q L
Sbjct: 542 QSLQQL 547

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/546 (66%), Positives = 448/546 (82%), Gaps = 1/546 (0%)

Query: 4   EKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGP 63
           ++  K  +S  +     E FYASPLY FL PF+   +QWL+ +II++FA+IIRCAIGLGP
Sbjct: 14  KQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGP 73

Query: 64  YSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTF 123
           YSG  + PM GDFEAQRHWMEITQHLPIS+WY+YDL+YWGLDYPPLTA+HSY+ G +G F
Sbjct: 74  YSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKF 133

Query: 124 CNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIA 183
            NP WF L++SRG+E + LK +MR T ++SE IFY+PA++YFT W+G++R QSP+GQ+IA
Sbjct: 134 FNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIA 193

Query: 184 AAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYY 243
           AAAILFQP LMLIDHGHFQYNS+MLG TVYAINNLLD+ YAPAAI FV+SICFKQMSLYY
Sbjct: 194 AAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYY 253

Query: 244 APIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIF-GGLDGLAQTVRRIF 302
           APIFFAYLLGRS+F  + FN+ RF++I+IAT+V+F  +F+P Y+F GG   + Q+V RIF
Sbjct: 254 APIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIF 313

Query: 303 PFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHL 362
           PFARGIFEDKVANFWCV N I+K+KV +T D+L++YSLILTVVGF PAM+ I+ +P+KHL
Sbjct: 314 PFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHL 373

Query: 363 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPL 422
           LPY+LAAC+MSF+LFSFQVHEK            +TS DWNVLS+VSWINNVALFTLWPL
Sbjct: 374 LPYSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPL 433

Query: 423 LKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIF 482
           LK++G+ LQY VCF LSNWLIGNFSF TPRFLPK +TPGP I +V+ +YRRRSLLP++I 
Sbjct: 434 LKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNII 493

Query: 483 WKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLK 542
           WK+IIV SYI M A   L+LF+E PP++PD++V+LNCT+GF  F+ FWLW YYK  TL  
Sbjct: 494 WKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTS 553

Query: 543 KNIQDL 548
           KN+Q L
Sbjct: 554 KNLQYL 559

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/536 (69%), Positives = 438/536 (81%), Gaps = 4/536 (0%)

Query: 16  SEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGD 75
           ++  EESFYASP+YDFL+PFRP G+QWL E+II + A+I+RCAIGLGPYSG    P+HGD
Sbjct: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGD 69

Query: 76  FEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSR 135
           FEAQRHWMEITQHLP+SKWY+YDL+YWGLDYPPLTAFHS L G +GTF NP WFALD SR
Sbjct: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSR 129

Query: 136 GIET--QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSL 193
           G E+   GLK YMR TV++S+ +FY PAV+YFTKWLGR RNQSPIGQ IAAAAILFQPSL
Sbjct: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSL 189

Query: 194 MLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLG 253
           MLIDHGHFQYNS+MLG T YAINNLLDE+YA AA+CFVLSICFKQM+LYYAPIFFAYLL 
Sbjct: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLS 249

Query: 254 RSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGG-LDGLAQTVRRIFPFARGIFEDK 312
           RS+ FPK FNI R   I+ ATL TF+ + +P Y  GG L  + Q + RIFPF+RGIFEDK
Sbjct: 250 RSLLFPK-FNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDK 308

Query: 313 VANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSM 372
           VANFWCV N  VK+K  FT  QL++YSL+ TV+GF PAMI+ +L+P+KHLLPY L ACSM
Sbjct: 309 VANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSM 368

Query: 373 SFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQY 432
           SF+LFSFQVHEK            ++S DWNVLS+VSWINNVALFTLWPLLK++GL+LQY
Sbjct: 369 SFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428

Query: 433 FVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYI 492
            V F LSNWLIGNFSFITPRFLPK +TPGPSISS++ +YRRRSLLP+++ WK  I+ +YI
Sbjct: 429 TVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488

Query: 493 GMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548
            M  YH LDLF+  P ++PDLWV+LNC +GF  FS+FW+W+YYK  T   K+++DL
Sbjct: 489 AMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/536 (69%), Positives = 440/536 (82%), Gaps = 4/536 (0%)

Query: 16  SEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGD 75
           ++  EESFYASP+YDFL+PFRP G+QWL E+II + A+I+RC IGLGPYSG    P++GD
Sbjct: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGD 69

Query: 76  FEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSR 135
           FEAQRHWMEITQHLP+SKWY+YDL+YWGLDYPPLTAFHSYLLG +G+F NP WFAL+ SR
Sbjct: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSR 129

Query: 136 GIET--QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSL 193
           G E+   GLK YMR TV++S+ +FY PAV+YFTKWLGR RNQSPIGQ IAA+AILFQPSL
Sbjct: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSL 189

Query: 194 MLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLG 253
           MLIDHGHFQYNS+MLG T YAINNLLDE+YA AA+CFVLSICFKQM+LYYAPIFFAYLL 
Sbjct: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLS 249

Query: 254 RSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGG-LDGLAQTVRRIFPFARGIFEDK 312
           RS+ FPK FNI R   I+ ATL TF  +F+P Y  GG L  + Q + RIFPFARGIFEDK
Sbjct: 250 RSLLFPK-FNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARGIFEDK 308

Query: 313 VANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSM 372
           VANFWCV N  VK+K  FT  QL++YSLI TV+GF PAMI+ +L+P+KHLLPY L ACSM
Sbjct: 309 VANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSM 368

Query: 373 SFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQY 432
           SF+LFSFQVHEK            ++S DWNVLS+VSWINNVALFTLWPLLK++GL+LQY
Sbjct: 369 SFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428

Query: 433 FVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYI 492
            V F LSNWLIGNFSFITPRFLPK +TPGPSISS++ +YRRRSLLP+++ WK  I+ +YI
Sbjct: 429 AVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488

