Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02607g6.24ON20820810621e-149
Smik_13.1586.24ON2082089641e-134
Kpol_1037.286.24ON2082089621e-133
Suva_13.1616.24ON2082089611e-133
Skud_13.1536.24ON2082089611e-133
YML001W (YPT7)6.24ON2082089601e-133
TDEL0G044506.24ON2082089581e-133
SAKL0E01386g6.24ON2082089501e-132
NCAS0H008506.24ON2082089501e-132
KNAG0M012206.24ON2072089491e-131
NDAI0D008406.24ON2082089431e-131
KLTH0C11132g6.24ON2082089411e-130
ZYRO0C07700g6.24ON2072089381e-130
Kwal_56.224406.24ON2082089371e-130
KAFR0G026706.24ON2082089341e-129
ACR003C6.24ON2082089331e-129
Ecym_30286.24ON2082089301e-129
TPHA0J003606.24ON2092099131e-126
KLLA0D01265g6.24ON2072079051e-125
TBLA0A071806.24ON2082089011e-124
Ecym_73058.70ON2132023579e-42
ZYRO0C07062g6.49ON2142063561e-41
AGL021W8.70ON2122023525e-41
KNAG0D026508.70ON2112063517e-41
SAKL0B02332g8.70ON2132023517e-41
YLR262C (YPT6)6.49ON2152093501e-40
Skud_12.3416.49ON2162103492e-40
KLLA0D05313g8.25ON2042003482e-40
KLTH0C10384g6.49ON2342053502e-40
Kpol_1011.38.70ON2142053482e-40
TPHA0F025006.49ON2151813473e-40
CAGL0K06017g6.49ON2191803473e-40
NDAI0G033408.70ON2072033464e-40
NCAS0D025006.49ON2221873474e-40
Kwal_23.50588.70ON2132023464e-40
KLTH0A02662g8.70ON2132023464e-40
Smik_12.3366.49ON2161733465e-40
KAFR0C033308.70ON2102033455e-40
TPHA0P003608.70ON2142023456e-40
NCAS0J006308.70ON2182013457e-40
NCAS0C040208.70ON2102033448e-40
Suva_10.3596.49ON2152093449e-40
Ecym_15188.25ON2042053439e-40
KLLA0E12079g8.70ON2142013431e-39
ZYRO0F03872g8.70ON2172013431e-39
KAFR0B016608.70ON2062033421e-39
Kwal_56.225556.49ON2122043422e-39
KLLA0F20471g6.49ON2122053422e-39
Kpol_1042.26.49ON2142093412e-39
Kwal_14.11168.25ON2042003403e-39
SAKL0B01012g8.25ON2042053403e-39
KAFR0A052606.49ON2351663423e-39
KLTH0G18788g8.25ON2041983394e-39
ABR220W8.25ON2041963394e-39
KNAG0E027206.49ON2311813414e-39
TBLA0E031906.49ON2071813394e-39
CAGL0F02123g8.70ON2152053395e-39
TDEL0G042106.49ON2221773396e-39
AGR257C6.49ON2201653388e-39
YFL005W (SEC4)8.70ON2151683371e-38
CAGL0K12672g8.25ON2062003361e-38
SAKL0E02090g6.49ON2141773352e-38
Smik_6.738.70ON2151683343e-38
Suva_6.198.25ON2062003316e-38
KNAG0G009308.70ON2132013317e-38
TDEL0C009808.70ON2151993318e-38
Suva_6.548.70ON2151683318e-38
TDEL0C004908.25ON2082003309e-38
Kpol_1023.218.25ON2072043291e-37
NDAI0G030508.25ON2101983291e-37
KAFR0C035808.25ON2122043282e-37
Skud_6.328.25ON2062003272e-37
Smik_6.408.25ON2062003272e-37
YFL038C (YPT1)8.25ON2062003272e-37
NDAI0I023806.49ON2221733283e-37
TBLA0C004508.25ON2102013273e-37
Skud_6.668.70ON2151683273e-37
TBLA0D026508.70ON2172083273e-37
Ecym_31376.49ON2212133274e-37
ZYRO0F02816g8.25ON2092003247e-37
TPHA0D002708.25ON2072063221e-36
KNAG0E031008.25ON2122033195e-36
KAFR0J018502.196ON2092083161e-35
KAFR0A035601.289ON2072063152e-35
KLLA0D02376g1.289ON2072053142e-35
NCAS0C037108.25ON2112023133e-35
KNAG0C018401.338ON2122103082e-34
NCAS0B067202.196ON2122123056e-34
TBLA0C027801.289ON2202003057e-34
Smik_14.2342.196ON2202143031e-33
Suva_8.1422.196ON2092082961e-32
Kpol_1016.241.289ON2112142961e-32
Ecym_63281.289ON2052042942e-32
TPHA0I027801.289ON2082072942e-32
Smik_15.2692.196ON2102092942e-32
Kpol_1029.162.196ON2112122942e-32
CAGL0G07689g1.289ON2152092943e-32
Skud_15.2532.196ON2092082925e-32
YOR089C (VPS21)2.196ON2102092925e-32
AER434C3.521ON2191802926e-32
TBLA0B018202.196ON2122112917e-32
TPHA0I025901.338ON2251712919e-32
TDEL0D015701.289ON2172102901e-31
AAL176C1.289ON2052042882e-31
TBLA0C049103.521ON2312012892e-31
Kwal_14.23941.289ON2072062872e-31
CAGL0J08635g2.196ON2082082872e-31
KLTH0H09768g1.289ON2292062883e-31
Skud_14.2382.196ON2202142873e-31
SAKL0D05940g1.289ON2072062863e-31
Suva_7.513.521ON2211722873e-31
Ecym_12073.521ON2171792864e-31
Kpol_423.123.521ON2201902865e-31
CAGL0K09394g3.521ON2211672865e-31
Smik_5.1543.521ON2231722865e-31
SAKL0E09922g2.196ON2132112855e-31
TPHA0P009502.196ON2131802855e-31
CAGL0C02453g3.521ON2181722856e-31
Suva_14.2472.196ON2182122849e-31
ZYRO0B09152g1.338ON2232032841e-30
YNL093W (YPT53)2.196ON2202142831e-30
Suva_5.1283.521ON2231722831e-30
Skud_5.1403.521ON2231722831e-30
YER031C (YPT31)3.521ON2231722831e-30
KLTH0G08206g2.196ON2122122821e-30
Skud_7.583.521ON2221722822e-30
YGL210W (YPT32)3.521ON2221722822e-30
KAFR0C043101.338ON1992042802e-30
Smik_7.533.521ON2221722813e-30
Ecym_53622.196ON2092072803e-30
KLTH0G01760g3.521ON2181712803e-30
ACL084C2.196ON2072062794e-30
SAKL0F01914g3.521ON2211712804e-30
TPHA0D034303.521ON2231712804e-30
ZYRO0C15554g2.196ON2112092794e-30
KAFR0F041603.521ON2451902815e-30
KLLA0B00671g3.521ON2191872787e-30
KLLA0C13728g2.196ON2082082778e-30
TDEL0C046602.196ON2112112778e-30
ZYRO0E08492g3.521ON2181712752e-29
NDAI0I029103.521ON2191722734e-29
Kwal_23.29782.196ON2112132724e-29
NDAI0B049801.289ON2272252727e-29
NCAS0E006003.521ON2191872718e-29
NCAS0B073601.338ON2251712719e-29
KNAG0B005803.521ON2251712719e-29
Smik_2.4081.338ON1992072699e-29
KNAG0C016001.289ON2141742691e-28
KNAG0I010802.196ON2531702702e-28
AEL187C1.338ON2081762655e-28
TDEL0D058903.521ON2291722665e-28
Smik_11.2711.289ON2342212666e-28
Skud_11.2471.289ON2342212658e-28
Ecym_63091.338ON2082122621e-27
YKR014C (YPT52)1.289ON2342322632e-27
NCAS0B076301.289ON2161812612e-27
ZYRO0G21384g1.289ON2182102612e-27
Kwal_56.22441singletonOFF1181172532e-27
Suva_11.2461.289ON2362232605e-27
Suva_4.5261.338ON1982052575e-27
YBR264C (YPT10)1.338ON1992062568e-27
NDAI0B041802.182ON3291902631e-26
CAGL0I09306g1.338ON2062062542e-26
TDEL0D020601.338ON2021682532e-26
SAKL0D06490g1.338ON2182162525e-26
Skud_2.3971.338ON1992082506e-26
YOR101W (RAS1)2.182ON3091652523e-25
Smik_15.2812.182ON3121872523e-25
Skud_15.2662.182ON3132072514e-25
NCAS0B068502.182ON3241762507e-25
NDAI0B046801.338ON2232142448e-25
TPHA0B030002.182ON3051892481e-24
Suva_8.1552.182ON3161712462e-24
TDEL0F013602.182ON2871762443e-24
KAFR0J019702.182ON3181762453e-24
KLLA0C13387g2.182ON2841712425e-24
CAGL0B04521g2.182ON3391652446e-24
TBLA0B01750singletonON3731962457e-24
KAFR0D020402.182ON2741962391e-23
Kpol_1029.82.182ON3051652401e-23
Kpol_1066.111.338ON2421872353e-23
YNL098C (RAS2)2.182ON3222082393e-23
Suva_14.2412.182ON3221762375e-23
Kwal_26.83872.182ON2921602356e-23
KLTH0D08932g2.182ON2921892349e-23
Smik_14.2272.182ON3221652351e-22
Skud_14.2322.182ON3231652351e-22
KNAG0H033802.182ON3241652341e-22
Kwal_14.24841.338ON2031852253e-22
KLLA0F01232g1.338ON2102142254e-22
KLTH0H10274g1.338ON2011652244e-22
Ecym_53492.182ON2871982278e-22
SAKL0E10252g2.182ON2681602268e-22
ZYRO0D14784g6.90ON2142142221e-21
CAGL0J05632g2.200ON1881812201e-21
ZYRO0B09438g2.182ON2981762261e-21
KLTH0G14850g6.90ON2141742212e-21
Suva_7.4434.73ON2711962242e-21
Kwal_56.233616.90ON2141742202e-21
Suva_8.2416.90ON2202142203e-21
Smik_15.3706.90ON2202142203e-21
YOR185C (GSP2)6.90ON2202142203e-21
TDEL0F027704.73ON2381792213e-21
Kwal_14.22444.73ON2441772213e-21
ADL262W2.182ON2701962223e-21
Suva_10.3896.90ON2191652193e-21
Skud_12.3756.90ON2191652193e-21
Smik_12.3716.90ON2191652193e-21
YLR293C (GSP1)6.90ON2191652193e-21
Skud_15.3526.90ON2201652194e-21
KAFR0F036704.73ON2631742214e-21
Ecym_30976.90ON2141742176e-21
AGR294C6.90ON2141742176e-21
KLLA0A04499gsingletonON2141742176e-21
KLLA0C05126g6.90ON2141742176e-21
Smik_6.2574.73ON2711852199e-21
TDEL0G038106.90ON2221652161e-20
NDAI0D038204.73ON2681692181e-20
SAKL0A07744g6.90ON2141652151e-20
Skud_7.4764.73ON2721852181e-20
YGR152C (RSR1)4.73ON2721852181e-20
ZYRO0G07018g4.73ON2501692162e-20
NCAS0A018904.73ON2711962172e-20
KLTH0H09042g4.73ON2421692152e-20
CAGL0I00594g6.90ON2141652132e-20
Kpol_1009.96.90ON2131652114e-20
TPHA0K010606.90ON2131652114e-20
NCAS0F004406.90ON2191652115e-20
KAFR0A048006.90ON2191652115e-20
NDAI0D026706.90ON2201652115e-20
TBLA0E009806.90ON2211652115e-20
KNAG0F031806.90ON2941652147e-20
Kwal_47.190553.521ON1791412061e-19
TBLA0B014102.182ON6381952171e-19
ZYRO0E03608g1.443ON2001792071e-19
Kpol_1026.124.73ON3291742122e-19
KAFR0J012402.200ON1871802043e-19
KLLA0C12001g4.73ON2591752083e-19
KLLA0C13816g2.200ON1871802034e-19
ZYRO0D01452g7.521ON2201862054e-19
Ecym_53652.200ON1891792034e-19
KNAG0I019302.182ON3191642095e-19
SAKL0H20746g4.73ON2511652065e-19
KNAG0M018302.200ON1861792025e-19
KNAG0D037804.73ON3041692085e-19
NCAS0G027302.200ON1871762025e-19
TPHA0K018204.73ON3201872086e-19
NDAI0B054001.215ON2951822077e-19
KNAG0C012601.215ON2991662077e-19
TBLA0B003704.73ON3461962088e-19
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CAGL0E02607g
         (627 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02607g Chr5 complement(248998..249624) [627 bp, 208 aa] {O...   413   e-149
Smik_13.158 Chr13 (258333..258959) [627 bp, 208 aa] {ON} YML001W...   375   e-134
Kpol_1037.28 s1037 (68071..68697) [627 bp, 208 aa] {ON} (68071.....   375   e-133
Suva_13.161 Chr13 (257150..257776) [627 bp, 208 aa] {ON} YML001W...   374   e-133
Skud_13.153 Chr13 (253075..253701) [627 bp, 208 aa] {ON} YML001W...   374   e-133
YML001W Chr13 (267174..267800) [627 bp, 208 aa] {ON}  YPT7Rab fa...   374   e-133
TDEL0G04450 Chr7 complement(808210..808836) [627 bp, 208 aa] {ON...   373   e-133
SAKL0E01386g Chr5 (105246..105872) [627 bp, 208 aa] {ON} highly ...   370   e-132
NCAS0H00850 Chr8 (155266..155892) [627 bp, 208 aa] {ON} Anc_6.24      370   e-132
KNAG0M01220 Chr13 (222591..223214) [624 bp, 207 aa] {ON} Anc_6.2...   370   e-131
NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24      367   e-131
KLTH0C11132g Chr3 complement(915337..915963) [627 bp, 208 aa] {O...   367   e-130
ZYRO0C07700g Chr3 complement(584547..585170) [624 bp, 207 aa] {O...   365   e-130
Kwal_56.22440 s56 (130574..131200) [627 bp, 208 aa] {ON} YML001W...   365   e-130
KAFR0G02670 Chr7 complement(552130..552756) [627 bp, 208 aa] {ON...   364   e-129
ACR003C Chr3 complement(359762..360388) [627 bp, 208 aa] {ON} Sy...   363   e-129
Ecym_3028 Chr3 (54759..55385) [627 bp, 208 aa] {ON} similar to A...   362   e-129
TPHA0J00360 Chr10 (80553..81182) [630 bp, 209 aa] {ON} Anc_6.24 ...   356   e-126
KLLA0D01265g Chr4 (110784..111407) [624 bp, 207 aa] {ON} highly ...   353   e-125
TBLA0A07180 Chr1 complement(1787774..1788400) [627 bp, 208 aa] {...   351   e-124
Ecym_7305 Chr7 (650045..650686) [642 bp, 213 aa] {ON} similar to...   142   9e-42
ZYRO0C07062g Chr3 (532175..532819) [645 bp, 214 aa] {ON} highly ...   141   1e-41
AGL021W Chr7 (681754..682392) [639 bp, 212 aa] {ON} Syntenic hom...   140   5e-41
KNAG0D02650 Chr4 (474662..475297) [636 bp, 211 aa] {ON} Anc_8.70...   139   7e-41
SAKL0B02332g Chr2 (227078..227719) [642 bp, 213 aa] {ON} highly ...   139   7e-41
YLR262C Chr12 complement(668244..668891) [648 bp, 215 aa] {ON}  ...   139   1e-40
Skud_12.341 Chr12 complement(609187..609837) [651 bp, 216 aa] {O...   139   2e-40
KLLA0D05313g Chr4 (459496..460110) [615 bp, 204 aa] {ON} highly ...   138   2e-40
KLTH0C10384g Chr3 (861122..861826) [705 bp, 234 aa] {ON} highly ...   139   2e-40
Kpol_1011.3 s1011 complement(4828..5472) [645 bp, 214 aa] {ON} c...   138   2e-40
TPHA0F02500 Chr6 complement(551815..552462) [648 bp, 215 aa] {ON...   138   3e-40
CAGL0K06017g Chr11 complement(586922..587581) [660 bp, 219 aa] {...   138   3e-40
NDAI0G03340 Chr7 (792718..793341) [624 bp, 207 aa] {ON} Anc_8.70      137   4e-40
NCAS0D02500 Chr4 (474037..474705) [669 bp, 222 aa] {ON} Anc_6.49      138   4e-40
Kwal_23.5058 s23 (989533..990174) [642 bp, 213 aa] {ON} YFL005W ...   137   4e-40
KLTH0A02662g Chr1 complement(226313..226954) [642 bp, 213 aa] {O...   137   4e-40
Smik_12.336 Chr12 complement(606255..606905) [651 bp, 216 aa] {O...   137   5e-40
KAFR0C03330 Chr3 (679443..680075) [633 bp, 210 aa] {ON} Anc_8.70...   137   5e-40
TPHA0P00360 Chr16 (76379..77023) [645 bp, 214 aa] {ON} Anc_8.70 ...   137   6e-40
NCAS0J00630 Chr10 complement(95335..95991) [657 bp, 218 aa] {ON}...   137   7e-40
NCAS0C04020 Chr3 (817944..818576) [633 bp, 210 aa] {ON} Anc_1.21...   137   8e-40
Suva_10.359 Chr10 complement(629445..630092) [648 bp, 215 aa] {O...   137   9e-40
Ecym_1518 Chr1 (1069582..1070196) [615 bp, 204 aa] {ON} similar ...   136   9e-40
KLLA0E12079g Chr5 (1075299..1075943) [645 bp, 214 aa] {ON} highl...   136   1e-39
ZYRO0F03872g Chr6 (329213..329866) [654 bp, 217 aa] {ON} highly ...   136   1e-39
KAFR0B01660 Chr2 complement(318959..319579) [621 bp, 206 aa] {ON...   136   1e-39
Kwal_56.22555 s56 complement(178575..179213) [639 bp, 212 aa] {O...   136   2e-39
KLLA0F20471g Chr6 (1901749..1902387) [639 bp, 212 aa] {ON} highl...   136   2e-39
Kpol_1042.2 s1042 complement(4659..5303) [645 bp, 214 aa] {ON} c...   135   2e-39
Kwal_14.1116 s14 complement(202534..203148) [615 bp, 204 aa] {ON...   135   3e-39
SAKL0B01012g Chr2 complement(92466..93080) [615 bp, 204 aa] {ON}...   135   3e-39
KAFR0A05260 Chr1 complement(1040753..1041460) [708 bp, 235 aa] {...   136   3e-39
KLTH0G18788g Chr7 (1624218..1624832) [615 bp, 204 aa] {ON} highl...   135   4e-39
ABR220W Chr2 (817292..817906) [615 bp, 204 aa] {ON} Syntenic hom...   135   4e-39
KNAG0E02720 Chr5 (541478..542173) [696 bp, 231 aa] {ON}               135   4e-39
TBLA0E03190 Chr5 complement(803935..804558) [624 bp, 207 aa] {ON...   135   4e-39
CAGL0F02123g Chr6 (212117..212764) [648 bp, 215 aa] {ON} highly ...   135   5e-39
TDEL0G04210 Chr7 (764766..765434) [669 bp, 222 aa] {ON} Anc_6.49...   135   6e-39
AGR257C Chr7 complement(1225880..1226542) [663 bp, 220 aa] {ON} ...   134   8e-39
YFL005W Chr6 (130334..130981) [648 bp, 215 aa] {ON}  SEC4Rab fam...   134   1e-38
CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} high...   134   1e-38
SAKL0E02090g Chr5 complement(160194..160838) [645 bp, 214 aa] {O...   133   2e-38
Smik_6.73 Chr6 (143556..144203) [648 bp, 215 aa] {ON} YFL005W (R...   133   3e-38
Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON} YF...   132   6e-38
KNAG0G00930 Chr7 (183672..184313) [642 bp, 213 aa] {ON} Anc_8.70...   132   7e-38
TDEL0C00980 Chr3 (164219..164866) [648 bp, 215 aa] {ON} Anc_8.70...   132   8e-38
Suva_6.54 Chr6 (102191..102838) [648 bp, 215 aa] {ON} YFL005W (R...   132   8e-38
TDEL0C00490 Chr3 complement(75792..76418) [627 bp, 208 aa] {ON} ...   131   9e-38
Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON...   131   1e-37
NDAI0G03050 Chr7 complement(711396..712028) [633 bp, 210 aa] {ON...   131   1e-37
KAFR0C03580 Chr3 (733658..734296) [639 bp, 212 aa] {ON} Anc_8.25...   130   2e-37
Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON} YF...   130   2e-37
Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON} YF...   130   2e-37
YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}  YPT...   130   2e-37
NDAI0I02380 Chr9 complement(542975..543643) [669 bp, 222 aa] {ON}     130   3e-37
TBLA0C00450 Chr3 complement(84352..84984) [633 bp, 210 aa] {ON} ...   130   3e-37
Skud_6.66 Chr6 (132521..133168) [648 bp, 215 aa] {ON} YFL005W (R...   130   3e-37
TBLA0D02650 Chr4 (655924..656577) [654 bp, 217 aa] {ON} Anc_8.70...   130   3e-37
Ecym_3137 Chr3 (254058..254723) [666 bp, 221 aa] {ON} similar to...   130   4e-37
ZYRO0F02816g Chr6 complement(237904..238533) [630 bp, 209 aa] {O...   129   7e-37
TPHA0D00270 Chr4 complement(37369..37992) [624 bp, 207 aa] {ON} ...   128   1e-36
KNAG0E03100 Chr5 complement(618438..619076) [639 bp, 212 aa] {ON...   127   5e-36
KAFR0J01850 Chr10 complement(356911..357540) [630 bp, 209 aa] {O...   126   1e-35
KAFR0A03560 Chr1 (729254..729877) [624 bp, 207 aa] {ON} Anc_1.28...   125   2e-35
KLLA0D02376g Chr4 (201512..202135) [624 bp, 207 aa] {ON} similar...   125   2e-35
NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON...   125   3e-35
KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.33...   123   2e-34
NCAS0B06720 Chr2 complement(1278798..1279436) [639 bp, 212 aa] {...   122   6e-34
TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON...   122   7e-34
Smik_14.234 Chr14 (430086..430748) [663 bp, 220 aa] {ON} YNL093W...   121   1e-33
Suva_8.142 Chr8 complement(247554..248183) [630 bp, 209 aa] {ON}...   118   1e-32
Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON} (61782.....   118   1e-32
Ecym_6328 Chr6 complement(629586..630203) [618 bp, 205 aa] {ON} ...   117   2e-32
TPHA0I02780 Chr9 complement(614605..615231) [627 bp, 208 aa] {ON...   117   2e-32
Smik_15.269 Chr15 complement(451402..452034) [633 bp, 210 aa] {O...   117   2e-32
Kpol_1029.16 s1029 (30724..31359) [636 bp, 211 aa] {ON} (30724.....   117   2e-32
CAGL0G07689g Chr7 complement(729919..730566) [648 bp, 215 aa] {O...   117   3e-32
Skud_15.253 Chr15 complement(446672..447301) [630 bp, 209 aa] {O...   117   5e-32
YOR089C Chr15 complement(490196..490828) [633 bp, 210 aa] {ON}  ...   117   5e-32
AER434C Chr5 complement(1466442..1467052,1467106..1467154) [660 ...   117   6e-32
TBLA0B01820 Chr2 complement(415800..416438) [639 bp, 212 aa] {ON...   116   7e-32
TPHA0I02590 Chr9 complement(571327..572004) [678 bp, 225 aa] {ON...   116   9e-32
TDEL0D01570 Chr4 (310454..311107) [654 bp, 217 aa] {ON} Anc_1.28...   116   1e-31
AAL176C Chr1 complement(31588..32205) [618 bp, 205 aa] {ON} Synt...   115   2e-31
TBLA0C04910 Chr3 complement(1193590..1194285) [696 bp, 231 aa] {...   115   2e-31
Kwal_14.2394 s14 (738645..739268) [624 bp, 207 aa] {ON} YKR014C ...   115   2e-31
CAGL0J08635g Chr10 complement(856102..856728) [627 bp, 208 aa] {...   115   2e-31
KLTH0H09768g Chr8 (840625..841314) [690 bp, 229 aa] {ON} similar...   115   3e-31
Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W...   115   3e-31
SAKL0D05940g Chr4 (485575..486198) [624 bp, 207 aa] {ON} highly ...   114   3e-31
Suva_7.51 Chr7 (90232..90897) [666 bp, 221 aa] {ON} YGL210W (REAL)    115   3e-31
Ecym_1207 Chr1 (420728..420773,421159..421766) [654 bp, 217 aa] ...   114   4e-31
Kpol_423.12 s423 (26761..27423) [663 bp, 220 aa] {ON} (26761..27...   114   5e-31
CAGL0K09394g Chr11 complement(930063..930728) [666 bp, 221 aa] {...   114   5e-31
Smik_5.154 Chr5 complement(218975..219646) [672 bp, 223 aa] {ON}...   114   5e-31
SAKL0E09922g Chr5 complement(829249..829890) [642 bp, 213 aa] {O...   114   5e-31
TPHA0P00950 Chr16 complement(193256..193897) [642 bp, 213 aa] {O...   114   5e-31
CAGL0C02453g Chr3 (247493..248149) [657 bp, 218 aa] {ON} highly ...   114   6e-31
Suva_14.247 Chr14 (448490..449146) [657 bp, 218 aa] {ON} YNL093W...   114   9e-31
ZYRO0B09152g Chr2 complement(714608..715279) [672 bp, 223 aa] {O...   114   1e-30
YNL093W Chr14 (449868..450530) [663 bp, 220 aa] {ON}  YPT53Rab f...   113   1e-30
Suva_5.128 Chr5 complement(190103..190774) [672 bp, 223 aa] {ON}...   113   1e-30
Skud_5.140 Chr5 complement(211975..212646) [672 bp, 223 aa] {ON}...   113   1e-30
YER031C Chr5 complement(214076..214747) [672 bp, 223 aa] {ON}  Y...   113   1e-30
KLTH0G08206g Chr7 (666127..666765) [639 bp, 212 aa] {ON} highly ...   113   1e-30
Skud_7.58 Chr7 (99129..99797) [669 bp, 222 aa] {ON} YGL210W (REAL)    113   2e-30
YGL210W Chr7 (93792..94460) [669 bp, 222 aa] {ON}  YPT32Rab fami...   113   2e-30
KAFR0C04310 Chr3 (855871..856470) [600 bp, 199 aa] {ON} Anc_1.33...   112   2e-30
Smik_7.53 Chr7 (88592..89260) [669 bp, 222 aa] {ON} YGL210W (REAL)    112   3e-30
Ecym_5362 Chr5 (735204..735833) [630 bp, 209 aa] {ON} similar to...   112   3e-30
KLTH0G01760g Chr7 (132121..132166,132307..132917) [657 bp, 218 a...   112   3e-30
ACL084C Chr3 complement(199020..199643) [624 bp, 207 aa] {ON} Sy...   112   4e-30
SAKL0F01914g Chr6 (162387..162432,162627..163246) [666 bp, 221 a...   112   4e-30
TPHA0D03430 Chr4 complement(719751..720422) [672 bp, 223 aa] {ON...   112   4e-30
ZYRO0C15554g Chr3 complement(1218190..1218825) [636 bp, 211 aa] ...   112   4e-30
KAFR0F04160 Chr6 complement(819022..819759) [738 bp, 245 aa] {ON...   112   5e-30
KLLA0B00671g Chr2 complement(50393..51006,51417..51462) [660 bp,...   111   7e-30
KLLA0C13728g Chr3 (1173329..1173955) [627 bp, 208 aa] {ON} highl...   111   8e-30
TDEL0C04660 Chr3 complement(845203..845838) [636 bp, 211 aa] {ON...   111   8e-30
ZYRO0E08492g Chr5 complement(676074..676684,676766..676811) [657...   110   2e-29
NDAI0I02910 Chr9 complement(688721..689380) [660 bp, 219 aa] {ON...   109   4e-29
Kwal_23.2978 s23 (97956..98591) [636 bp, 211 aa] {ON} YOR089C (V...   109   4e-29
NDAI0B04980 Chr2 complement(1216833..1217516) [684 bp, 227 aa] {...   109   7e-29
NCAS0E00600 Chr5 (102956..103615) [660 bp, 219 aa] {ON} Anc_3.521     108   8e-29
NCAS0B07360 Chr2 complement(1389230..1389907) [678 bp, 225 aa] {...   108   9e-29
KNAG0B00580 Chr2 (94797..95474) [678 bp, 225 aa] {ON} Anc_3.521 ...   108   9e-29
Smik_2.408 Chr2 complement(723817..724416) [600 bp, 199 aa] {ON}...   108   9e-29
KNAG0C01600 Chr3 (317298..317942) [645 bp, 214 aa] {ON} Anc_1.28...   108   1e-28
KNAG0I01080 Chr9 (207327..208088) [762 bp, 253 aa] {ON} Anc_2.19...   108   2e-28
AEL187C Chr5 complement(284984..285610) [627 bp, 208 aa] {ON} Sy...   106   5e-28
TDEL0D05890 Chr4 complement(1067167..1067856) [690 bp, 229 aa] {...   107   5e-28
Smik_11.271 Chr11 complement(452840..453544) [705 bp, 234 aa] {O...   107   6e-28
Skud_11.247 Chr11 complement(445982..446686) [705 bp, 234 aa] {O...   106   8e-28
Ecym_6309 Chr6 (585998..586624) [627 bp, 208 aa] {ON} similar to...   105   1e-27
YKR014C Chr11 complement(465367..466071) [705 bp, 234 aa] {ON}  ...   105   2e-27
NCAS0B07630 Chr2 complement(1443664..1444314) [651 bp, 216 aa] {...   105   2e-27
ZYRO0G21384g Chr7 complement(1763055..1763711) [657 bp, 218 aa] ...   105   2e-27
Kwal_56.22441 s56 complement(130807..131163) [357 bp, 118 aa] {O...   102   2e-27
Suva_11.246 Chr11 complement(449412..450122) [711 bp, 236 aa] {O...   104   5e-27
Suva_4.526 Chr4 complement(909423..910019) [597 bp, 198 aa] {ON}...   103   5e-27
YBR264C Chr2 complement(737770..738369) [600 bp, 199 aa] {ON}  Y...   103   8e-27
NDAI0B04180 Chr2 (1055285..1056274) [990 bp, 329 aa] {ON} Anc_2....   105   1e-26
CAGL0I09306g Chr9 complement(897357..897977) [621 bp, 206 aa] {O...   102   2e-26
TDEL0D02060 Chr4 (403098..403706) [609 bp, 202 aa] {ON} Anc_1.33...   102   2e-26
SAKL0D06490g Chr4 complement(531028..531684) [657 bp, 218 aa] {O...   101   5e-26
Skud_2.397 Chr2 complement(706771..707370) [600 bp, 199 aa] {ON}...   100   6e-26
YOR101W Chr15 (515244..516173) [930 bp, 309 aa] {ON}  RAS1GTPase...   101   3e-25
Smik_15.281 Chr15 (476294..477232) [939 bp, 312 aa] {ON} YOR101W...   101   3e-25
Skud_15.266 Chr15 (471563..472504) [942 bp, 313 aa] {ON} YOR101W...   101   4e-25
NCAS0B06850 Chr2 (1305199..1306173) [975 bp, 324 aa] {ON} Anc_2....   100   7e-25
NDAI0B04680 Chr2 complement(1157279..1157950) [672 bp, 223 aa] {...    99   8e-25
TPHA0B03000 Chr2 complement(683258..684175) [918 bp, 305 aa] {ON...   100   1e-24
Suva_8.155 Chr8 (272370..273320) [951 bp, 316 aa] {ON} YOR101W (...    99   2e-24
TDEL0F01360 Chr6 complement(241607..242470) [864 bp, 287 aa] {ON...    99   3e-24
KAFR0J01970 Chr10 (379033..379989) [957 bp, 318 aa] {ON} Anc_2.1...    99   3e-24
KLLA0C13387g Chr3 complement(1142002..1142841,1143162..1143176) ...    98   5e-24
CAGL0B04521g Chr2 complement(439732..440751) [1020 bp, 339 aa] {...    99   6e-24
TBLA0B01750 Chr2 complement(392769..393890) [1122 bp, 373 aa] {O...    99   7e-24
KAFR0D02040 Chr4 complement(412576..413382,413464..413481) [825 ...    97   1e-23
Kpol_1029.8 s1029 complement(15899..16816) [918 bp, 305 aa] {ON}...    97   1e-23
Kpol_1066.11 s1066 complement(18137..18865) [729 bp, 242 aa] {ON...    95   3e-23
YNL098C Chr14 complement(439602..440570) [969 bp, 322 aa] {ON}  ...    97   3e-23
Suva_14.241 Chr14 complement(437053..438021) [969 bp, 322 aa] {O...    96   5e-23
Kwal_26.8387 s26 (763564..764442) [879 bp, 292 aa] {ON} YNL098C ...    95   6e-23
KLTH0D08932g Chr4 (742772..742786,742899..743762) [879 bp, 292 a...    95   9e-23
Smik_14.227 Chr14 complement(419257..420225) [969 bp, 322 aa] {O...    95   1e-22
Skud_14.232 Chr14 complement(429739..430710) [972 bp, 323 aa] {O...    95   1e-22
KNAG0H03380 Chr8 (632140..633114) [975 bp, 324 aa] {ON} Anc_2.18...    95   1e-22
Kwal_14.2484 s14 complement(777938..778549) [612 bp, 203 aa] {ON...    91   3e-22
KLLA0F01232g Chr6 complement(114430..115062) [633 bp, 210 aa] {O...    91   4e-22
KLTH0H10274g Chr8 complement(882443..883048) [606 bp, 201 aa] {O...    91   4e-22
Ecym_5349 Chr5 complement(708225..709076,709277..709288) [864 bp...    92   8e-22
SAKL0E10252g Chr5 (855721..855735,855900..856691) [807 bp, 268 a...    92   8e-22
ZYRO0D14784g Chr4 complement(1247520..1248164) [645 bp, 214 aa] ...    90   1e-21
CAGL0J05632g Chr10 complement(539466..540032) [567 bp, 188 aa] {...    89   1e-21
ZYRO0B09438g Chr2 (738659..739555) [897 bp, 298 aa] {ON} similar...    92   1e-21
KLTH0G14850g Chr7 (1304240..1304884) [645 bp, 214 aa] {ON} highl...    90   2e-21
Suva_7.443 Chr7 complement(764401..765216) [816 bp, 271 aa] {ON}...    91   2e-21
Kwal_56.23361 s56 complement(508046..508690) [645 bp, 214 aa] {O...    89   2e-21
Suva_8.241 Chr8 complement(432445..433107) [663 bp, 220 aa] {ON}...    89   3e-21
Smik_15.370 Chr15 complement(637457..638119) [663 bp, 220 aa] {O...    89   3e-21
YOR185C Chr15 complement(681444..682106) [663 bp, 220 aa] {ON}  ...    89   3e-21
TDEL0F02770 Chr6 complement(507090..507806) [717 bp, 238 aa] {ON...    90   3e-21
Kwal_14.2244 s14 (671441..672175) [735 bp, 244 aa] {ON} YGR152C ...    90   3e-21
ADL262W Chr4 (243996..244010,244072..244869) [813 bp, 270 aa] {O...    90   3e-21
Suva_10.389 Chr10 complement(681930..682589) [660 bp, 219 aa] {O...    89   3e-21
Skud_12.375 Chr12 complement(661797..662456) [660 bp, 219 aa] {O...    89   3e-21
Smik_12.371 Chr12 complement(658971..659630) [660 bp, 219 aa] {O...    89   3e-21
YLR293C Chr12 complement(720771..721430) [660 bp, 219 aa] {ON}  ...    89   3e-21
Skud_15.352 Chr15 complement(632241..632903) [663 bp, 220 aa] {O...    89   4e-21
KAFR0F03670 Chr6 complement(726736..727527) [792 bp, 263 aa] {ON...    90   4e-21
Ecym_3097 Chr3 (181482..182126) [645 bp, 214 aa] {ON} similar to...    88   6e-21
AGR294C Chr7 complement(1287036..1287680) [645 bp, 214 aa] {ON} ...    88   6e-21
KLLA0A04499g Chr1 complement(404732..405376) [645 bp, 214 aa] {O...    88   6e-21
KLLA0C05126g Chr3 complement(463657..464301) [645 bp, 214 aa] {O...    88   6e-21
Smik_6.257 Chr6 complement(414005..414820) [816 bp, 271 aa] {ON}...    89   9e-21
TDEL0G03810 Chr7 (699414..700082) [669 bp, 222 aa] {ON} Anc_6.90...    88   1e-20
NDAI0D03820 Chr4 complement(908209..909015) [807 bp, 268 aa] {ON...    89   1e-20
SAKL0A07744g Chr1 (688406..689050) [645 bp, 214 aa] {ON} highly ...    87   1e-20
Skud_7.476 Chr7 complement(778308..779126) [819 bp, 272 aa] {ON}...    89   1e-20
YGR152C Chr7 complement(794674..795492) [819 bp, 272 aa] {ON}  R...    89   1e-20
ZYRO0G07018g Chr7 complement(559273..560025) [753 bp, 250 aa] {O...    88   2e-20
NCAS0A01890 Chr1 complement(364746..365561) [816 bp, 271 aa] {ON...    88   2e-20
KLTH0H09042g Chr8 (776732..777460) [729 bp, 242 aa] {ON} similar...    87   2e-20
CAGL0I00594g Chr9 (44835..45479) [645 bp, 214 aa] {ON} highly si...    87   2e-20
Kpol_1009.9 s1009 complement(23990..24631) [642 bp, 213 aa] {ON}...    86   4e-20
TPHA0K01060 Chr11 (219078..219719) [642 bp, 213 aa] {ON} Anc_6.9...    86   4e-20
NCAS0F00440 Chr6 complement(79004..79663) [660 bp, 219 aa] {ON} ...    86   5e-20
KAFR0A04800 Chr1 (954630..955289) [660 bp, 219 aa] {ON} Anc_6.90...    86   5e-20
NDAI0D02670 Chr4 (618909..619571) [663 bp, 220 aa] {ON} Anc_6.90       86   5e-20
TBLA0E00980 Chr5 (224289..224954) [666 bp, 221 aa] {ON} Anc_6.90...    86   5e-20
KNAG0F03180 Chr6 complement(598089..598973) [885 bp, 294 aa] {ON...    87   7e-20
Kwal_47.19055 s47 complement(1078494..1079033) [540 bp, 179 aa] ...    84   1e-19
TBLA0B01410 Chr2 complement(304771..306687) [1917 bp, 638 aa] {O...    88   1e-19
ZYRO0E03608g Chr5 complement(279670..280272) [603 bp, 200 aa] {O...    84   1e-19
Kpol_1026.12 s1026 complement(27073..28062) [990 bp, 329 aa] {ON...    86   2e-19
KAFR0J01240 Chr10 complement(229638..230201) [564 bp, 187 aa] {O...    83   3e-19
KLLA0C12001g Chr3 complement(1029092..1029871) [780 bp, 259 aa] ...    85   3e-19
KLLA0C13816g Chr3 (1183412..1183975) [564 bp, 187 aa] {ON} highl...    83   4e-19
ZYRO0D01452g Chr4 complement(104471..105133) [663 bp, 220 aa] {O...    84   4e-19
Ecym_5365 Chr5 (743477..744046) [570 bp, 189 aa] {ON} similar to...    83   4e-19
KNAG0I01930 Chr9 (376663..377622) [960 bp, 319 aa] {ON}                85   5e-19
SAKL0H20746g Chr8 (1817259..1818014) [756 bp, 251 aa] {ON} simil...    84   5e-19
KNAG0M01830 Chr13 complement(339904..340464) [561 bp, 186 aa] {O...    82   5e-19
KNAG0D03780 Chr4 complement(688854..689768) [915 bp, 304 aa] {ON...    85   5e-19
NCAS0G02730 Chr7 (491357..491920) [564 bp, 187 aa] {ON}                82   5e-19
TPHA0K01820 Chr11 complement(385771..386733) [963 bp, 320 aa] {O...    85   6e-19
NDAI0B05400 Chr2 (1326549..1327436) [888 bp, 295 aa] {ON} Anc_1....    84   7e-19
KNAG0C01260 Chr3 complement(243934..244833) [900 bp, 299 aa] {ON...    84   7e-19
TBLA0B00370 Chr2 (68828..69868) [1041 bp, 346 aa] {ON}                 85   8e-19
AFR464W Chr6 (1274600..1275394) [795 bp, 264 aa] {ON} Syntenic h...    83   1e-18
CAGL0E03113g Chr5 complement(289401..290372) [972 bp, 323 aa] {O...    84   1e-18
KLTH0G08294g Chr7 (678358..678921) [564 bp, 187 aa] {ON} highly ...    81   1e-18
Kwal_55.21941 s55 (1048693..1049322) [630 bp, 209 aa] {ON} YPR16...    82   2e-18
Kwal_34.16142 s34 complement(220030..220608) [579 bp, 192 aa] {O...    81   2e-18
NDAI0F02560 Chr6 complement(629428..630000) [573 bp, 190 aa] {ON}      80   3e-18
KLTH0F18612g Chr6 (1513182..1513811) [630 bp, 209 aa] {ON} simil...    80   4e-18
Kpol_1039.20 s1039 (65494..66126) [633 bp, 210 aa] {ON} (65494.....    80   5e-18
TDEL0C04630 Chr3 complement(837302..837877) [576 bp, 191 aa] {ON...    80   6e-18
Ecym_1407 Chr1 (846135..846941) [807 bp, 268 aa] {ON} similar to...    81   6e-18
TDEL0B05600 Chr2 complement(991741..992346) [606 bp, 201 aa] {ON...    80   7e-18
SAKL0C06424g Chr3 complement(591532..592395) [864 bp, 287 aa] {O...    81   8e-18
Kpol_1029.18 s1029 (37197..37763) [567 bp, 188 aa] {ON} (37197.....    79   1e-17
NCAS0B08090 Chr2 (1545134..1546003) [870 bp, 289 aa] {ON} Anc_1....    81   1e-17
TDEL0H00970 Chr8 complement(158769..159638) [870 bp, 289 aa] {ON...    80   2e-17
ZYRO0C15466g Chr3 complement(1208350..1208919) [570 bp, 189 aa] ...    79   2e-17
ABR183W Chr2 (755915..756538) [624 bp, 207 aa] {ON} Rho1b; Synte...    79   2e-17
SAKL0F15642g Chr6 (1273987..1274616) [630 bp, 209 aa] {ON} highl...    79   2e-17
ZYRO0D03146g Chr4 complement(244206..245039) [834 bp, 277 aa] {O...    80   2e-17
Ecym_7212 Chr7 (444427..445050) [624 bp, 207 aa] {ON} similar to...    79   2e-17
SAKL0E09834g Chr5 complement(819736..820308) [573 bp, 190 aa] {O...    78   2e-17
TPHA0P00920 Chr16 complement(185904..186470) [567 bp, 188 aa] {O...    78   3e-17