Query: 493 GMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548
            M  YHFLD F+  P ++PDLWV+LNC +GF+ FS+FWLW+YYK  T   K+++DL
Sbjct: 489 AMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/544 (70%), Positives = 445/544 (81%), Gaps = 16/544 (2%)

Query: 20  EESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQ 79
           EE+FYASPL+DFL+PFRP GSQWLTE++II+FA+IIRCAI LG YSG    PM GDFEAQ
Sbjct: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQ 76

Query: 80  RHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIET 139
           RHWMEITQHLPISKWY++DL+YWGLDYPP TA+HSY  GKLG+F NPDWFAL+SSRG E+
Sbjct: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136

Query: 140 --QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLID 197
              GLK YMRFTV+LSEA+FY+PAVVYFTKWLG+ RNQSPIGQFIAAAAILFQPSLMLID
Sbjct: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196

Query: 198 HGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMF 257
           HGHFQYNS+MLG TVYAINNLLDEFY PAAICFVLS+CFKQM+LYY+PIFF YLL +S+ 
Sbjct: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256

Query: 258 FPKLFNIPRFISISIATLVTFTAMFSPFYIFG-------------GLDGLAQTVRRIFPF 304
            P   NI RFI ++I+T+V+F  MF P Y+FG             GL+ L Q +RRIFPF
Sbjct: 257 HPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315

Query: 305 ARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLP 364
           ARGIFEDKVANFWCV N ++K++ LFT +QL+ YSL+ T++GF P+MI I LYPRK L+P
Sbjct: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375

Query: 365 YALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLK 424
           YALAACSMSF+LFSFQVHEK            +TS DWNVLS+V WINNVALFTLWPLL+
Sbjct: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435

Query: 425 REGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWK 484
           ++GL LQYFVC+FLSNWLIGNFSFITP+FLP F+TPGPSIS++ D+YRR SLLPH+I WK
Sbjct: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495

Query: 485 LIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKN 544
           +II+SSYI M A   LDLF + P  +PDLW+ILNCT+GF  F LFWLW  YK   +  K 
Sbjct: 496 IIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555

Query: 545 IQDL 548
           + DL
Sbjct: 556 LNDL 559

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/544 (66%), Positives = 444/544 (81%), Gaps = 6/544 (1%)

Query: 6   KDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYS 65
           K+K+A    +    EESFYASPLYDFL+PFRPAGSQWLTE++I++FA+II CA+G G YS
Sbjct: 4   KNKEA----KRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYS 59

Query: 66  GYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCN 125
           G    PM GDFEAQRHWMEITQHL  S+WY++DL+YWGLDYPPLTA+HSY+LGK+G+F  
Sbjct: 60  GQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIK 119

Query: 126 PDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAA 185
           P+WF L+ SRGIET  LK +MRFTVLLSE +FY+PAVVYFTKWLG+ R +SPIGQFI+AA
Sbjct: 120 PEWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAA 179

Query: 186 AILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAP 245
           AILFQPSLMLIDHGHFQYN +MLG TVYAIN+L +EFYA AAICFVLSICFKQM+LYYAP
Sbjct: 180 AILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAP 239

Query: 246 IFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIF-GGLDGLAQTVRRIFPF 304
           IFFAYLL +S+F P+ FN PR  +I++AT+++F AM++P YIF GGL  + Q+V RIFPF
Sbjct: 240 IFFAYLLSKSLFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPF 298

Query: 305 ARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLP 364
           ARGIFEDKVANFWCV N   K+K +F  +QL++YSLI T++GF PA+I+I LYP+KH++ 
Sbjct: 299 ARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIIC 358

Query: 365 YALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLK 424
           YALA CSMSFYLFSFQVHEK            +TS +W+VLSM +WINNV LFTL+PLLK
Sbjct: 359 YALATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLK 418

Query: 425 REGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWK 484
           ++GL LQYFVCF LSNWL+GNFSF+TP+FLPKF+TPGPS+SSV  NYRRRS LP ++ WK
Sbjct: 419 KDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWK 478

Query: 485 LIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKN 544
           +IIVSSY  M   H +D  +  P  +PDLWV+LNC +GF  F+LFWLW+YY   T+ +K 
Sbjct: 479 IIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKT 538

Query: 545 IQDL 548
           +Q L
Sbjct: 539 LQQL 542

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/547 (65%), Positives = 440/547 (80%), Gaps = 7/547 (1%)

Query: 1   MSSEKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIG 60
           MSS++K       +  +  +ESF+ASPL+DFL PFRP  +QW  ++II++FA+IIRC +G
Sbjct: 1   MSSKRK------PYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVG 54

Query: 61  LGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKL 120
           LG +SG    PMHGDFEAQRHWME+T +LP+S+WY+YDL YWGLDYPPLTA+HSY+LGKL
Sbjct: 55  LGSFSGMNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL 114

Query: 121 GTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQ 180
           G   +P WF L  SRG E+  LK+YMRFTVLLSE + Y+P V+YF KW+G+ R Q+PIGQ
Sbjct: 115 GDIFDPTWFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQ 174

Query: 181 FIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMS 240
           +IAAAAILFQPSL+LIDHGHFQYNS+MLG TVYAINNLLDE+YAPAAICFVLS+CFKQM+
Sbjct: 175 YIAAAAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMA 234

Query: 241 LYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRR 300
           LYYAPIFF+YLL +S+F P LFN+PR ++++ ATL++F AMF P Y++GG+  + Q++ R
Sbjct: 235 LYYAPIFFSYLLSKSLFSP-LFNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293

Query: 301 IFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRK 360
           IFPF+RGIFEDKVANFWC  N  +K+KVL+T  QL+MYSL  T +GF PA ILI  YP+K
Sbjct: 294 IFPFSRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKK 353

Query: 361 HLLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLW 420
           HL+PYAL ACSMSF+LFSFQVHEK            +TS DWNVLSMVSWINN+A FTLW
Sbjct: 354 HLIPYALTACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLW 413