NCAS0A08470 Chr1 complement(1678221..1678847) [627 bp, 208 aa] {...    78   3e-17
Suva_14.250 Chr14 (455251..455829) [579 bp, 192 aa] {ON} YNL090W...    78   3e-17
Suva_9.76 Chr9 (134573..135271) [699 bp, 232 aa] {ON} YIL118W (R...    79   4e-17
Suva_11.289 Chr11 (531935..532810) [876 bp, 291 aa] {ON} YKR055W...    79   4e-17
Smik_9.51 Chr9 (117526..118221) [696 bp, 231 aa] {ON} YIL118W (R...    78   5e-17
YIL118W Chr9 (139752..140447) [696 bp, 231 aa] {ON}  RHO3Non-ess...    78   5e-17
Ecym_3286 Chr3 (542469..543143) [675 bp, 224 aa] {ON} similar to...    78   6e-17
KLTH0H13970g Chr8 (1217045..1217623) [579 bp, 192 aa] {ON} simil...    77   6e-17
ADL252W Chr4 (258347..259021) [675 bp, 224 aa] {ON} Syntenic hom...    77   8e-17
KAFR0G00680 Chr7 complement(170317..171210) [894 bp, 297 aa] {ON...    79   9e-17
KLLA0A05643g Chr1 (528976..529632) [657 bp, 218 aa] {ON} similar...    77   1e-16
KAFR0J01600 Chr10 complement(290538..291206) [669 bp, 222 aa] {O...    77   1e-16
YNL090W Chr14 (456565..457143) [579 bp, 192 aa] {ON}  RHO2Non-es...    76   1e-16
Skud_9.53 Chr9 (116575..117270) [696 bp, 231 aa] {ON} YIL118W (R...    77   1e-16
TBLA0B01800 Chr2 complement(408546..409136) [591 bp, 196 aa] {ON...    76   1e-16
KNAG0E01840 Chr5 (380757..381419) [663 bp, 220 aa] {ON} Anc_2.24...    77   2e-16
YKR055W Chr11 (548216..549091) [876 bp, 291 aa] {ON}  RHO4Non-es...    78   2e-16
SAKL0H13068g Chr8 complement(1125095..1125670) [576 bp, 191 aa] ...    76   2e-16
Kwal_33.14452 s33 complement(679084..679866) [783 bp, 260 aa] {O...    77   2e-16
Kwal_23.3135 s23 complement(172095..172670) [576 bp, 191 aa] {ON...    75   2e-16
KLTH0F07920g Chr6 complement(687410..687985) [576 bp, 191 aa] {O...    75   2e-16
KLLA0A04213g Chr1 complement(382243..382818) [576 bp, 191 aa] {O...    75   2e-16
TDEL0F05450 Chr6 (1014759..1015334) [576 bp, 191 aa] {ON} Anc_8....    75   2e-16
ZYRO0A09306g Chr1 (745829..746404) [576 bp, 191 aa] {ON} highly ...    75   2e-16
TPHA0C02190 Chr3 complement(498886..499461) [576 bp, 191 aa] {ON...    75   2e-16
KAFR0B06320 Chr2 (1307235..1307810) [576 bp, 191 aa] {ON} Anc_8....    75   2e-16
TPHA0F01280 Chr6 complement(293022..293657) [636 bp, 211 aa] {ON...    76   3e-16
KLLA0D08327g Chr4 (708240..709004) [765 bp, 254 aa] {ON} similar...    77   3e-16
ZYRO0C09680g Chr3 (735760..736698) [939 bp, 312 aa] {ON} similar...    77   3e-16
CAGL0F05269g Chr6 complement(533759..534334) [576 bp, 191 aa] {O...    75   3e-16
Skud_11.291 Chr11 (529726..530601) [876 bp, 291 aa] {ON} YKR055W...    77   4e-16
SAKL0F15620g Chr6 (1272848..1273471) [624 bp, 207 aa] {ON} highl...    75   5e-16
CAGL0G08558g Chr7 complement(804969..805652) [684 bp, 227 aa] {O...    75   5e-16
KLLA0A11330g Chr1 (982552..983124) [573 bp, 190 aa] {ON} similar...    75   5e-16
Smik_14.237 Chr14 (436872..437450) [579 bp, 192 aa] {ON} YNL090W...    75   5e-16
Smik_11.317 Chr11 (538087..539016) [930 bp, 309 aa] {ON} YKR055W...    77   5e-16
TBLA0H00690 Chr8 complement(148963..149622) [660 bp, 219 aa] {ON...    75   6e-16
SAKL0E08558g Chr5 complement(695313..695990) [678 bp, 225 aa] {O...    75   6e-16
KLLA0B10626g Chr2 (936497..937123) [627 bp, 208 aa] {ON} uniprot...    75   6e-16
Kpol_529.16 s529 complement(43810..44385) [576 bp, 191 aa] {ON} ...    74   7e-16
CAGL0K08316g Chr11 (839222..840193) [972 bp, 323 aa] {ON} some s...    76   8e-16
NCAS0G01910 Chr7 complement(342761..343636) [876 bp, 291 aa] {ON...    76   8e-16
Ecym_4146 Chr4 complement(312161..312736) [576 bp, 191 aa] {ON} ...    74   9e-16
AGL093W Chr7 (532002..532577) [576 bp, 191 aa] {ON} Syntenic hom...    74   9e-16
Suva_10.324 Chr10 complement(570500..571075) [576 bp, 191 aa] {O...    74   9e-16
Skud_12.297 Chr12 complement(544541..545116) [576 bp, 191 aa] {O...    74   9e-16
Smik_12.290 Chr12 complement(544884..545459) [576 bp, 191 aa] {O...    74   9e-16
YLR229C Chr12 complement(604212..604787) [576 bp, 191 aa] {ON}  ...    74   9e-16
Skud_14.241 Chr14 (446886..447464) [579 bp, 192 aa] {ON} YNL090W...    74   9e-16
ACL087C Chr3 complement(191573..192136) [564 bp, 187 aa] {ON} Sy...    74   1e-15
TBLA0H03330 Chr8 (817665..818243) [579 bp, 192 aa] {ON} Anc_8.42...    74   1e-15
KLTH0B06996g Chr2 (565363..566142) [780 bp, 259 aa] {ON} weakly ...    75   1e-15
KNAG0A04510 Chr1 complement(632334..632939) [606 bp, 201 aa] {ON...    74   2e-15
Suva_3.60 Chr3 (81874..82491) [618 bp, 205 aa] {ON} YCR027C (REAL)     74   2e-15
CAGL0L11242g Chr12 (1199371..1200135) [765 bp, 254 aa] {ON} high...    74   2e-15
Kwal_47.16983 s47 complement(197253..197924) [672 bp, 223 aa] {O...    74   2e-15
KLLA0F03443g Chr6 (324020..324691) [672 bp, 223 aa] {ON} highly ...    74   2e-15
SAKL0E12848g Chr5 (1060050..1060835) [786 bp, 261 aa] {ON} simil...    74   3e-15
Kpol_520.36 s520 complement(90395..91072) [678 bp, 225 aa] {ON} ...    73   3e-15
NDAI0C04820 Chr3 (1113624..1114199) [576 bp, 191 aa] {ON} Anc_8....    72   3e-15
KNAG0K02400 Chr11 complement(482842..483861) [1020 bp, 339 aa] {...    74   4e-15
KLTH0F05698g Chr6 complement(489561..490376) [816 bp, 271 aa] {O...    74   4e-15
KLTH0D16236g Chr4 (1344371..1345048) [678 bp, 225 aa] {ON} simil...    73   4e-15
KLTH0F18590g Chr6 (1511729..1512355) [627 bp, 208 aa] {ON} highl...    72   6e-15
SAKL0D10780g Chr4 (896563..897222) [660 bp, 219 aa] {ON} similar...    72   8e-15
KLLA0B05038g Chr2 complement(457608..458279) [672 bp, 223 aa] {O...    72   1e-14
KLTH0G09548g Chr7 (802001..802696) [696 bp, 231 aa] {ON} highly ...    72   1e-14
TBLA0J00210 Chr10 complement(27395..28039) [645 bp, 214 aa] {ON}...    71   1e-14
ABL139C Chr2 complement(134873..135757) [885 bp, 294 aa] {ON} Sy...    72   1e-14
KNAG0F01270 Chr6 complement(229391..230398) [1008 bp, 335 aa] {O...    72   2e-14
ZYRO0B14256g Chr2 (1160536..1161219) [684 bp, 227 aa] {ON} simil...    71   2e-14
Kwal_23.4875 s23 (904790..905482) [693 bp, 230 aa] {ON} YIL118W ...    71   2e-14
SAKL0G17424g Chr7 (1508263..1508913) [651 bp, 216 aa] {ON} simil...    70   3e-14
KAFR0I00390 Chr9 complement(84398..85093) [696 bp, 231 aa] {ON} ...    70   3e-14
NDAI0D00180 Chr4 complement(26285..26926) [642 bp, 213 aa] {ON}        70   4e-14
TDEL0D00920 Chr4 complement(167879..168568) [690 bp, 229 aa] {ON...    70   5e-14
TPHA0F02330 Chr6 (513129..514112) [984 bp, 327 aa] {ON} Anc_2.75...    71   5e-14
NDAI0G04930 Chr7 complement(1191671..1192303) [633 bp, 210 aa] {...    70   5e-14
NCAS0B02880 Chr2 complement(494164..494739) [576 bp, 191 aa] {ON...    69   5e-14
NCAS0A15070 Chr1 (2971104..2971739) [636 bp, 211 aa] {ON}              70   5e-14
NCAS0H00220 Chr8 complement(29761..30399) [639 bp, 212 aa] {ON}        70   5e-14
NCAS0A06070 Chr1 (1197908..1198585) [678 bp, 225 aa] {ON} Anc_4....    70   6e-14
Kpol_1008.17 s1008 (34952..35581) [630 bp, 209 aa] {ON} (34952.....    69   7e-14
TBLA0F02960 Chr6 (719060..719707) [648 bp, 215 aa] {ON} Anc_7.52...    69   7e-14
TPHA0I03130 Chr9 (696033..696662) [630 bp, 209 aa] {ON}                69   9e-14
Kpol_1013.49 s1013 complement(108782..109414) [633 bp, 210 aa] {...    69   9e-14
NDAI0H03720 Chr8 (909855..910775) [921 bp, 306 aa] {ON} Anc_2.75       70   1e-13
Suva_16.495 Chr16 (859802..860431) [630 bp, 209 aa] {ON} YPR165W...    69   1e-13
Skud_16.464 Chr16 (818093..818722) [630 bp, 209 aa] {ON} YPR165W...    69   1e-13
Smik_16.424 Chr16 (736628..737257) [630 bp, 209 aa] {ON} YPR165W...    69   1e-13
YPR165W Chr16 (875368..875997) [630 bp, 209 aa] {ON}  RHO1GTP-bi...    69   1e-13
Ecym_6421 Chr6 (820187..821071) [885 bp, 294 aa] {ON} similar to...    70   1e-13
Kpol_1041.7 s1041 (25272..26135) [864 bp, 287 aa] {ON} (25272..2...    69   2e-13
TDEL0C04120 Chr3 complement(725595..726290) [696 bp, 231 aa] {ON...    69   2e-13
ZYRO0D01474g Chr4 complement(105651..106289) [639 bp, 212 aa] {O...    68   2e-13
TPHA0B01720 Chr2 complement(384530..385420) [891 bp, 296 aa] {ON...    69   2e-13
TBLA0E03870 Chr5 (972894..973580) [687 bp, 228 aa] {ON} Anc_2.24...    68   2e-13
KAFR0A03120 Chr1 complement(636653..637282) [630 bp, 209 aa] {ON}      68   2e-13
KNAG0D05300 Chr4 (974092..974730) [639 bp, 212 aa] {ON}                68   3e-13
KAFR0B00480 Chr2 complement(98402..99040) [639 bp, 212 aa] {ON} ...    68   3e-13
AER132W Chr5 (888052..888750) [699 bp, 232 aa] {ON} Syntenic hom...    68   3e-13
CAGL0I08459g Chr9 (829562..830194) [633 bp, 210 aa] {ON} highly ...    67   3e-13
Ecym_1155 Chr1 complement(318859..319560) [702 bp, 233 aa] {ON} ...    68   3e-13
NCAS0B06460 Chr2 complement(1221860..1222564) [705 bp, 234 aa] {...    68   3e-13
KAFR0A07530 Chr1 (1520661..1521554) [894 bp, 297 aa] {ON} Anc_2....    69   3e-13
TDEL0H00500 Chr8 complement(74047..74679) [633 bp, 210 aa] {ON} ...    67   5e-13
Skud_3.103 Chr3 complement(150880..151509) [630 bp, 209 aa] {ON}...    67   6e-13
Kwal_33.14015 s33 complement(484017..484832) [816 bp, 271 aa] {O...    67   7e-13
NDAI0J00230 Chr10 (38760..39515) [756 bp, 251 aa] {ON}                 67   8e-13
TDEL0A01170 Chr1 complement(198136..198957) [822 bp, 273 aa] {ON...    67   1e-12
NCAS0D00420 Chr4 complement(64888..65739) [852 bp, 283 aa] {ON} ...    67   1e-12
Smik_3.126 Chr3 complement(166497..167126) [630 bp, 209 aa] {ON}...    66   1e-12
Kpol_1013.48 s1013 complement(107294..107959) [666 bp, 221 aa] {...    66   1e-12
YML064C Chr13 complement(145139..145876) [738 bp, 245 aa] {ON}  ...    66   2e-12
ACR257C Chr3 complement(808667..809446) [780 bp, 259 aa] {ON} Sy...    66   2e-12
Kwal_55.21937 s55 (1047204..1047830) [627 bp, 208 aa] {ON} YPR16...    65   2e-12
Suva_13.93 Chr13 complement(147850..148587) [738 bp, 245 aa] {ON...    65   3e-12
YNL180C Chr14 complement(299654..300649) [996 bp, 331 aa] {ON}  ...    66   3e-12
Smik_13.80 Chr13 complement(142681..143418) [738 bp, 245 aa] {ON...    65   4e-12
Ecym_2048 Chr2 (75961..77217) [1257 bp, 418 aa] {ON} similar to ...    66   5e-12
ZYRO0A01606g Chr1 (133530..134252) [723 bp, 240 aa] {ON} highly ...    65   5e-12
Skud_13.80 Chr13 complement(143292..144029) [738 bp, 245 aa] {ON...    65   5e-12
YCR027C Chr3 complement(167370..167999) [630 bp, 209 aa] {ON}  R...    64   6e-12
KNAG0E03990 Chr5 (788341..789045) [705 bp, 234 aa] {ON} Anc_4.32...    64   6e-12
NDAI0D03040 Chr4 (717810..718454) [645 bp, 214 aa] {ON} Anc_4.326      64   7e-12
NDAI0B03750 Chr2 complement(940372..941094) [723 bp, 240 aa] {ON...    64   7e-12
NCAS0J02000 Chr10 (384676..385347) [672 bp, 223 aa] {ON} Anc_4.326     64   8e-12
Ecym_7211 Chr7 (442765..443412) [648 bp, 215 aa] {ON} similar to...    64   9e-12
KAFR0F00400 Chr6 complement(94002..94754) [753 bp, 250 aa] {ON} ...    64   1e-11
Smik_14.27 Chr14 (44732..45976) [1245 bp, 414 aa] {ON} YNL304W (...    64   2e-11
Skud_14.35 Chr14 (53689..55065) [1377 bp, 458 aa] {ON} YNL304W (...    64   2e-11
Smik_14.150 Chr14 complement(278905..279900) [996 bp, 331 aa] {O...    64   2e-11
KAFR0A08400 Chr1 complement(1686919..1688154) [1236 bp, 411 aa] ...    64   3e-11
Suva_14.35 Chr14 (56635..57891) [1257 bp, 418 aa] {ON} YNL304W (...    64   3e-11
YNL304W Chr14 (60297..61550) [1254 bp, 417 aa] {ON}  YPT11Rab fa...    63   6e-11
NDAI0F03360 Chr6 (810071..811003) [933 bp, 310 aa] {ON} Anc_2.75       62   6e-11
ABR182W Chr2 (754518..755147) [630 bp, 209 aa] {ON} Rho1a; Synte...    61   8e-11
Kpol_1056.30 s1056 complement(68711..69394) [684 bp, 227 aa] {ON...    61   1e-10
Suva_14.161 Chr14 complement(295880..296878) [999 bp, 332 aa] {O...    62   1e-10
NDAI0A06180 Chr1 complement(1405552..1407303) [1752 bp, 583 aa] ...    62   1e-10
TPHA0I03140 Chr9 (697331..697990) [660 bp, 219 aa] {ON} Anc_7.521      60   1e-10
Skud_14.154 Chr14 complement(290647..291642) [996 bp, 331 aa] {O...    61   2e-10
TDEL0E00580 Chr5 (126371..127576) [1206 bp, 401 aa] {ON} Anc_3.4...    61   2e-10
CAGL0M03817g Chr13 complement(431237..432664) [1428 bp, 475 aa] ...    61   3e-10
ADL162W Chr4 (405599..406813) [1215 bp, 404 aa] {ON} Syntenic ho...    60   3e-10
TBLA0D05710 Chr4 (1411089..1412231) [1143 bp, 380 aa] {ON} Anc_1...    60   4e-10
TPHA0O00870 Chr15 complement(162632..163369) [738 bp, 245 aa] {O...    59   4e-10
Kwal_55.21971 s55 complement(1059877..1061142) [1266 bp, 421 aa]...    60   5e-10
KLLA0C12881g Chr3 (1090895..1092016) [1122 bp, 373 aa] {ON} simi...    60   6e-10
CAGL0G05764g Chr7 complement(552809..553681) [873 bp, 290 aa] {O...    59   8e-10
ZYRO0C02618g Chr3 complement(208102..209172) [1071 bp, 356 aa] {...    59   1e-09
NDAI0B04050 Chr2 complement(1027616..1028029) [414 bp, 137 aa] {...    55   3e-09
Kpol_1060.60 s1060 complement(139699..140631) [933 bp, 310 aa] {...    57   6e-09
TBLA0B00790 Chr2 complement(171658..172677) [1020 bp, 339 aa] {O...    57   6e-09
SAKL0C12716g Chr3 complement(1135452..1136720) [1269 bp, 422 aa]...    56   9e-09
KLTH0F18810g Chr6 complement(1525047..1526393) [1347 bp, 448 aa]...    56   1e-08
TBLA0B08610 Chr2 complement(2057209..2059068) [1860 bp, 619 aa] ...    56   1e-08
TPHA0P01330 Chr16 complement(269708..271318) [1611 bp, 536 aa] {...    55   2e-08
KLTH0G05654g Chr7 complement(450410..451090,451167..451244) [759...    55   2e-08
KLLA0F02662g Chr6 (241804..242565) [762 bp, 253 aa] {ON} conserv...    54   3e-08
Kpol_505.1 s505 (572..1471) [900 bp, 299 aa] {ON} (572..1471) [9...    53   8e-08
Kpol_1076.2 s1076 complement(1580..3259) [1680 bp, 559 aa] {ON} ...    53   2e-07
Kwal_47.18241 s47 (748088..748780) [693 bp, 230 aa] {ON} YOR089C...    52   2e-07
NCAS0A10020 Chr1 complement(2005133..2006716) [1584 bp, 527 aa] ...    52   3e-07
TPHA0C01660 Chr3 (384105..384704) [600 bp, 199 aa] {ON} Anc_8.50...    51   3e-07
CAGL0J11242g Chr10 (1094754..1095908) [1155 bp, 384 aa] {ON} sim...    50   1e-06
TDEL0A04760 Chr1 complement(841005..841718) [714 bp, 237 aa] {ON}      49   2e-06
SAKL0H11066g Chr8 (955148..955741) [594 bp, 197 aa] {ON} highly ...    48   3e-06
Suva_8.147 Chr8 (259965..260516) [552 bp, 183 aa] {ON} YOR094W (...    47   5e-06
TBLA0A06090 Chr1 (1499665..1499689,1499931..1500475) [570 bp, 18...    47   6e-06
Skud_16.61 Chr16 (112172..112199,112340..112884) [573 bp, 190 aa...    47   6e-06
Kpol_1002.39 s1002 (115751..116317) [567 bp, 188 aa] {ON} (11575...    46   1e-05
ZYRO0E07304g Chr5 complement(559169..559713,559791..559815) [570...    46   1e-05
TPHA0J02510 Chr10 complement(557245..557814) [570 bp, 189 aa] {O...    46   1e-05
Skud_16.231 Chr16 (424100..424696) [597 bp, 198 aa] {ON} YPL051W...    46   1e-05
Kpol_333.2 s333 (2276..2875) [600 bp, 199 aa] {ON} (2276..2875) ...    46   1e-05
TPHA0B03060 Chr2 complement(695421..696458) [1038 bp, 345 aa] {O...    47   2e-05
YPL051W Chr16 (459963..460559) [597 bp, 198 aa] {ON}  ARL3GTPase...    46   2e-05
KAFR0K00190 Chr11 (47432..47459,47605..48149) [573 bp, 190 aa] {...    45   2e-05
YHR022C Chr8 complement(149575..150345) [771 bp, 256 aa] {ON} Pu...    46   2e-05
SAKL0G06908g Chr7 complement(568249..569100) [852 bp, 283 aa] {O...    46   2e-05
TDEL0E05440 Chr5 complement(998317..998861,998933..998957) [570 ...    45   3e-05
KLLA0F17072g Chr6 complement(1566668..1567240) [573 bp, 190 aa] ...    45   3e-05
Suva_16.88 Chr16 (148107..148134,148267..148811) [573 bp, 190 aa...    45   3e-05
Smik_6.423 Chr6 complement(684936..685480,685617..685644) [573 b...    45   3e-05
YPL218W Chr16 (138698..138725,138865..139409) [573 bp, 190 aa] {...    45   3e-05
AGL261W Chr7 (218211..218807) [597 bp, 198 aa] {ON} Syntenic hom...    45   3e-05
NCAS0D01240 Chr4 complement(226870..227421) [552 bp, 183 aa] {ON...    45   3e-05
SAKL0A03960g Chr1 (368829..368850,368923..369467) [567 bp, 188 a...    45   4e-05
Smik_16.185 Chr16 (335352..335948) [597 bp, 198 aa] {ON} YPL051W...    45   4e-05
KNAG0D01000 Chr4 (164190..164217,164460..165004) [573 bp, 190 aa...    44   5e-05
TBLA0A00450 Chr1 complement(83149..83760) [612 bp, 203 aa] {ON} ...    44   6e-05
TPHA0H02990 Chr8 (715815..717776) [1962 bp, 653 aa] {ON} Anc_7.1...    45   6e-05
Skud_15.259 Chr15 (459133..459684) [552 bp, 183 aa] {ON} YOR094W...    44   6e-05
KAFR0E01740 Chr5 complement(352927..353958) [1032 bp, 343 aa] {O...    45   7e-05
CAGL0E05896g Chr5 complement(584585..585129,585415..585439) [570...    44   7e-05
AFL114W Chr6 (222754..223326) [573 bp, 190 aa] {ON} Syntenic hom...    44   7e-05
ZYRO0F08536g Chr6 complement(687627..688223) [597 bp, 198 aa] {O...    44   7e-05
Suva_16.264 Chr16 (463019..463615) [597 bp, 198 aa] {ON} YPL051W...    44   7e-05
SAKL0E10054g Chr5 (843076..843621) [546 bp, 181 aa] {ON} highly ...    44   9e-05
NCAS0B06760 Chr2 (1290711..1291256) [546 bp, 181 aa] {ON} Anc_2....    44   9e-05
Smik_15.274 Chr15 (463883..464434) [552 bp, 183 aa] {ON} YOR094W...    44   9e-05
NDAI0E03010 Chr5 (642507..643181) [675 bp, 224 aa] {ON} Anc_8.502      44   1e-04
YOR094W Chr15 (502795..503346) [552 bp, 183 aa] {ON}  ARF3Glucos...    43   1e-04
Kwal_27.11872 s27 complement(985259..985852) [594 bp, 197 aa] {O...    43   1e-04
NCAS0C02320 Chr3 (436472..437071) [600 bp, 199 aa] {ON} Anc_8.502      43   1e-04
Skud_1.12 Chr1 complement(28719..30704) [1986 bp, 661 aa] {ON} Y...    44   2e-04
ZYRO0E02090g Chr5 complement(155560..156105) [546 bp, 181 aa] {O...    43   2e-04
KLTH0H03696g Chr8 (335581..335602,335689..336233) [567 bp, 188 a...    43   2e-04
Ecym_2552 Chr2 complement(1071072..1071668) [597 bp, 198 aa] {ON...    43   2e-04
KAFR0J01900 Chr10 (369226..369768) [543 bp, 180 aa] {ON} Anc_2.1...    42   2e-04
Kwal_56.24462 s56 complement(1005762..1006307) [546 bp, 181 aa] ...    42   2e-04
Kpol_1019.32 s1019 (66082..66627) [546 bp, 181 aa] {ON} (66082.....    42   3e-04
TPHA0P00900 Chr16 complement(180898..181443) [546 bp, 181 aa] {O...    42   3e-04
TPHA0A03130 Chr1 (688097..688642) [546 bp, 181 aa] {ON} Anc_7.30...    42   3e-04
TBLA0A05900 Chr1 (1456128..1456673) [546 bp, 181 aa] {ON} Anc_7....    42   3e-04
NDAI0A02910 Chr1 (653631..654176) [546 bp, 181 aa] {ON}                42   3e-04
KAFR0L01290 Chr12 complement(239086..239631) [546 bp, 181 aa] {O...    42   3e-04
KAFR0B01090 Chr2 (206995..207540) [546 bp, 181 aa] {ON} Anc_7.30...    42   3e-04
Skud_4.117 Chr4 (212154..212699) [546 bp, 181 aa] {ON} YDL137W (...    42   3e-04
Smik_4.98 Chr4 (193129..193674) [546 bp, 181 aa] {ON} YDL137W (R...    42   3e-04
YDL137W Chr4 (216529..217074) [546 bp, 181 aa] {ON}  ARF2ADP-rib...    42   3e-04
NDAI0F01490 Chr6 (367903..367927,368225..368772) [573 bp, 190 aa...    42   3e-04
TDEL0B01350 Chr2 (239829..240425) [597 bp, 198 aa] {ON} Anc_8.50...    42   3e-04
YAL048C Chr1 complement(52801..54789) [1989 bp, 662 aa] {ON}  GE...    43   4e-04
NDAI0A02160 Chr1 (489919..490575) [657 bp, 218 aa] {ON} Anc_7.307      42   4e-04
TDEL0C02390 Chr3 (420853..421398) [546 bp, 181 aa] {ON} Anc_7.30...    42   4e-04
ZYRO0F05742g Chr6 complement(473659..474204) [546 bp, 181 aa] {O...    42   4e-04
TPHA0F01600 Chr6 (371312..371857) [546 bp, 181 aa] {ON} Anc_2.19...    42   4e-04
KNAG0B02830 Chr2 (545859..546404) [546 bp, 181 aa] {ON} Anc_7.30...    42   4e-04
Skud_4.66 Chr4 (113702..114247) [546 bp, 181 aa] {ON} YDL192W (R...    42   4e-04
Smik_4.48 Chr4 (94533..95078) [546 bp, 181 aa] {ON} YDL192W (REAL)     42   4e-04
YDL192W Chr4 (116321..116866) [546 bp, 181 aa] {ON}  ARF1ADP-rib...    42   4e-04
KNAG0C04000 Chr3 (788971..789546) [576 bp, 191 aa] {ON} Anc_7.30...    42   4e-04
Kpol_2000.16 s2000 complement(29208..29753) [546 bp, 181 aa] {ON...    41   5e-04
NCAS0A13870 Chr1 complement(2722379..2722924) [546 bp, 181 aa] {...    41   5e-04
NCAS0E03720 Chr5 complement(731259..731804) [546 bp, 181 aa] {ON...    41   5e-04
CAGL0J09064g Chr10 (894680..895225) [546 bp, 181 aa] {ON} highly...    41   5e-04
CAGL0I03916g Chr9 (343014..343559) [546 bp, 181 aa] {ON} highly ...    41   5e-04
Suva_4.56 Chr4 (104717..105262) [546 bp, 181 aa] {ON} YDL192W (R...    41   5e-04
Suva_4.107 Chr4 (204848..205393) [546 bp, 181 aa] {ON} YDL137W (...    41   5e-04
KLTH0E11660g Chr5 complement(1038583..1039245) [663 bp, 220 aa] ...    41   7e-04
KLTH0H02200g Chr8 (199831..200376) [546 bp, 181 aa] {ON} highly ...    41   7e-04
TBLA0F02110 Chr6 complement(518429..518974) [546 bp, 181 aa] {ON...    41   7e-04
Ecym_2181 Chr2 (354573..355145) [573 bp, 190 aa] {ON} similar to...    41   8e-04
KLLA0B02046g Chr2 (178646..179218) [573 bp, 190 aa] {ON} highly ...    41   8e-04
Smik_13.187 Chr13 complement(311260..312843) [1584 bp, 527 aa] {...    42   8e-04
Suva_1.16 Chr1 complement(29877..31853) [1977 bp, 658 aa] {ON} Y...    42   9e-04
Smik_1.15 Chr1 complement(35773..37758) [1986 bp, 661 aa] {ON} Y...    42   9e-04
Kwal_23.2944 s23 complement(84192..84746) [555 bp, 184 aa] {ON} ...    40   0.001
KNAG0A02140 Chr1 (186453..187052) [600 bp, 199 aa] {ON} Anc_8.50...    40   0.001
KLTH0G08074g Chr7 complement(651983..652537) [555 bp, 184 aa] {O...    40   0.002
Ecym_5356 Chr5 complement(720805..721350) [546 bp, 181 aa] {ON} ...    39   0.002
ZYRO0A05500g Chr1 complement(448060..448785) [726 bp, 241 aa] {O...    40   0.003
KAFR0A02180 Chr1 complement(455809..457344) [1536 bp, 511 aa] {O...    40   0.003
TDEL0E03600 Chr5 (677077..677943) [867 bp, 288 aa] {ON} Anc_5.26...    40   0.003
KLTH0G07172g Chr7 (578557..579714) [1158 bp, 385 aa] {ON} some s...    40   0.003
TDEL0F01430 Chr6 complement(253231..253776) [546 bp, 181 aa] {ON...    39   0.003
Kpol_1020.46 s1020 (107506..108051) [546 bp, 181 aa] {ON} (10750...    39   0.003
Kwal_56.24453 s56 complement(1004296..1004841) [546 bp, 181 aa] ...    39   0.005
KLTH0H02222g Chr8 (201281..201826) [546 bp, 181 aa] {ON} highly ...    38   0.008
SAKL0F10296g Chr6 complement(791446..791991) [546 bp, 181 aa] {O...    38   0.008
ACL078W Chr3 (212664..213209) [546 bp, 181 aa] {ON} Syntenic hom...    38   0.008
KNAG0H03300 Chr8 (620438..620983) [546 bp, 181 aa] {ON} Anc_2.19...    38   0.008
YMR023C Chr13 complement(319437..321017) [1581 bp, 526 aa] {ON} ...    39   0.009
CAGL0E06292g Chr5 (633372..634598) [1227 bp, 408 aa] {ON} some s...    38   0.011
Ecym_8057 Chr8 complement(123686..124231) [546 bp, 181 aa] {ON} ...    37   0.011
ADR094W Chr4 (878121..878666) [546 bp, 181 aa] {ON} Syntenic hom...    37   0.011
Suva_13.190 Chr13 complement(310063..311646) [1584 bp, 527 aa] {...    38   0.012
TBLA0B01480 Chr2 complement(320668..321213) [546 bp, 181 aa] {ON...    37   0.015
KLLA0E24773g Chr5 (2194554..2195105) [552 bp, 183 aa] {ON} highl...    37   0.015
Skud_13.177 Chr13 complement(306114..307697) [1584 bp, 527 aa] {...    38   0.016
KLLA0A03465g Chr1 complement(314573..316552) [1980 bp, 659 aa] {...    38   0.016
AEL232C Chr5 complement(196356..197285) [930 bp, 309 aa] {ON} NO...    37   0.017
SAKL0F10318g Chr6 complement(793294..793782) [489 bp, 162 aa] {O...    37   0.018
KLLA0F05225g Chr6 (515391..515936) [546 bp, 181 aa] {ON} highly ...    37   0.021
KAFR0B05110 Chr2 complement(1051041..1051583) [543 bp, 180 aa] {...    36   0.028
TPHA0A01165 Chr1 complement(228734..229285) [552 bp, 183 aa] {ON}      36   0.028
KLTH0D00880g Chr4 complement(84021..86015) [1995 bp, 664 aa] {ON...    37   0.029
TBLA0A01350 Chr1 (320382..321452) [1071 bp, 356 aa] {ON} Anc_1.4...    37   0.033
SAKL0H08624g Chr8 complement(744555..745106) [552 bp, 183 aa] {O...    35   0.051
Ecym_7092 Chr7 (177595..178146) [552 bp, 183 aa] {ON} similar to...    35   0.051
ZYRO0A10340g Chr1 complement(841263..841814) [552 bp, 183 aa] {O...    35   0.051
KNAG0A01690 Chr1 complement(99320..99871) [552 bp, 183 aa] {ON} ...    35   0.051
KAFR0E00655 Chr5 complement(145183..145734) [552 bp, 183 aa] {ON}      35   0.051
Suva_4.416 Chr4 complement(737342..737893) [552 bp, 183 aa] {ON}...    35   0.051
Skud_2.292 Chr2 complement(535291..535842) [552 bp, 183 aa] {ON}...    35   0.051
Smik_2.305 Chr2 complement(554080..554631) [552 bp, 183 aa] {ON}...    35   0.051
YBR164C Chr2 complement(567875..568426) [552 bp, 183 aa] {ON}  A...    35   0.051
KAFR0I00240 Chr9 complement(51330..53309) [1980 bp, 659 aa] {ON}...    36   0.052
AFR446W Chr6 (1240748..1241647) [900 bp, 299 aa] {ON} Syntenic h...    36   0.055
KLTH0D08074g Chr4 complement(684208..685701) [1494 bp, 497 aa] {...    36   0.066
NDAI0E02560 Chr5 complement(533331..533882) [552 bp, 183 aa] {ON...    35   0.069
NCAS0C01840 Chr3 complement(342241..342792) [552 bp, 183 aa] {ON...    35   0.069
CAGL0I10835g Chr9 (1071206..1071757) [552 bp, 183 aa] {ON} highl...    35   0.069
KLTH0E13838g Chr5 (1219497..1220048) [552 bp, 183 aa] {ON} highl...    35   0.093
Suva_16.203 Chr16 complement(356955..357512) [558 bp, 185 aa] {O...    35   0.094
NCAS0B00230 Chr2 (22985..23914) [930 bp, 309 aa] {ON} Anc_8.855 ...    35   0.10 
AGR221W Chr7 (1164825..1165376) [552 bp, 183 aa] {ON} Syntenic h...    34   0.13 
TDEL0A05420 Chr1 (950041..950592) [552 bp, 183 aa] {ON} Anc_8.59...    34   0.13 
TBLA0E04020 Chr5 (1011363..1011914) [552 bp, 183 aa] {ON} Anc_8....    34   0.13 
Ecym_8058 Chr8 complement(125461..126084) [624 bp, 207 aa] {ON} ...    34   0.14 
Suva_13.22 Chr13 (26809..27738) [930 bp, 309 aa] {ON} YML121W (R...    34   0.18 
Skud_13.20 Chr13 (26713..27645) [933 bp, 310 aa] {ON} YML121W (R...    34   0.18 
YML121W Chr13 (26930..27862) [933 bp, 310 aa] {ON}  GTR1Cytoplas...    34   0.18 
CAGL0M07546g Chr13 (756457..757920) [1464 bp, 487 aa] {ON} simil...    34   0.21 
NCAS0A07600 Chr1 (1510813..1512783) [1971 bp, 656 aa] {ON}             34   0.30 
Kwal_26.6810 s26 complement(74581..76575) [1995 bp, 664 aa] {ON}...    34   0.30 
SAKL0D14498g Chr4 (1190537..1190579,1190642..1192623) [2025 bp, ...    34   0.30 
Kwal_33.14296 s33 (608548..609447) [900 bp, 299 aa] {ON} YML121W...    33   0.32 
KLTH0F06952g Chr6 (607612..608511) [900 bp, 299 aa] {ON} highly ...    33   0.32 
Kwal_26.8232 s26 complement(699606..701084) [1479 bp, 492 aa] {O...    33   0.37 
ZYRO0E06446g Chr5 complement(488300..489820) [1521 bp, 506 aa] {...    33   0.38 
TDEL0H04320 Chr8 (743371..745332) [1962 bp, 653 aa] {ON} Anc_7.1...    33   0.39 
ADR402W Chr4 (1426897..1428882) [1986 bp, 661 aa] {ON} Syntenic ...    33   0.39 
Smik_13.13 Chr13 (23291..24223) [933 bp, 310 aa] {ON} YML121W (R...    33   0.43 
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    33   0.49 
NCAS0A07490 Chr1 complement(1488151..1490121) [1971 bp, 656 aa] ...    33   0.53 
Ecym_5018 Chr5 complement(39804..41783) [1980 bp, 659 aa] {ON} s...    33   0.53 
Ecym_1392 Chr1 (813854..814753) [900 bp, 299 aa] {ON} similar to...    33   0.57 
NDAI0E00220 Chr5 (23266..24174) [909 bp, 302 aa] {ON} Anc_4.54 Y...    33   0.57 
TPHA0C04810 Chr3 complement(1038869..1039846) [978 bp, 325 aa] {...    33   0.59 
KNAG0G03510 Chr7 complement(749018..750010) [993 bp, 330 aa] {ON...    33   0.59 
Kpol_1049.6 s1049 (13314..15272) [1959 bp, 652 aa] {ON} (13314.....    33   0.70 
SAKL0D01034g Chr4 (75089..75988) [900 bp, 299 aa] {ON} highly si...    32   0.76 
KLLA0E12805g Chr5 (1135181..1135780) [600 bp, 199 aa] {ON} simil...    32   0.81 
TDEL0B06610 Chr2 complement(1168348..1169853) [1506 bp, 501 aa] ...    32   0.89 
KAFR0B03285 Chr2 (683307..687806) [4500 bp, 1499 aa] {ON}              32   1.0  
Kpol_541.18 s541 complement(50148..51128) [981 bp, 326 aa] {ON} ...    32   1.1  
TBLA0A10480 Chr1 (2580976..2582211) [1236 bp, 411 aa] {ON} Anc_5...    32   1.1  
TPHA0I02500 Chr9 complement(554264..555934) [1671 bp, 556 aa] {O...    32   1.2  
AEL034W Chr5 (568246..570261) [2016 bp, 671 aa] {ON} Syntenic ho...    32   1.3  
CAGL0M12276g Chr13 (1225135..1227084) [1950 bp, 649 aa] {ON} hig...    32   1.7  
ZYRO0A00968g Chr1 (69245..70144) [900 bp, 299 aa] {ON} highly si...    31   1.8  
Kwal_56.24149 s56 complement(873371..873820) [450 bp, 149 aa] {O...    30   2.0  
KNAG0E04140 Chr5 (820949..822970) [2022 bp, 673 aa] {ON} Anc_7.1...    31   2.2  
CAGL0B02453g Chr2 complement(234125..235075) [951 bp, 316 aa] {O...    31   2.5  
TPHA0N01270 Chr14 complement(275792..276754) [963 bp, 320 aa] {O...    31   2.5  
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    31   2.7  
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    31   2.7  
NDAI0F02930 Chr6 complement(716511..716963) [453 bp, 150 aa] {ON...    30   2.8  
TBLA0B09230 Chr2 complement(2184288..2184752) [465 bp, 154 aa] {...    30   2.8  
KLLA0C06358g Chr3 complement(563583..564482) [900 bp, 299 aa] {O...    30   3.3  
TBLA0B02930 Chr2 complement(674860..675783) [924 bp, 307 aa] {ON...    30   3.3  
KNAG0E02100 Chr5 complement(430423..431022) [600 bp, 199 aa] {ON...    30   3.5  
Ecym_7062 Chr7 complement(129195..130643) [1449 bp, 482 aa] {ON}...    30   3.7  
CAGL0A01980g Chr1 complement(208311..210338) [2028 bp, 675 aa] {...    30   3.9  
TBLA0I01600 Chr9 complement(348934..351318) [2385 bp, 794 aa] {O...    30   4.0  
KLLA0D09801g Chr4 (827563..830193) [2631 bp, 876 aa] {ON} simila...    30   4.1  
TPHA0C00270 Chr3 complement(41978..44974) [2997 bp, 998 aa] {ON}...    30   4.1  
TDEL0B00240 Chr2 complement(46369..47268) [900 bp, 299 aa] {ON} ...    30   4.4  
NDAI0D01840 Chr4 (432480..433610) [1131 bp, 376 aa] {ON} Anc_5.2...    30   4.7  
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...    30   5.1  
ZYRO0C00770g Chr3 complement(58234..60192) [1959 bp, 652 aa] {ON...    30   5.2  
NDAI0I03110 Chr9 complement(729539..732637) [3099 bp, 1032 aa] {...    30   5.5  
CAGL0L12892g Chr12 (1377787..1378776) [990 bp, 329 aa] {ON} simi...    30   6.0  
Kwal_55.21524 s55 (873032..874189) [1158 bp, 385 aa] {ON} YHR107...    30   6.3  
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       30   6.3  
NDAI0C04880 Chr3 complement(1131659..1132876) [1218 bp, 405 aa] ...    30   6.4  
Smik_16.146 Chr16 (258668..260119) [1452 bp, 483 aa] {ON} YPL091...    30   6.6  
Kpol_1064.23 s1064 (40928..42457) [1530 bp, 509 aa] {ON} (40928....    30   6.7  
TBLA0A04400 Chr1 complement(1082864..1084813) [1950 bp, 649 aa] ...    30   7.0  
NDAI0H01980 Chr8 (479594..481675) [2082 bp, 693 aa] {ON} Anc_7.1...    30   7.0  
NCAS0G02750 Chr7 (497176..500715) [3540 bp, 1179 aa] {ON} Anc_2....    30   7.4  
CAGL0J05654g Chr10 (540710..545416) [4707 bp, 1568 aa] {ON} simi...    30   7.5  
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...    30   7.5  
KAFR0I01610 Chr9 complement(337286..338164) [879 bp, 292 aa] {ON...    29   7.6  
KAFR0A02900 Chr1 complement(602619..603515) [897 bp, 298 aa] {ON...    29   7.8  
ADR111W Chr4 (902185..903150) [966 bp, 321 aa] {ON} Syntenic hom...    29   8.0  
ABR080W Chr2 (532917..533939) [1023 bp, 340 aa] {ON} Syntenic ho...    29   8.0  
SAKL0D13618g Chr4 complement(1128458..1129948) [1491 bp, 496 aa]...    29   8.9  
SAKL0G13816g Chr7 (1183028..1184962) [1935 bp, 644 aa] {ON} simi...    29   9.2  
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    29   9.8  
Skud_9.149 Chr9 complement(283642..284427) [786 bp, 261 aa] {ON}...    29   9.8  