Query: 421 PLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHS 480
           PLLK++GL LQY     LSNWLIGNFSF+TPRFLPKF+TPGPS S VS+NYRRRSLLP +
Sbjct: 414 PLLKKDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDN 473

Query: 481 IFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTL 540
           IFWKLIIV+SYI M   H LD +++ P ++PDLWV+LNC++GF SF LFW+W YYK  TL
Sbjct: 474 IFWKLIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTL 533

Query: 541 LKKNIQD 547
             K + D
Sbjct: 534 RNKTLYD 540

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/529 (65%), Positives = 428/529 (80%), Gaps = 1/529 (0%)

Query: 20  EESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQ 79
           +ESF+ASPLYDFL PFRP  +Q+  E++I++FA++IRCA+GLG +SG    PMHGDFEAQ
Sbjct: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68

Query: 80  RHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIET 139
           RHWME+T +LP+S+WY++DL+YWGLDYPPLTA+HSY LGKLG+  NP+WFAL SSRG ET
Sbjct: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128

Query: 140 QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHG 199
             LK YMRFTV+LSEA  Y+PAV+YFTKW G +R QSPIGQ+IAAAAILFQPSL+LIDHG
Sbjct: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188

Query: 200 HFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFP 259
           HFQYNS+MLG TVYAINNLLD F+ PAAICF+LS+CFKQM+L+Y+PIFFAYLL RS+F P
Sbjct: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248

Query: 260 KLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRIFPFARGIFEDKVANFWCV 319
             F   RF+S++++T++TF  MFSP Y+FGG+  + Q++ RIFPF+RGIFEDKVANFWCV
Sbjct: 249 S-FKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKVANFWCV 307

Query: 320 VNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSMSFYLFSF 379
            N IVK+   FT DQL+  S   T  GF P+  L++LYP+KH++PY LAACSM+F+LF F
Sbjct: 308 SNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLFGF 367

Query: 380 QVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQYFVCFFLS 439
           QVHEK            F S DWNVL++VSWINNVALFTLWPLLK++ L LQY +   LS
Sbjct: 368 QVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMMLLS 427

Query: 440 NWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYIGMTAYHF 499
           NWLIGNFSF+TPRFLP FITPGPS+S+V++ YRRRS LP++I WK++I++SYI M   H 
Sbjct: 428 NWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVIHI 487

Query: 500 LDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548
           LDLF++ P + PDLWV++NC +GF  FS+FWLW  YK  T+  K+I DL
Sbjct: 488 LDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/539 (63%), Positives = 429/539 (79%), Gaps = 7/539 (1%)

Query: 9   KAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYK 68
           K VSK       E F+ASPLYDFL PFRP  +Q+  E++I++FA++IRCA+GLG +SG  
Sbjct: 4   KKVSK------NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEN 57

Query: 69  DGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDW 128
            GP+HGDFEAQRHWME+T HLP+S+WY+YDL+YWGLDYPPLTA+HSY+LGKLG+  N +W
Sbjct: 58  SGPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEW 117

Query: 129 FALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAIL 188
           FAL SSRGIE   +K YMRFTV+LSEA  Y+PAV+YFTKW G +R QSPIGQ+IAAAAIL
Sbjct: 118 FALLSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAIL 177

Query: 189 FQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFF 248
           FQPSL+LIDHGHFQYNS+MLG TVY+INNLLD +Y PAAICFVLS+CFKQM+LYY+P+FF
Sbjct: 178 FQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFF 237

Query: 249 AYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRIFPFARGI 308
           AYLL   +  P L N+PRF+S++ +T+++F  +FSP Y+FGG   + Q++ RIFPF+RGI
Sbjct: 238 AYLLSECLISPSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGI 296

Query: 309 FEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALA 368
           FEDKVANFWCV N + K+   +T  +L+ +S+I T  GF P+ ++++ YP+KH++P+ALA
Sbjct: 297 FEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALA 356

Query: 369 ACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLKREGL 428
           ACSM+F+LFSFQVHEK            + S DWNVLSMVSWINNVALFTLWPLLK++ L
Sbjct: 357 ACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHL 416

Query: 429 YLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIV 488
            LQY +   LSNWLIGNFSF+TPRFLPKFITPGPSIS VS+ YRRRS LP + FWKLIIV
Sbjct: 417 TLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIV 476

Query: 489 SSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQD 547
           +SY+ M A H LD F+  P   PDLWV+LNC +GF  F++FWLW +YK  T+   N+QD
Sbjct: 477 ASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/547 (62%), Positives = 427/547 (78%), Gaps = 3/547 (0%)

Query: 2   SSEKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGL 61
           ++E     A+ K    +  E+F+ASP+YDFL PFRP G+QW  +++I++FA+IIRCA+GL
Sbjct: 23  NAETTTSTAIMK--KVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGL 80

Query: 62  GPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLG 121
           G YSG    PM GDFEAQRHWMEITQHLP+ +WY+YDL+YWGLDYPPLTA+HSYLLGKLG
Sbjct: 81  GGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLG 140

Query: 122 TFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQF 181
           +F    WF L+SSRG E+  LK+YMRFTV++SE + Y+PAV+YFTKW+G+ R+QSPIGQ+
Sbjct: 141 SFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQY 200

Query: 182 IAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSL 241
           IAAAAILFQP+L+L+DHGHFQYN +MLG TVY +NNLLD FYA  AICFVLS+CFKQM+L
Sbjct: 201 IAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMAL 260

Query: 242 YYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRI 301
           YY+PIFFAYLL +S + P + N+PR  +IS++T + F   F P YIFGG   L Q++ RI
Sbjct: 261 YYSPIFFAYLLSKSTYSPGI-NLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRI 319