>CAGL0E02607g Chr5 complement(248998..249624) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001w YPT7 GTP-binding protein of the RAB
           family
          Length = 208

 Score =  413 bits (1062), Expect = e-149
 Identities = 208/208 (100%), Positives = 208/208 (100%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM
Sbjct: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN
Sbjct: 121 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           QNDAHAFEDDFNDAINIQLEGESNSCSC
Sbjct: 181 QNDAHAFEDDFNDAINIQLEGESNSCSC 208

>Smik_13.158 Chr13 (258333..258959) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  375 bits (964), Expect = e-134
 Identities = 183/208 (87%), Positives = 198/208 (95%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +D DKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNA SFENIKSW+DEFLVHAN+SSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVSSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D E+SKKVVSEK+ QELAKSLGD+PLFLTSAK+AINVDTAFEEIA+SALQQN
Sbjct: 121 FVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q D  AFEDD+NDAINI+L+GE+NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>Kpol_1037.28 s1037 (68071..68697) [627 bp, 208 aa] {ON}
           (68071..68697) [627 nt, 209 aa]
          Length = 208

 Score =  375 bits (962), Expect = e-133
 Identities = 180/208 (86%), Positives = 198/208 (95%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVI+LGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DDDK  TM
Sbjct: 1   MSSRKKNILKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDDKAATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN+KSFENIKSW+DEFL+HAN+SSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKSWRDEFLIHANVSSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D+EDSKK+V++K+ QELAK LGDVPLFLTSAK+AINVD AFEEIA+SALQQN
Sbjct: 121 FVILGNKIDVEDSKKIVTQKSAQELAKELGDVPLFLTSAKNAINVDQAFEEIARSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q DA AFEDDFNDAINIQL+GE +SCSC
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCSC 208