Query: 302 FPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKH 361
           FPFARGIFEDKVANFWCV N  +K++ LFT   L++YSL+ TV+G  P+ I+  LYP++H
Sbjct: 320 FPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRH 379

Query: 362 LLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWP 421
           LLPYALAACSMSF+LFSFQVHEK            +TSRDWNVLS+V WINNVALFTLWP
Sbjct: 380 LLPYALAACSMSFFLFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWP 439

Query: 422 LLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSI 481
           LLK++ L LQY V F  SNWLIGNFSF+TPRFLPKF+TPGPSIS +  +YRR SLLP S+
Sbjct: 440 LLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSL 499

Query: 482 FWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLL 541
            W+LIIV SYI M   HFLD ++  P ++PDLWV+ NC++GF  F  FW+W  YK   + 
Sbjct: 500 IWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMR 559

Query: 542 KKNIQDL 548
              +QDL
Sbjct: 560 NSTLQDL 566

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/529 (62%), Positives = 421/529 (79%), Gaps = 1/529 (0%)

Query: 20  EESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQ 79
           EESF+ASPLYDFL+P RP  +QW  ++II++FA+I+R A+GLG YSG   GP+ GDFEAQ
Sbjct: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFGDFEAQ 81

Query: 80  RHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIET 139
           RHWMEIT  LPIS+WY+YDL+YWGLDYPPLTA+HSY+LG+LG+F N  WF L++SRG E+
Sbjct: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141

Query: 140 QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHG 199
             LK++MR TVLLSE + Y+PAV+YFT+W+GR RNQSPIGQ++A AAILFQPSL+LIDHG
Sbjct: 142 IDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILIDHG 201

Query: 200 HFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFP 259
           HFQYN +MLG  VY INNLLDEFY  AAICFVLS+ FKQM+LYY+P+ FAYL  RS ++P
Sbjct: 202 HFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAYYP 261

Query: 260 KLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRIFPFARGIFEDKVANFWCV 319
           + FN PRF  I+IATL+TF A+++P  +FG    + Q+V R+FPF+RGIFEDKVANFWCV
Sbjct: 262 R-FNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGIFEDKVANFWCV 320

Query: 320 VNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSMSFYLFSF 379
            N I+K++ L+T  QL+ Y L+ T +   PA I+I LYP+K LLPYALAACSM+F+LFSF
Sbjct: 321 TNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMAFFLFSF 380

Query: 380 QVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQYFVCFFLS 439
           QVHEK              S +W+VLSMV+WINNVALFTLWPLLK++GL LQY + F LS
Sbjct: 381 QVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYAIMFLLS 440

Query: 440 NWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYIGMTAYHF 499
           NWL+GNFSF+TP FLPKF+TPGPS+S V+D+YRRRSLLP +IFW++IIVSSY+ M   H 
Sbjct: 441 NWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFIHL 500

Query: 500 LDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548
           LDL+++ P  +PD+WV+  C +GF  F+ FWLW YY+   +   ++ +L
Sbjct: 501 LDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/547 (59%), Positives = 429/547 (78%), Gaps = 2/547 (0%)

Query: 3   SEKKDKKAVSKFESEQG-EESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGL 61
           S++  +K ++    + G +E+F+ASPLYDFL+P RP  +QW  ++II++FA+IIR A+GL
Sbjct: 18  SKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGL 77

Query: 62  GPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLG 121
           G YSG    PM GDFEAQRHWME+TQH+P+SKWY++ L+YWGLDYPPLTA+HSYLLGKLG
Sbjct: 78  GGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLG 137

Query: 122 TFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQF 181
           ++ +P+WF+L +SRG E++ LK+YMR TV+LSE  FY+PAV+YFT+W+GRRR QSPIGQ+
Sbjct: 138 SYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQY 197

Query: 182 IAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSL 241
           IA AAILFQP+L+LIDHGHFQYN +MLG TV AINNLLD++YA AA+ FV S+ FKQM+L
Sbjct: 198 IAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMAL 257

Query: 242 YYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRI 301
           YYAP+ F YLL RS+++P+L NIPRF+++++ATL+ F  +++P Y+ G +  + Q++ R+
Sbjct: 258 YYAPVMFVYLLSRSIYYPRL-NIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRV 316

Query: 302 FPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKH 361
           FPF RG+FEDKVANFWCV N +VK+K  +T  QL+ +SL+LT     P++I+  LYP+K 
Sbjct: 317 FPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKF 376

Query: 362 LLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWP 421
           +LPYALAACSMSF+LF FQVHEK            +TS DWNVLSMV+WINN+ALFTLWP
Sbjct: 377 MLPYALAACSMSFFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWP 436

Query: 422 LLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSI 481
           LLK++GL LQY + F LSNWLIGNFSFITP FLPK +TPGPS+S V+D YRRRSLLP +I
Sbjct: 437 LLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNI 496

Query: 482 FWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLL 541
            W++IIV SYI + A H  +L+     R PD+WV+ NC +G  SF+LFW+W  YK   + 
Sbjct: 497 IWRIIIVVSYICVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMR 556

Query: 542 KKNIQDL 548
              I DL
Sbjct: 557 NSTISDL 563

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  123 bits (308), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 133/274 (48%), Gaps = 31/274 (11%)

Query: 70  GPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWF 129
           G    DF+  R+W+ IT +LPISKWYY +   W LDYPP  A+  ++L +      P+  
Sbjct: 59  GYYSTDFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFA----PEIV 114

Query: 130 ALDSSRGIETQGLKN-----YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAA 184
             D    I   G        + R TV++SE + +     Y      + R Q     F+ A
Sbjct: 115 KNDGCLDIVEVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVA 170

Query: 185 AAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYA 244
           ++I+  P  ++IDH HFQYN  +    + +I     + Y   A+ + +S+CFK + LY A
Sbjct: 171 SSIVLSPGFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLA 230

Query: 245 PIFFAYLLGRSMFFPKLFNIPRFISIS----------IATLVT--FTAMFSPFYIFGGLD 292
           P +F +LL   +   + F    ++ +           +A +V+  FT  F+PF IF    
Sbjct: 231 PCYFVFLLRAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAPF-IF---- 285

Query: 293 GLAQTVRRIFPFARGIFEDKVA-NFWCVVNTIVK 325
            L Q + R+FPF+RG+     A NFW + + I K
Sbjct: 286 QLPQVLSRLFPFSRGLTHAYWAPNFWAMYSFIDK 319

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  119 bits (297), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 127/271 (46%), Gaps = 25/271 (9%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  LP+ KWYY     W LDYPP  A+  +LL +       D   LD  
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQFVPQRVQDDGCLDIV 103

Query: 135 RGIETQGLKN--YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPS 192
             +   GL    + R TV++SE + ++   VY  K     R+      F+ A++I+  P 
Sbjct: 104 -AVGQFGLPTIVFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSIVLSPG 158

Query: 193 LMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLL 252
            ++IDH HFQYN  +    + +I     + Y      F  ++CFK + LY AP FFA+LL
Sbjct: 159 FLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFAFLL 218

Query: 253 G---------RSMFFPKLFNIPR---FISISIATLVTFTAMFSPFYIFGGLDGLAQTVRR 300
                     R   +  L ++ R      +    L  F   F+PF     +  L Q + R
Sbjct: 219 RVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF-----IYQLPQLMSR 273

Query: 301 IFPFARGIFEDKVA-NFWCVVNTIVKFKVLF 330
           +FPF+RG+     A NFW + + + K   LF
Sbjct: 274 LFPFSRGLTHAYWAPNFWALYSALDKVLTLF 304

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/260 (31%), Positives = 124/260 (47%), Gaps = 25/260 (9%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  LPIS+WYY     W LDYPP  A+  + L +       D   LD  
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKSVRDDGCLDIV 125

Query: 135 RGIETQGLKN--YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPS 192
             I   GL    + R TV+ SE + ++   +Y        R+QS    F+ A++I+  P 
Sbjct: 126 E-IGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 193 LMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLL 252
            ++IDH HFQYN  +    + +I    ++ Y   A+ +  +ICFK + LY AP +F +LL
Sbjct: 181 FLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 253 GRSMFFPKLFNIPRFIS----------ISIATLVT--FTAMFSPFYIFGGLDGLAQTVRR 300
              +     F    +            + +AT+V   FT  F PF        + Q + R
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF-----AHQMPQVLSR 295

Query: 301 IFPFARGIFEDKVA-NFWCV 319
           +FPF+RG+     A NFW +
Sbjct: 296 LFPFSRGLTHAYWAPNFWAL 315

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 122/269 (45%), Gaps = 31/269 (11%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  LP+ +WYY     W LDYPP  A+  + L +      P +   D  
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFV----PSYVKSDGC 91

Query: 135 RGIETQG-----LKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILF 189
             I   G        + R TV+ SE + ++   VY        R QS    F+ A++I  
Sbjct: 92  LDIVEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAI 147

Query: 190 QPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFA 249
            P  ++IDH HFQYN  +    + +I    ++ Y      + +++CFK + LY AP +F 
Sbjct: 148 SPGFLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFV 207

Query: 250 YLLGRSMFFPKLFNIPRF------------ISISIATLVTFTAMFSPFYIFGGLDGLAQT 297
           +LL   +   K F    +            + +    + TF   F PF     +  L Q 
Sbjct: 208 FLLRAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGPF-----IFDLPQL 262

Query: 298 VRRIFPFARGIFEDKVA-NFWCVVNTIVK 325
           + R+FPF+RG+     A NFW + +TI K
Sbjct: 263 LTRLFPFSRGLTHAYWAPNFWAIYSTIDK 291

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  116 bits (291), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 83/263 (31%), Positives = 122/263 (46%), Gaps = 31/263 (11%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  LPIS+WYY     W LDYPP  A+  + L +       D   LD  
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 135 RGIETQGLKN--YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPS 192
             +   GL    + R TV+ SE + Y    +Y        R+QS    F+ A++I+  P 
Sbjct: 126 E-VGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 193 LMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLL 252
            ++IDH HFQYN  +    + +I    ++ Y   A  +  +ICFK + LY AP +F +LL
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 253 ---------------GRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQT 297
                             +F  +  N+ +  SI I     FT  F PF        + Q 
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIG---IFTICFVPF-----AHQMPQV 292

Query: 298 VRRIFPFARGIFEDKVA-NFWCV 319
           + R+FPF+RG+     A NFW +
Sbjct: 293 LSRLFPFSRGLTHAYWAPNFWAL 315

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  116 bits (290), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 130/281 (46%), Gaps = 34/281 (12%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  LPISKWYY     W LDYPP  A+  + L +       D   LD  
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 135 RGIETQGLKN--YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPS 192
             +   GL    + R TV+ S+ + ++   VY        R+QS    F+ A++I+  P 
Sbjct: 126 E-VGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPG 180

Query: 193 LMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLL 252
             +IDH HFQYN  +    + +I     + Y   AI +  +ICFK + LY AP +F +LL
Sbjct: 181 FFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLL 240

Query: 253 ---------------GRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQT 297
                             +F  +  N+ +  SI I     FT  F PF        + Q 
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIG---IFTICFLPF-----AHQMPQV 292

Query: 298 VRRIFPFARGIFEDKVA-NFWCVVNTIVKFKVLFTNDQLRM 337
           + R+FPF+RG+     A NFW + + + K   + T   LR+
Sbjct: 293 LSRLFPFSRGLTHAYWAPNFWALYSFMDK---ILTTIMLRL 330