>Suva_13.161 Chr13 (257150..257776) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  374 bits (961), Expect = e-133
 Identities = 182/208 (87%), Positives = 198/208 (95%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +D DKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNA SFENIKSW+DEFLVHAN++SPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D E+SKKVVSEK+ QELAKSLGD+PLFLTSAK+AINVDTAFEEIA+SALQQN
Sbjct: 121 FVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q D  AFEDD+NDAINI+L+GE+NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>Skud_13.153 Chr13 (253075..253701) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  374 bits (961), Expect = e-133
 Identities = 182/208 (87%), Positives = 198/208 (95%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +D DKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNA SFENIKSW+DEFLVHAN++SPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D E+SKKVVSEK+ QELAKSLGD+PLFLTSAK+AINVDTAFEEIA+SALQQN
Sbjct: 121 FVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q D  AFEDD+NDAINI+L+GE+NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>YML001W Chr13 (267174..267800) [627 bp, 208 aa] {ON}  YPT7Rab
           family GTPase; GTP-binding protein of the rab family;
           required for homotypic fusion event in vacuole
           inheritance, for endosome-endosome fusion, similar to
           mammalian Rab7
          Length = 208

 Score =  374 bits (960), Expect = e-133
 Identities = 181/208 (87%), Positives = 198/208 (95%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +D DKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNA SFENIKSW+DEFLVHAN++SPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D E+SKK+VSEK+ QELAKSLGD+PLFLTSAK+AINVDTAFEEIA+SALQQN
Sbjct: 121 FVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q D  AFEDD+NDAINI+L+GE+NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>TDEL0G04450 Chr7 complement(808210..808836) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  373 bits (958), Expect = e-133
 Identities = 182/208 (87%), Positives = 198/208 (95%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIKSW+DEFLVHAN+SSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNVKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D+E+SKKVV+ K+ Q+LAKSLG+VPLF TSAK+AINVDTAFEEI +SALQQN
Sbjct: 121 FVILGNKIDVEESKKVVNTKSAQDLAKSLGNVPLFFTSAKNAINVDTAFEEIGRSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q DA AFE+DFNDAINIQL+GE +SCSC
Sbjct: 181 QADADAFEEDFNDAINIQLDGEPSSCSC 208

>SAKL0E01386g Chr5 (105246..105872) [627 bp, 208 aa] {ON} highly
           similar to uniprot|P32939 Saccharomyces cerevisiae
           YML001W YPT7 Gtp-binding protein of the rab family
           required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 208

 Score =  370 bits (950), Expect = e-132
 Identities = 180/208 (86%), Positives = 199/208 (95%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +D+DKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDEDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSW+DEFLVHAN+SSPESFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D+E+SKKVV+ ++ QELAKSLG+VPLFLTSAK +INV+TAFEEIA+SALQQ+
Sbjct: 121 FVILGNKIDVEESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQS 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q DA AFEDDFNDAINIQL+GE +SC+C
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCNC 208

>NCAS0H00850 Chr8 (155266..155892) [627 bp, 208 aa] {ON} Anc_6.24
          Length = 208

 Score =  370 bits (950), Expect = e-132
 Identities = 180/208 (86%), Positives = 196/208 (94%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DDDKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSW+DEFLVHAN+SSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNKVDI+++KKVVS  A QELAKSLG+ PLF+TSAK +IN+D AFEEIA+SALQQN
Sbjct: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q+DA AF+DDFNDAINIQL+ E NSCSC
Sbjct: 181 QSDADAFDDDFNDAINIQLDDEPNSCSC 208

>KNAG0M01220 Chr13 (222591..223214) [624 bp, 207 aa] {ON} Anc_6.24
           YML001W
          Length = 207

 Score =  370 bits (949), Expect = e-131
 Identities = 184/208 (88%), Positives = 197/208 (94%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M  RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DD KV TM
Sbjct: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATM 59

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+WKDEFLVHAN+SSPE+FP
Sbjct: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNKVD+E+SKK+V+ KA QELA SLG++PLFLTSAKSAINVDTAFEEIA+SALQQN
Sbjct: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           QNDA AFE+DFNDAINIQL+GE NSCSC
Sbjct: 180 QNDADAFEEDFNDAINIQLDGEPNSCSC 207

>NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24
          Length = 208

 Score =  367 bits (943), Expect = e-131
 Identities = 174/208 (83%), Positives = 195/208 (93%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DDDK+ TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKIATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSW+DEFL+HANIS+PE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLIHANISTPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D+E+SKK+VS  +  ELAKSLGD+PLF TSAK +IN++ AFEEIA+SALQQN
Sbjct: 121 FVILGNKIDVEESKKIVSSNSATELAKSLGDIPLFFTSAKDSINIENAFEEIARSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           QND  AF++DFNDAINI+L+GE NSCSC
Sbjct: 181 QNDVDAFDEDFNDAINIRLDGEPNSCSC 208

>KLTH0C11132g Chr3 complement(915337..915963) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001W YPT7 Gtp-binding protein of the rab
           family required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 208

 Score =  367 bits (941), Expect = e-130
 Identities = 177/208 (85%), Positives = 198/208 (95%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDK+SQQYKATIGADFLTKEV +D DKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKFSQQYKATIGADFLTKEVTMDGDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSW+DEFLVHAN+SSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D+E+SKKVVS ++ Q++AKSLG++PLFLTSAK +INVDTAFEEIA++ALQQ+
Sbjct: 121 FVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQS 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q DA AFEDDFNDAINIQL+GE +SCSC
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCSC 208

>ZYRO0C07700g Chr3 complement(584547..585170) [624 bp, 207 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001W YPT7 Gtp-binding protein of the rab
           family required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 207

 Score =  365 bits (938), Expect = e-130
 Identities = 182/208 (87%), Positives = 197/208 (94%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DD KV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATM 59

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSW+DEFLVHAN+ SPE+FP
Sbjct: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVLSPETFP 119

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNKVD+E+SKK VS K+ QELAKSLG+VPLFLTSAK+AINVDTAFEEIA+SALQQN
Sbjct: 120 FVILGNKVDVEESKKTVSVKSAQELAKSLGNVPLFLTSAKNAINVDTAFEEIARSALQQN 179

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q DA AFE+DFNDAINIQL+GE ++CSC
Sbjct: 180 QADADAFEEDFNDAINIQLDGEPSACSC 207

>Kwal_56.22440 s56 (130574..131200) [627 bp, 208 aa] {ON} YML001W
           (YPT7) - GTP-binding protein, rab family [contig 185]
           FULL
          Length = 208

 Score =  365 bits (937), Expect = e-130
 Identities = 177/208 (85%), Positives = 198/208 (95%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M ARKKNILKVIILGDSGVGKTSLMHRYV+DK+SQQYKATIGADFLTKEV +D DKV TM
Sbjct: 1   MSARKKNILKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSMDGDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSW+DEFLVHAN+SSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D+E+SKKVVS ++ Q++AKSLG++PLFLTSAK +INVDTAFEEIA++ALQQ+
Sbjct: 121 FVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQS 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q DA AFEDDFNDAINIQL+GE +SCSC
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCSC 208

>KAFR0G02670 Chr7 complement(552130..552756) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  364 bits (934), Expect = e-129
 Identities = 175/208 (84%), Positives = 197/208 (94%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M ++KK ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKE+ +D D+  TM
Sbjct: 1   MSSKKKTILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEINVDGDRTATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIKSW+DEFLVHAN+SSPESFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNTKSFENIKSWRDEFLVHANVSSPESFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+DIE++KKV+S K+ Q+LAKSLG++PLFLTSAKS+INVD AFEEIA+SALQQN
Sbjct: 121 FVILGNKIDIEETKKVISVKSAQDLAKSLGNIPLFLTSAKSSINVDPAFEEIARSALQQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           QNDA AFE+DFNDAINIQL+GE++SC+C
Sbjct: 181 QNDADAFEEDFNDAINIQLDGEADSCAC 208

>ACR003C Chr3 complement(359762..360388) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML001W
           (YPT7)
          Length = 208

 Score =  363 bits (933), Expect = e-129
 Identities = 176/208 (84%), Positives = 195/208 (93%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +D DKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFEN+KSW+DEFLVHAN+ SPESFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D+E+SKKVV+ +  QELAKSLG++P FLTSAK+AINVD AFEEIA+SALQQ+
Sbjct: 121 FVILGNKIDVEESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQS 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q DA A+EDDFNDAINIQL+GE +SC+C
Sbjct: 181 QADAGAYEDDFNDAINIQLDGEPSSCNC 208

>Ecym_3028 Chr3 (54759..55385) [627 bp, 208 aa] {ON} similar to
           Ashbya gossypii ACR003C
          Length = 208

 Score =  362 bits (930), Expect = e-129
 Identities = 175/208 (84%), Positives = 196/208 (94%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M +RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +D DKV TM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN+KSFENIK+W+DEFLVHAN+ SPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKAWRDEFLVHANVPSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNK+D+E+SKKVV+ ++ QELAKSLG++P FLTSAK+AINVD AFEEIA+SALQQ+
Sbjct: 121 FVILGNKIDVEESKKVVTTRSSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQS 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q DA A+EDDFNDAINIQL+GE +SCSC
Sbjct: 181 QADADAYEDDFNDAINIQLDGEPSSCSC 208

>TPHA0J00360 Chr10 (80553..81182) [630 bp, 209 aa] {ON} Anc_6.24
           YML001W
          Length = 209