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 123/263 (46%), Gaps = 31/263 (11%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  LP+S+WYY     W LDYPP  A+  + L +       D   LD  
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 135 RGIETQGLKN--YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPS 192
             +   GL    + R TV+ SE + +    +Y        R+QS    F+ A++I+  P 
Sbjct: 126 E-VGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 193 LMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLL 252
            ++IDH HFQYN  +    + +I    ++ Y   A+ +  SICFK + LY AP +F +LL
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLL 240

Query: 253 ---------------GRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQT 297
                             +F  +  N+ +  SI I     FT  F PF        + Q 
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIG---IFTICFLPF-----AHQMPQV 292

Query: 298 VRRIFPFARGIFEDKVA-NFWCV 319
           + R+FPF+RG+     A NFW +
Sbjct: 293 LSRLFPFSRGLTHAYWAPNFWAL 315

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 121/263 (46%), Gaps = 31/263 (11%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+WM IT  LPISKWY+ +   W LDYPP  A+  + L +      P     D  
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFV----PKIVRDDGC 164

Query: 135 RGIETQG-----LKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILF 189
             I   G        + R TV++SE   +     Y        R QS    F+ A++I+ 
Sbjct: 165 LDIVEVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVL 220

Query: 190 QPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFA 249
            P  +++DH HFQYN+ +    + +I     + Y   A+ + +++CFK + LY AP +F 
Sbjct: 221 SPGFLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFV 280

Query: 250 YLLGRSMFFPKLFNIP------------RFISISIATLVTFTAMFSPFYIFGGLDGLAQT 297
           +LL   +   K F               R + +    L  F   F+PF IF     + Q 
Sbjct: 281 FLLRAYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAPF-IF----QMPQV 335

Query: 298 VRRIFPFARGIFEDKVA-NFWCV 319
           + R+FPF+RG+     A NFW +
Sbjct: 336 LSRLFPFSRGLTHAYWAPNFWAI 358

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  115 bits (287), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 128/276 (46%), Gaps = 35/276 (12%)

Query: 70  GPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWF 129
           G +  DF+  R+W+ IT  LP+ +WY+ +   W LDYPP  A+  + L +L     P+  
Sbjct: 39  GYLSTDFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLV----PNIV 94

Query: 130 ALDSSRGIETQGLKN-----YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAA 184
             D    I   G        + R TV+ SE + ++   VY  K     R+      F+ A
Sbjct: 95  RQDGCLDIVKVGQFGMPTIVFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVA 150

Query: 185 AAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYA 244
           ++I+  P  ++IDH HFQYN  +    + +I    ++ Y    + F ++ICFK + LY A
Sbjct: 151 SSIVLSPGFLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLA 210

Query: 245 PIFF-----AYLLGRSMFFPKLFNIPRFISI---------SIATLVTFTAMFSPFYIFGG 290
           P FF      Y+L  S F  K +N    ISI             L  F   F+PF     
Sbjct: 211 PSFFVFLLRVYVLDFSNFHFKSYN--DLISIVQWRNLFKLGSVVLCVFGVCFAPF----- 263

Query: 291 LDGLAQTVRRIFPFARGIFEDKVA-NFWCVVNTIVK 325
           +    Q + R+FPF+RG+     A NFW + + + K
Sbjct: 264 ISQWPQLLSRLFPFSRGLTHAYWAPNFWAMYSLLDK 299

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  113 bits (282), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 101/424 (23%), Positives = 177/424 (41%), Gaps = 72/424 (16%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  LP+ +WYY +   W LDYPP  A+  + L +      P +   D  
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFV----PKFVKEDGC 98

Query: 135 RGIETQGLKN-----YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILF 189
             I  +G        + R TV++SE + ++   V+        + QS    F+ A++I+ 
Sbjct: 99  LDILPEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIIL 154

Query: 190 QPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFA 249
            P  ++IDH HFQYN  + G  + +I    ++ Y    + + +++CFK + LY AP +F 
Sbjct: 155 SPGFLMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFV 214

Query: 250 YLLGRSMFFPKLFNIPRFISISIA------------TLVTFTAMFSPFYIFGGLDGLAQT 297
           +LL   +   + F    +  + +              +      F PF+       + Q 
Sbjct: 215 FLLRAYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFW-----RDMNQL 269

Query: 298 VRRIFPFARGIFEDKVA-NFWCVVNTIVK-FKVLFTN---------DQLR---------- 336
           + R+FPF+RG+     A NFW + + + K   +LF           D++           
Sbjct: 270 LSRLFPFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSR 329

Query: 337 -----MYSLILTVVGFAPAMILIILYPRKHLLPY-----------ALAACSMSFYLFSFQ 380
                ++ +IL  +      +L + Y    ++P            +L  C  + +LF + 
Sbjct: 330 GLVEDVFFVILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWH 389

Query: 381 VHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLL-KREGLYLQYFVCFFLS 439
           VHEK                D  +LS    + +    +L+PLL K +   L+   C +L 
Sbjct: 390 VHEKAILLVIIPFSFLVVC-DRRLLSSFMLVGSAGYVSLFPLLFKGQDFLLK---CLYLI 445

Query: 440 NWLI 443
            W I
Sbjct: 446 VWCI 449

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 130/269 (48%), Gaps = 33/269 (12%)

Query: 70  GPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWF 129
           G    DF+  R+W+ IT  LP++KWY      W LDYPP  A+  + L +       +  
Sbjct: 47  GYYSTDFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQFVPKSVAEDG 106

Query: 130 ALDSSRGIETQGLKN--YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQ----FIA 183
            LD  + + + GL    + R TV+LSE + Y    V+         N S I +    F+ 
Sbjct: 107 CLDIVK-VGSFGLPTIIFQRITVILSELVLYAALQVFI--------NTSDISEKSANFVV 157

Query: 184 AAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYY 243
           A++I+  P L+++DH HFQYN  + G  + +I    ++ Y   A  F +++CFK + LY 
Sbjct: 158 ASSIVLSPGLLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYL 217