 Score =  356 bits (913), Expect = e-126
 Identities = 171/209 (81%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD-DKVVT 177
           M +RKKN+LKVI+LGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVV+DD  +  T
Sbjct: 1   MSSRKKNLLKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVIDDGSQAAT 60

Query: 178 MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESF 357
           MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+NIKSW+DEFL+HAN+SSPE+F
Sbjct: 61  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFDNIKSWRDEFLIHANVSSPETF 120

Query: 358 PFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ 537
           PFVILGNK+DIEDSK+ +S K GQE+AK LG++PLFLTSAK +INVD AFEEI + ALQQ
Sbjct: 121 PFVILGNKIDIEDSKQKISAKQGQEMAKELGNIPLFLTSAKDSINVDVAFEEITRGALQQ 180

Query: 538 NQNDAHAFEDDFNDAINIQLEGESNSCSC 624
           NQNDA AF+DDFNDAINIQL+ ES+SC+C
Sbjct: 181 NQNDADAFKDDFNDAINIQLDDESSSCAC 209

>KLLA0D01265g Chr4 (110784..111407) [624 bp, 207 aa] {ON} highly
           similar to uniprot|P32939 Saccharomyces cerevisiae
           YML001W YPT7 Gtp-binding protein of the rab family
           required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 207

 Score =  353 bits (905), Expect = e-125
 Identities = 169/207 (81%), Positives = 194/207 (93%)
 Frame = +1

Query: 4   IARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQ 183
           ++RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV+++DDKV TMQ
Sbjct: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60

Query: 184 VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPF 363
           VWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+KSW+DEFLVHAN+SSPE+FPF
Sbjct: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120

Query: 364 VILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQ 543
           VIL NKVD+E+SKKVVS ++ QE AKSLG+VPLF TSAK +INV  AFEEIA+SALQQ+Q
Sbjct: 121 VILANKVDVEESKKVVSSRSAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQ 180

Query: 544 NDAHAFEDDFNDAINIQLEGESNSCSC 624
           +DA A+EDD ++AINIQL+GE +SC+C
Sbjct: 181 SDADAYEDDLSEAINIQLDGEPSSCNC 207

>TBLA0A07180 Chr1 complement(1787774..1788400) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  351 bits (901), Expect = e-124
 Identities = 170/208 (81%), Positives = 191/208 (91%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           M  RKK ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +D+D   TM
Sbjct: 1   MSTRKKQILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVAIDNDTTATM 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIKSW+DEFL+HAN+SSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFENIKSWRDEFLIHANVSSPETFP 120

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           FVILGNKVD +DSKK V+ KA QEL+KSLG++PLF TSAK++INVD+AFEEIA+ AL+QN
Sbjct: 121 FVILGNKVDTKDSKKSVTLKAAQELSKSLGNIPLFQTSAKNSINVDSAFEEIARGALEQN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           + DA A+EDDFNDAINIQL+GE +SC+C
Sbjct: 181 KADADAYEDDFNDAINIQLDGEPSSCAC 208

>Ecym_7305 Chr7 (650045..650686) [642 bp, 213 aa] {ON} similar to
           Ashbya gossypii AGL021W
          Length = 213

 Score =  142 bits (357), Expect = 9e-42
 Identities = 82/202 (40%), Positives = 120/202 (59%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+KV+++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V +D  K+  +Q+WDTA
Sbjct: 19  SIMKVLLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDIDGKKI-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++FENI+ W      HA     E    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFSTVNQHAT----EDAQILLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   + V+ + G+ LAK LG VP    SAK   NV   F  +AK   ++  ND   
Sbjct: 134 KKDMD--TRAVTYEQGESLAKELG-VPFIEASAKDDENVSDIFFTLAKIIQEKIDNDRLV 190

Query: 559 FEDDFNDAINIQLEGESNSCSC 624
                   +NI   G  +S +C
Sbjct: 191 GNFGREGNVNISSSGNLSSSNC 212

>ZYRO0C07062g Chr3 (532175..532819) [645 bp, 214 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 214

 Score =  141 bits (356), Expect = 1e-41
 Identities = 81/206 (39%), Positives = 121/206 (58%), Gaps = 7/206 (3%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E+    I+GNK D
Sbjct: 73  RFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDV---KNERGEENVILCIVGNKSD 129

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++V +E+ G+  AK LG      TS K+  NV   F+ IAKS  +  ++     +D
Sbjct: 130 LSDERQVSTEE-GETKAKVLGAKIFMETSTKAGYNVKNLFKRIAKSLPEFQESPNTGVKD 188

Query: 568 DFN-------DAINIQLEGESNSCSC 624
           D N       D    + E +++SC C
Sbjct: 189 DSNENNAGVIDITTNEEEQQASSCQC 214

>AGL021W Chr7 (681754..682392) [639 bp, 212 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL005W (SEC4)
          Length = 212

 Score =  140 bits (352), Expect = 5e-41
 Identities = 80/202 (39%), Positives = 120/202 (59%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++  K+  +Q+WDTA
Sbjct: 18  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDINGKKI-KLQLWDTA 76

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++FENI+ W      HAN    E    +++GN
Sbjct: 77  GQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTVNQHAN----EEAQLLLVGN 132

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   + V+ + G+ LAK LG VP    SAK   NV   F  +AK   ++  ND   
Sbjct: 133 KKDMD--TRAVTYEQGESLAKELG-VPFIEASAKDDENVSDIFFTLAKLIQEKIDNDKLV 189

Query: 559 FEDDFNDAINIQLEGESNSCSC 624
                  ++NI       S +C
Sbjct: 190 NNSGREGSVNISSGSNMPSSNC 211

>KNAG0D02650 Chr4 (474662..475297) [636 bp, 211 aa] {ON} Anc_8.70
           YFL005W
          Length = 211

 Score =  139 bits (351), Expect = 7e-41
 Identities = 79/206 (38%), Positives = 125/206 (60%), Gaps = 4/206 (1%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+KV+++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++  K+  +Q+WDTA
Sbjct: 13  SIMKVLLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKI-KLQLWDTA 71

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++FEN+K+W      HA     +    +++GN
Sbjct: 72  GQERFRTITTAYYRGAMGIILVYDVTDERTFENVKNWFKTVSDHAT----DDAQLLLVGN 127

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSAL----QQNQN 546
           K D++   ++V+ + G+ L K LG +P    SAK   NV+  F  +AK        Q+  
Sbjct: 128 KCDMD--TRLVTHEQGEALGKELG-IPFVEASAKDDTNVNEVFFTLAKLIQGRLDSQSAA 184

Query: 547 DAHAFEDDFNDAINIQLEGESNSCSC 624
           D+ A   +    +NI   G+ +S +C
Sbjct: 185 DSTAGRGNSKGGVNINENGKKSSSNC 210

>SAKL0B02332g Chr2 (227078..227719) [642 bp, 213 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 213

 Score =  139 bits (351), Expect = 7e-41
 Identities = 77/202 (38%), Positives = 124/202 (61%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++  K+  +Q+WDTA
Sbjct: 19  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKI-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHAN----DEAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   + V+ + G+ L+K LG +P    SAK+  NV+  F  +AK   ++  ND   
Sbjct: 134 KSDMD--TRAVTYEQGEALSKELG-LPFVEASAKNDDNVNEIFFTLAKLIQEKIDNDKLV 190

Query: 559 FEDDFNDAINIQLEGESNSCSC 624
              + + ++NI   G  +  +C
Sbjct: 191 GNTNKDGSVNINSNGGGSKSNC 212

>YLR262C Chr12 complement(668244..668891) [648 bp, 215 aa] {ON}
           YPT6Rab family GTPase, Ras-like GTP binding protein
           involved in the secretory pathway, required for fusion
           of endosome-derived vesicles with the late Golgi,
           maturation of the vacuolar carboxypeptidase Y; has
           similarity to the human GTPase, Rab6
          Length = 215

 Score =  139 bits (350), Expect = 1e-40
 Identities = 81/209 (38%), Positives = 122/209 (58%), Gaps = 10/209 (4%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E+    I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGDENVILCIVGNKSD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ-QNQNDAHAFE 564
           + D +++ +E+ G++ AK LG      TS K+  NV   F++IAKS  + QN        
Sbjct: 128 LSDERQISTEE-GEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDS 186

Query: 565 DDFNDA---------INIQLEGESNSCSC 624
           ++ N A         I+   E E ++C C
Sbjct: 187 ENANSANQNKPGVIDISTAEEQEQSACQC 215

>Skud_12.341 Chr12 complement(609187..609837) [651 bp, 216 aa] {ON}
           YLR262C (REAL)
          Length = 216

 Score =  139 bits (349), Expect = 2e-40
 Identities = 82/210 (39%), Positives = 121/210 (57%), Gaps = 11/210 (5%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E+    I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEENVILCIVGNKSD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ-QNQNDAHAFE 564
           + D +++ +E+ G++ AK LG      TS K+  NV T F+ IAKS  + QN        
Sbjct: 128 LSDERQISTEE-GEKKAKLLGAKIFMETSTKAGYNVKTLFKRIAKSLPEFQNSESTPLDG 186

Query: 565 DDFNDA----------INIQLEGESNSCSC 624
           ++ N +          I+   E E  SC C
Sbjct: 187 ENANTSGNQNKPGVIDISTTEEQEQTSCQC 216

>KLLA0D05313g Chr4 (459496..460110) [615 bp, 204 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038C YPT1 Ras-like small GTPase involved in the
           ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  138 bits (348), Expect = 2e-40
 Identities = 79/200 (39%), Positives = 124/200 (62%), Gaps = 4/200 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRGA   ++VYDVT+ +SF N+K+W  E     +         +++GNK
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI----DRFGTAGVLKLLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D+ D KKVV  +  +E A S+G +P   TSA  + NV+ AF    ++I +S  +Q +++
Sbjct: 123 NDLTD-KKVVDTEVAKEFADSIG-IPFIETSALDSSNVEEAFLIMTKQIKESVAKQQKDN 180

Query: 550 AHAFEDDFNDAINIQLEGES 609
             A      D  N+ L+G+S
Sbjct: 181 GRA-----EDKSNVNLKGQS 195

>KLTH0C10384g Chr3 (861122..861826) [705 bp, 234 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 234

 Score =  139 bits (350), Expect = 2e-40
 Identities = 81/205 (39%), Positives = 122/205 (59%), Gaps = 6/205 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 35  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 93

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYDVTN KSFE I  W ++     +    E+    I+GNK D
Sbjct: 94  RFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDV---KSERGEENVVLCIVGNKND 150

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++V +E+ G+  A+ L       TS K   NV   F +IAK+  +  ++D+   +D
Sbjct: 151 LSDERQVSTEE-GERKAQVLNAKIFIETSTKVGFNVKNLFRKIAKTLPEFQKSDSVPLDD 209

Query: 568 DFN----DAINIQL--EGESNSCSC 624
           +      D I+I    E E +SC C
Sbjct: 210 NATKNKPDVIDITTNEEQEQSSCQC 234

>Kpol_1011.3 s1011 complement(4828..5472) [645 bp, 214 aa] {ON}
           complement(4828..5472) [645 nt, 215 aa]
          Length = 214

 Score =  138 bits (348), Expect = 2e-40
 Identities = 80/205 (39%), Positives = 127/205 (61%), Gaps = 3/205 (1%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V ++  K+  +Q+WDTA
Sbjct: 18  SIMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVEINGKKI-KLQLWDTA 76

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ K+F NI+ W      HAN    +    +++GN
Sbjct: 77  GQERFRTITTAYYRGAMGIILVYDVTDEKTFANIRQWFKTVTEHAN----DEAQLLLVGN 132

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK---SALQQNQND 549
           K D++   + V+ + G+EL+K LG +P   +SAK+  NV+  F  +AK     +  N+  
Sbjct: 133 KSDMD--TRAVTYEQGEELSKELG-IPFIESSAKNDENVNEIFSTLAKLIQEKIDSNRLA 189

Query: 550 AHAFEDDFNDAINIQLEGESNSCSC 624
           A+    D N  IN    G S+  +C
Sbjct: 190 ANGTGKDSNLNIN-SGSGSSSKANC 213

>TPHA0F02500 Chr6 complement(551815..552462) [648 bp, 215 aa] {ON}
           Anc_6.49 YLR262C
          Length = 215

 Score =  138 bits (347), Expect = 3e-40
 Identities = 74/181 (40%), Positives = 112/181 (61%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++          E+    I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKTE---RGSENVILCIVGNKSD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++V +E+ G+  AK LG      TS K+  NV   F++IAKS  +   +D+   +D
Sbjct: 128 LSDERQVTTEE-GEAKAKELGATIFMETSTKAGHNVKNLFKKIAKSLPEFQNSDSTPLDD 186

Query: 568 D 570
           +
Sbjct: 187 N 187

>CAGL0K06017g Chr11 complement(586922..587581) [660 bp, 219 aa] {ON}
           highly similar to uniprot|Q99260 Saccharomyces
           cerevisiae YLR262c GTP-binding protein
          Length = 219

 Score =  138 bits (347), Expect = 3e-40
 Identities = 74/180 (41%), Positives = 113/180 (62%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 13  KIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 71

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E+    ++GNK D
Sbjct: 72  RFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDV---KNERGAENVILCVVGNKSD 128

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++V +E+ G++ A+ LG      TS K   NV   F++IAKS  +   +DA+  E+
Sbjct: 129 LADERQVTAEE-GEKKAQDLGAKIFMQTSTKVGYNVKNLFKKIAKSLPEFQDSDANPLEN 187

>NDAI0G03340 Chr7 (792718..793341) [624 bp, 207 aa] {ON} Anc_8.70
          Length = 207

 Score =  137 bits (346), Expect = 4e-40
 Identities = 81/203 (39%), Positives = 125/203 (61%), Gaps = 3/203 (1%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 12  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 70

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 71  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWFKTVNEHAN----DEAQLLLVGN 126

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK---SALQQNQND 549
           K D++   +VV+ + G+ LAK LG +P   +SAK+  NV+  F  +AK     +  N+  
Sbjct: 127 KSDMD--TRVVTYEQGESLAKELG-LPFVESSAKNDDNVNEIFFTLAKLIQEKIDANKLS 183

Query: 550 AHAFEDDFNDAINIQLEGESNSC 618
           A     D + +IN    G  +SC
Sbjct: 184 AAGSGKDGSVSINGSNSGSKSSC 206

>NCAS0D02500 Chr4 (474037..474705) [669 bp, 222 aa] {ON} Anc_6.49
          Length = 222

 Score =  138 bits (347), Expect = 4e-40
 Identities = 76/187 (40%), Positives = 113/187 (60%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    ++    I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDV---KNERGDDNVILCIVGNKSD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++V  E+ G+  AK LG      TS K+  NV   F++IAKS  +   +D +  + 
Sbjct: 128 LSDERQVTIEE-GENKAKILGADIFMETSTKAGYNVKNLFKKIAKSLPEFQNSDTNPLDT 186

Query: 568 DFNDAIN 588
           D N   N
Sbjct: 187 DGNGKNN 193

>Kwal_23.5058 s23 (989533..990174) [642 bp, 213 aa] {ON} YFL005W
           (SEC4) - Ras-like small GTP-binding protein [contig 7]
           FULL
          Length = 213

 Score =  137 bits (346), Expect = 4e-40
 Identities = 76/202 (37%), Positives = 122/202 (60%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 19  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHAN----DEAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   + VS   G+ LAK LG +P    SAK   NV+  F ++AK   ++  ++   
Sbjct: 134 KSDMD--TRAVSTDQGESLAKELG-IPFVEASAKDDTNVNDIFFQLAKLIQEKIDSEKLV 190

Query: 559 FEDDFNDAINIQLEGESNSCSC 624
                + ++N+   G +   +C
Sbjct: 191 GNTGRDGSVNVGAGGNNAKSNC 212

>KLTH0A02662g Chr1 complement(226313..226954) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P07560 Saccharomyces
           cerevisiae YFL005W SEC4 Secretory vesicle-associated Rab
           GTPase essential for exocytosis associates with the
           exocyst component Sec15p and may regulate polarized
           delivery of transport vesicles to the exocyst at the
           plasma membrane
          Length = 213

 Score =  137 bits (346), Expect = 4e-40
 Identities = 77/202 (38%), Positives = 122/202 (60%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 19  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWFSTVNQHAN----DEAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   + VS   G+ LAK LG +P    SAK   NV+  F  +AK   ++  ++   
Sbjct: 134 KSDMD--TRAVSTDQGEALAKELG-IPFVEASAKDDTNVNDIFFLLAKLIQEKIDSEKLV 190