Query: 244 APIFF-----AYLLGRSMF----FPKLFNIPR---FISISIATLVTFTAMFSPFYIFGGL 291
           AP +F     AY+L  S F    +  L +I +    + ++   +  F+  F PF     +
Sbjct: 218 APAYFVFLLRAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPF-----I 272

Query: 292 DGLAQTVRRIFPFARGIFEDKVA-NFWCV 319
               Q + R+FPF+RG+     A N W V
Sbjct: 273 TTWQQLLARLFPFSRGLTHAYWAPNVWAV 301

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  109 bits (272), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 122/269 (45%), Gaps = 31/269 (11%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  LP+ +WYY     W LDYPP  A+  +LL +      P     D +
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFV----PKIVKEDGA 110

Query: 135 RGIETQG-----LKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILF 189
             I   G        + R TV+ SE + ++   V+        + +S    F+ A++I+ 
Sbjct: 111 LDIVEIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVL 166

Query: 190 QPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFA 249
            P  ++IDH HFQYN  +    + +I     + Y   A  + +++CFK + LY AP +F 
Sbjct: 167 SPGFLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFV 226

Query: 250 YLLGRSMFFPKLFNIPRF------------ISISIATLVTFTAMFSPFYIFGGLDGLAQT 297
           +LL   +   K F    +              ++   L  F   F PF     L  L Q 
Sbjct: 227 FLLRAYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPF-----LYDLPQV 281

Query: 298 VRRIFPFARGIFEDKVA-NFWCVVNTIVK 325
           + R+FPF+RG+     A NFW + + + K
Sbjct: 282 MTRLFPFSRGLTHAYWAPNFWAIYSFLDK 310

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  108 bits (269), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 124/273 (45%), Gaps = 28/273 (10%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DFE  R+W+ +T  LP+ KWY      W +DYPPL A+  + L ++     P     D  
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQV----VPGAVRRDGC 114

Query: 135 RGIETQGLKN-----YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILF 189
             +  +G        + R TV+ SE + Y+   VY +    + R  +    F+   ++  
Sbjct: 115 LKLVAEGRYGWPTVVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVAL 170

Query: 190 QPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFA 249
            P+ +L+DH HFQYN  +    V +I    +  Y      F +++C K + LY AP +F 
Sbjct: 171 SPAFLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFV 230

Query: 250 YLLG---------RSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRR 300
           +LL          R   +  L    R+ ++     V    M   F  F G+  + Q + R
Sbjct: 231 FLLRAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAPFAGV--MPQLMAR 288

Query: 301 IFPFARGIFEDKVA-NFWCV---VNTIVKFKVL 329
           +FPF+RG+     A NFW +   V+ ++ F +L
Sbjct: 289 LFPFSRGLTHAYWAPNFWAIYSFVDKVLTFLML 321

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  108 bits (269), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 126/277 (45%), Gaps = 35/277 (12%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  + +  WYY     W LDYPP  A+  + +  L     P +   D  
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLV----PSFVRRDGC 119

Query: 135 RGIETQGLKN-----YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILF 189
             I   G        + R TV+ SE++ ++   +Y        R QS    FI A++I+ 
Sbjct: 120 LDIVEVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVL 175

Query: 190 QPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFA 249
            P  +++DH HFQYN  +    V +I    ++ Y   A+ + +++CFK + LY AP +F 
Sbjct: 176 SPGFLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFV 235

Query: 250 YLLG--------------RSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLA 295
           +LL               + + F  L        + +  +  F+  F PF IF     + 
Sbjct: 236 FLLRVYVLNFENFKFRSYKDLIF--LIRWKNLCQLGMIVVGVFSLCFGPF-IF----DMP 288

Query: 296 QTVRRIFPFARGIFEDKVA-NFWCVVNTIVKFKVLFT 331
           Q + R+FPF+RG+     A NFW + + + K   +F 
Sbjct: 289 QLLSRLFPFSRGLTHAYWAPNFWALYSFLDKVLTVFA 325

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 115/259 (44%), Gaps = 23/259 (8%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALD-S 133
           DF+  R+W+ IT  LP+ +WYY     W LDYPP  A+  + + +       D   LD  
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDIV 113

Query: 134 SRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSL 193
             G        + R +V++SE + ++    +  K     R QS    FI A +I+  P  
Sbjct: 114 PVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIILSPGF 169

Query: 194 MLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLG 253
           ++IDH HFQYN  +    + +I     E Y    + + +++CFK + LY AP +F +LL 
Sbjct: 170 LIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 229

Query: 254 RSMFFPKLFNIPRFISISI------------ATLVTFTAMFSPFYIFGGLDGLAQTVRRI 301
             +   K F    +  + +              L  F   F PF     +  L Q   R+
Sbjct: 230 AYVLNVKNFKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFLPF-----IYHLPQVFTRL 284

Query: 302 FPFARGIFEDKVA-NFWCV 319
           FPF RG+     A NFW +
Sbjct: 285 FPFGRGLTHAYWAPNFWAI 303

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 109/424 (25%), Positives = 170/424 (40%), Gaps = 82/424 (19%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT  LP+ +WYY     W LDYPP  A+  ++L +      P     D  
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQF----VPAAVRADGC 108

Query: 135 RGIETQGLKN-----YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILF 189
             I  QG+       + R TV+ SE + ++   VY        + QS    F+ A++I+ 
Sbjct: 109 LDIVPQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVL 164

Query: 190 QPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFA 249
            P L+++DH HFQYN  +    + +I       +   A  +  ++CFK + LY AP +F 
Sbjct: 165 SPMLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFM 224

Query: 250 YLLG---------RSMFFPKLFNI---PRFISISIATLVTFTAMFSPFYIFGGLDGLAQT 297
           +LL          R   +  LF I    R   +    L      F+PF        + Q 
Sbjct: 225 FLLRTYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPF-----ARDMPQL 279

Query: 298 VRRIFPFARGIFEDKVA-NFWCV------VNTIVKFKV-LFTN---------------DQ 334
           + R+FPF+RG+     A NFW +      V T+   KV LF                 D 
Sbjct: 280 LSRLFPFSRGLTHAYWAPNFWALYSLCDKVLTVALLKVPLFHRLILKVLSPKIFPASLDI 339

Query: 335 LR-----------------MYSLILTVVGFAPAMILIILYPRKHLLPY-----------A 366
           +R                 +Y ++L  +  A   +L +LY    +LP            +
Sbjct: 340 IRQRLKKNANHGTKGLVEDVYFVVLPQITPATTFLLTLLYQVLAVLPLLFDASFKRFLGS 399

Query: 367 LAACSMSFYLFSFQVHEKXXXXXXXXXXXXFTSRDWNVLSMVSWINNVALFTLWPLLKRE 426
           L  C  + +LF + VHEK                D  +L+    +      +L+PLL + 
Sbjct: 400 LTLCGFASFLFGWHVHEK-AIMLVIIPFSFLVVYDRRLLTSFKLVTTAGYVSLFPLLYKN 458

Query: 427 GLYL 430
             YL
Sbjct: 459 DDYL 462

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 120/256 (46%), Gaps = 17/256 (6%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ +T  LP+ +WYY     W LDYPP  A+  +++ +       D   LD  
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 135 R-GIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSL 193
             G   +    + R +V+ SE + ++    +      + R QS    FI A +I+  P  
Sbjct: 116 EIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILSPGF 171

Query: 194 MLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLG 253
           +++DH HFQYN  +    + +I     + Y   A+ +  ++CFK + LY AP +F +LL 
Sbjct: 172 LIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLLR 231

Query: 254 RSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLA---------QTVRRIFPF 304
             +   K F    +    +  LV +T +F    +   + G+          Q + R+FPF
Sbjct: 232 AYVLNVKGFQFKSY--KDLVRLVQWTNLFRLAGVVLSIVGVCFGPFIFDMPQLLTRLFPF 289

Query: 305 ARGIFEDKVA-NFWCV 319
           +RG+     A NFW +
Sbjct: 290 SRGLTHAYWAPNFWAI 305

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  107 bits (266), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 125/272 (45%), Gaps = 37/272 (13%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134
           DF+  R+W+ IT +LP+ +WYY     W LDYPP  A+  + L +      P     D  
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQF----VPGTVKQDGC 100

Query: 135 RGIETQGLKN-----YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILF 189
             I  +G        + R TV+LSE + ++   V+        R QS    F+ A++I+ 
Sbjct: 101 LEIVDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVL 156

Query: 190 QPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFA 249
            P+ +++DH HFQYN  +    + +I       Y   A  + +++CFK + LY AP +F 
Sbjct: 157 SPAFLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFV 216

Query: 250 YLL---------------GRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGL 294
           +LL                  +F  K  ++ +  SI I     F   F PF     +  L
Sbjct: 217 FLLRAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIG---VFALCFGPF-----VKDL 268

Query: 295 AQTVRRIFPFARGIFEDKVA-NFWCVVNTIVK 325
            Q + R+FPF+RG+     A NFW + + + K
Sbjct: 269 PQVLTRLFPFSRGLTHAYWAPNFWALYSFLDK 300

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 124/271 (45%), Gaps = 25/271 (9%)

Query: 70  GPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWF 129
           G    DF+  R+W+ IT  LP+ +WY      W LDYPP  A+  + L +       D  
Sbjct: 43  GYFSTDFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDG 102

Query: 130 ALDSSRGIETQGLKN--YMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAI 187
            LD    +   G+    + R TV++SE + ++   ++  K     ++      FI A++I
Sbjct: 103 CLDIVE-VGNFGMPTIIFQRITVIVSEVLLFVVLQIFINKSATNEKS----ANFIVASSI 157

Query: 188 LFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIF 247
           +  P  +++DH HFQYN  +    + AI       Y      F  ++CFK + LY AP F
Sbjct: 158 VLSPGFLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSF 217

Query: 248 FAYLLGRSMF---------FPKLFNI---PRFISISIATLVTFTAMFSPFYIFGGLDGLA 295
           F +LL   +          +  L +I    R + + +  L  F   F+PF     +  + 
Sbjct: 218 FVFLLRAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF-----ISEMP 272

Query: 296 QTVRRIFPFARGIFEDKVA-NFWCVVNTIVK 325
           Q + R+FPF+RG+     A NFW + + + K
Sbjct: 273 QLLERLFPFSRGLTHAYWAPNFWALYSLLDK 303

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 75/262 (28%), Positives = 116/262 (44%), Gaps = 29/262 (11%)

Query: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALD-S 133
           D E  R+W+ +T  LP+  WY      W LDYPP  A+  ++L +       D   LD  
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 134 SRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSL 193
             G        ++R TV+ +E + ++   V+        R  +    FI A++I   P  
Sbjct: 153 KEGKFGWPTVVFLRLTVIGTEILLFVVLQVFINTSDESERTVN----FIIASSIALSPGF 208

Query: 194 MLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLG 253
           +++DH HFQYN  +    + +I     E Y      F   +CFK + LY AP +F +LL 
Sbjct: 209 LIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTFLLR 268

Query: 254 -----------RS----MFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTV 298
                      R+    +F  + FN+ +   I ++ L      F PF     +  L Q +
Sbjct: 269 AYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSIL---AVCFVPF-----IPVLPQLI 320

Query: 299 RRIFPFARGIFEDKVA-NFWCV 319
            R+FPF+RG+     A NFW V
Sbjct: 321 SRLFPFSRGLTHAYWAPNFWAV 342

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.144    0.476 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,914,086
Number of extensions: 2407228
Number of successful extensions: 6462
Number of sequences better than 10.0: 45
Number of HSP's gapped: 6460
Number of HSP's successfully gapped: 51
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 68 (30.8 bits)