Query: 559 FEDDFNDAINIQLEGESNSCSC 624
                + ++N+   G ++  +C
Sbjct: 191 GNTGRDGSVNVGAAGNNSKSNC 212

>Smik_12.336 Chr12 complement(606255..606905) [651 bp, 216 aa] {ON}
           YLR262C (REAL)
          Length = 216

 Score =  137 bits (346), Expect = 5e-40
 Identities = 76/173 (43%), Positives = 112/173 (64%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E+    I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEENVILCIVGNKSD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQN 546
           + D +++ +E+ G++ AK LG      TS K+  NV T F++IAKS L + QN
Sbjct: 128 LSDERQISTEE-GEKKAKLLGAKIFMETSTKAGYNVKTLFKKIAKS-LPEFQN 178

>KAFR0C03330 Chr3 (679443..680075) [633 bp, 210 aa] {ON} Anc_8.70
           YFL005W
          Length = 210

 Score =  137 bits (345), Expect = 5e-40
 Identities = 85/203 (41%), Positives = 124/203 (61%), Gaps = 2/203 (0%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++  K+  +Q+WDTA
Sbjct: 15  SIMKILLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVEINGKKI-KLQLWDTA 73

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ K+F NI  W      HAN    +    +++GN
Sbjct: 74  GQERFRTITTAYYRGAMGIILVYDVTDEKTFANINKWFKTVTEHAN----DDAQLLLVGN 129

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   +VVS + G+ LAK LG +P   +SAK   NV   F  +AK  L Q++ DA+ 
Sbjct: 130 KNDMD--TRVVSCEQGEVLAKELG-LPFVESSAKDNNNVSDIFLSLAK--LIQDKIDANN 184

Query: 559 FEDDFND--AINIQLEGESNSCS 621
                N    INI     S+S S
Sbjct: 185 ITTGANQQKGININTNNSSSSKS 207

>TPHA0P00360 Chr16 (76379..77023) [645 bp, 214 aa] {ON} Anc_8.70
           YFL005W
          Length = 214

 Score =  137 bits (345), Expect = 6e-40
 Identities = 80/202 (39%), Positives = 126/202 (62%), Gaps = 1/202 (0%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V ++  K+  +Q+WDTA
Sbjct: 18  SIMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVEINGRKI-KLQLWDTA 76

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ K+F NI+ W      HAN    +    +++GN
Sbjct: 77  GQERFRTITTAYYRGAMGIILVYDVTDEKTFANIRQWFKTVTEHAN----DDAQLLLVGN 132

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D+E   + V+ + G EL++ LG +P    SAK+  NV+  F  +AK   ++  ++  A
Sbjct: 133 KSDME--TRTVTHEQGDELSRELG-IPFVEASAKNDDNVNEIFFTLAKLIQEKIDSNQIA 189

Query: 559 FEDDFNDA-INIQLEGESNSCS 621
              +  D+ INI   G S S S
Sbjct: 190 TGGNAKDSNININSSGGSGSKS 211

>NCAS0J00630 Chr10 complement(95335..95991) [657 bp, 218 aa] {ON}
           Anc_8.70
          Length = 218

 Score =  137 bits (345), Expect = 7e-40
 Identities = 75/201 (37%), Positives = 127/201 (63%), Gaps = 1/201 (0%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +++K++++GDSGVGK+ L+ R+V +K++  +  TIG DF  K + +   K+  +Q+WDTA
Sbjct: 25  SVMKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQGRKI-KLQLWDTA 83

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F+NI+ W      HAN    E    +++GN
Sbjct: 84  GQERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTVNEHAN----EQVQLLLVGN 139

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D+    + V+++ G+ELA+ LG +P    SAK+  NV+  F ++AK   ++  ND   
Sbjct: 140 KSDL--GNRQVTKEQGEELARELG-LPFMEASAKNDDNVNDLFLQLAKLIQEKIDNDEMG 196

Query: 559 FEDDFNDAINIQ-LEGESNSC 618
                   +NI+  +G+++SC
Sbjct: 197 EPRTAKKNVNIKSKDGKTSSC 217

>NCAS0C04020 Chr3 (817944..818576) [633 bp, 210 aa] {ON} Anc_1.215
           YKR055W
          Length = 210

 Score =  137 bits (344), Expect = 8e-40
 Identities = 79/203 (38%), Positives = 125/203 (61%), Gaps = 3/203 (1%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 15  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 73

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++GN
Sbjct: 74  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHAN----DEAQLLLVGN 129

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK---SALQQNQND 549
           K D++   +VV+ + G+ LAK LG +P   +SAK+  NV+  F  +AK     +  N+  
Sbjct: 130 KSDMD--TRVVTYEQGESLAKELG-LPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLA 186

Query: 550 AHAFEDDFNDAINIQLEGESNSC 618
                 D N +IN +  G  ++C
Sbjct: 187 GPGNGKDANISINAKDGGSKSNC 209

>Suva_10.359 Chr10 complement(629445..630092) [648 bp, 215 aa] {ON}
           YLR262C (REAL)
          Length = 215

 Score =  137 bits (344), Expect = 9e-40
 Identities = 78/209 (37%), Positives = 122/209 (58%), Gaps = 10/209 (4%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E+    I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEENVILCIVGNKSD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D +++ +E+ G++ AK LG      TS K+  NV   F++IAKS  +   ++A   + 
Sbjct: 128 LSDERQISTEE-GEKKAKLLGAKIFMETSTKAGYNVKNLFKKIAKSLPEFQNSEATPLDG 186

Query: 568 DFNDA----------INIQLEGESNSCSC 624
           +  ++          I+   E E + C C
Sbjct: 187 ENANSGNQNKPGVIDISTTDEQEKSGCQC 215

>Ecym_1518 Chr1 (1069582..1070196) [615 bp, 204 aa] {ON} similar to
           Ashbya gossypii ABR220W
          Length = 204

 Score =  136 bits (343), Expect = 9e-40
 Identities = 80/205 (39%), Positives = 124/205 (60%), Gaps = 6/205 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRGA   ++VYDVT+ +SF N+K+W  E   +      +    +++GNK
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRYGTAGVVK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA---KSALQQNQNDA 552
            D++D KKVV  +  +E A SL  +P+  TSA  + NV+ AF  +A   K  +   Q D 
Sbjct: 123 NDLKD-KKVVDFEVAKEFADSL-SIPVLETSALDSSNVEEAFLTMARQIKETMSHQQKDT 180

Query: 553 HAFEDDFNDAINIQ---LEGESNSC 618
              +D     +N++   L G S+ C
Sbjct: 181 GKKDD--KSGVNLKGQSLTGSSSGC 203

>KLLA0E12079g Chr5 (1075299..1075943) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 214

 Score =  136 bits (343), Expect = 1e-39
 Identities = 81/201 (40%), Positives = 121/201 (60%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +++K+++LGDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++  K V +Q+WDTA
Sbjct: 19  SVMKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDING-KRVKLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   VL+YDVT+ ++FENI+ W      HA+    E    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTVNQHAS----EDVVMLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   + VS + G+ LAK LG +P    SAK   NV   F  +AK  L Q + D   
Sbjct: 134 KKDMD--TRTVSYEQGEALAKELG-IPFIEASAKDDTNVSEIFFTLAK--LIQEKIDDGK 188

Query: 559 FEDDFNDAINIQLEGESNSCS 621
            E       N+ + G  +S S
Sbjct: 189 MEGKAEKEGNVSIRGSGSSGS 209

>ZYRO0F03872g Chr6 (329213..329866) [654 bp, 217 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 217

 Score =  136 bits (343), Expect = 1e-39
 Identities = 77/201 (38%), Positives = 124/201 (61%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V ++  K+  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVDINGKKI-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NI+ W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIRQWFKTVNEHAN----DDAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   + V+ + G+ LAK LG +P   +SAK+  NV+  F  +AK   ++  ND  A
Sbjct: 134 KSDMD--TRTVTYEQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAKLIQEKIDNDKLA 190

Query: 559 FEDDFNDAINIQLEGESNSCS 621
                    NI +   +N+ S
Sbjct: 191 GGSGAGKEGNININSGNNASS 211

>KAFR0B01660 Chr2 complement(318959..319579) [621 bp, 206 aa] {ON}
           Anc_8.70 YFL005W
          Length = 206

 Score =  136 bits (342), Expect = 1e-39
 Identities = 82/203 (40%), Positives = 130/203 (64%), Gaps = 2/203 (0%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 10  SIMKILLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 68

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 69  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNDHAN----DDAQLLLVGN 124

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   ++V+ + G+ LAK LG +P   +SAK   NV+  F  +A+  L Q++ D++ 
Sbjct: 125 KSDMD--TRLVTYEQGEALAKELG-LPFVESSAKDDQNVNEIFFTLAR--LIQDKIDSNK 179

Query: 559 FED--DFNDAINIQLEGESNSCS 621
             D  + ND  N+ ++  S+S S
Sbjct: 180 LSDAKNTNDG-NVNIKSSSSSMS 201

>Kwal_56.22555 s56 complement(178575..179213) [639 bp, 212 aa] {ON}
           YLR262C (YPT6) - highly homologous to the human GTPase,
           Rab6 [contig 185] FULL
          Length = 212

 Score =  136 bits (342), Expect = 2e-39
 Identities = 80/204 (39%), Positives = 119/204 (58%), Gaps = 5/204 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYDVTN KSFE I  W ++     +    E+    I+GNK D
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDV---KSERGEENVVLCIVGNKND 129

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++V +E+ G+  A+ L       TS K+  NV   F +IAK+  +  + D     +
Sbjct: 130 LSDERQVSTEE-GERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKTLPEFQKADEDPLGE 188

Query: 568 DFN---DAINIQL--EGESNSCSC 624
                 D I+I    E E +SC C
Sbjct: 189 QAKNKPDVIDITTASEQEQSSCQC 212

>KLLA0F20471g Chr6 (1901749..1902387) [639 bp, 212 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 212

 Score =  136 bits (342), Expect = 2e-39
 Identities = 81/205 (39%), Positives = 123/205 (60%), Gaps = 8/205 (3%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 13  KIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 71

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYDVTN KSFE I  W ++  +       E+   VI+GNK D
Sbjct: 72  RFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKME---RGEENVILVIVGNKSD 128

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIAKSALQQNQNDAHAFE 564
           + + ++V +E+   E   ++ +  LF+ TS K+  NV T F++IAK   +     +   +
Sbjct: 129 LVEERQVSTEEG--ERKSTVLNAKLFIETSTKAGFNVKTLFKKIAKLLPEFQDAQSTPLD 186

Query: 565 DDFND----AINIQLEGE---SNSC 618
           +D ND     IN+    E   SN C
Sbjct: 187 NDTNDKKPGVINLAAPDESQQSNGC 211

>Kpol_1042.2 s1042 complement(4659..5303) [645 bp, 214 aa] {ON}
           complement(4659..5303) [645 nt, 215 aa]
          Length = 214

 Score =  135 bits (341), Expect = 2e-39
 Identities = 79/209 (37%), Positives = 122/209 (58%), Gaps = 10/209 (4%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSF+ I  W ++     N    ++    ++GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIVVYDITKKKSFDCIDKWIEDV---KNERGEDNVILCVVGNKSD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++V +E  G++ AK LG      TS K+  NV   F++IAKS L + QN      D
Sbjct: 128 LTDERQVSTED-GEKKAKELGAKIFMETSTKAGYNVKNLFKKIAKS-LPEFQNSESTPLD 185

Query: 568 DFNDAINIQLEG----------ESNSCSC 624
           +  ++ N +  G          + +SC C
Sbjct: 186 ETENSDNTKKTGIIDITTNDELQQSSCQC 214

>Kwal_14.1116 s14 complement(202534..203148) [615 bp, 204 aa] {ON}
           YFL038C (YPT1) - Ras-like GTP-binding protein; most
           similar to mammalian Rab1A protein [contig 244] FULL
          Length = 204

 Score =  135 bits (340), Expect = 3e-39
 Identities = 78/200 (39%), Positives = 123/200 (61%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRGA   ++VYDVT+  SF ++K W  E   +A     +    +++GNK
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEIDRYATAGVLK----LMVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAF 561
            D++D K++V     +E A SL  +P   TSA  + NV+ AF  +AK  ++++    H  
Sbjct: 123 SDLQD-KRMVEYDVAKEFADSL-QIPFLETSALDSSNVEEAFLTMAKQ-IKESMAQQHRD 179

Query: 562 EDDFNDAINIQLEGESNSCS 621
               +D  N+ L+G+S S S
Sbjct: 180 TGKKDDKANVNLKGQSLSNS 199

>SAKL0B01012g Chr2 complement(92466..93080) [615 bp, 204 aa] {ON}
           highly similar to uniprot|P01123 Saccharomyces
           cerevisiae YFL038C YPT1 Ras-like small GTPase involved
           in the ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  135 bits (340), Expect = 3e-39
 Identities = 81/205 (39%), Positives = 125/205 (60%), Gaps = 6/205 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDLDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRGA   ++VYDVT+ +SF N+K+W  E   +      +    +++GNK
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRYGTAGVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA---KSALQQNQNDA 552
            D+ D KKVV  +  +E A SL  +P+  TSA  + NV+ AF  +A   K ++ Q Q D 
Sbjct: 123 NDLTD-KKVVEYEVAKEFADSL-QIPVLETSALDSSNVEEAFLTMARQIKESMSQQQRDN 180

Query: 553 HAFEDDFNDAINIQ---LEGESNSC 618
              E+     +N++   L G S+ C
Sbjct: 181 GKKEE--KAGVNLKGQSLTGTSSGC 203

>KAFR0A05260 Chr1 complement(1040753..1041460) [708 bp, 235 aa] {ON}
           Anc_6.49 YLR262C
          Length = 235

 Score =  136 bits (342), Expect = 3e-39
 Identities = 74/166 (44%), Positives = 105/166 (63%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 24  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 82

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W D+     N    E+    I+GNK D
Sbjct: 83  RFRSLIPSYIRDSKVAIVVYDITKKKSFEFIDKWVDDV---KNERGEENVVLCIVGNKND 139

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKS 525
           + D ++V +E+ G+  AK LG      TS K+  NV   F+ IAKS
Sbjct: 140 LGDERQVSTEE-GEAKAKKLGAKIFMETSTKAGYNVKNLFKRIAKS 184

>KLTH0G18788g Chr7 (1624218..1624832) [615 bp, 204 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038C YPT1 Ras-like small GTPase involved in the
           ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  135 bits (339), Expect = 4e-39
 Identities = 77/198 (38%), Positives = 122/198 (61%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRGA   ++VYDVT+  SF ++K W  E   +A     +    +++GNK
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEIDRYATAGVLK----LMVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAF 561
            D++D K++V     +E A SL  +P   TSA  + NV+ AF  +AK  ++++    H  
Sbjct: 123 SDLQD-KRMVEYDVAKEFADSL-QIPFLETSALDSSNVEEAFLTMAKQ-IKESMAQQHKD 179

Query: 562 EDDFNDAINIQLEGESNS 615
               +D  N+ L+G+S S
Sbjct: 180 TGKKDDKANVNLKGQSLS 197

>ABR220W Chr2 (817292..817906) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL038C (YPT1)
          Length = 204

 Score =  135 bits (339), Expect = 4e-39
 Identities = 75/196 (38%), Positives = 124/196 (63%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRGA   ++VYDVT+ +SF+N+K+W  E   +      +    +++GNK
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEIDRYGTAGVVK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAF 561
            D++D KKVV  +  +E A SL ++P+  TSA  + NV+ AF  +A+  +++  +     
Sbjct: 123 NDLKD-KKVVDFEVAREFADSL-NIPVLETSALDSSNVEEAFLTMARQ-IKETMSHQQKE 179

Query: 562 EDDFNDAINIQLEGES 609
               +D   + L+G+S
Sbjct: 180 SGKKDDKSGVNLKGQS 195

>KNAG0E02720 Chr5 (541478..542173) [696 bp, 231 aa] {ON} 
          Length = 231

 Score =  135 bits (341), Expect = 4e-39
 Identities = 73/181 (40%), Positives = 111/181 (61%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD   +  Q+WDTAGQE
Sbjct: 18  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDH-TIRFQLWDTAGQE 76

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N  S ++  F I+GNK D
Sbjct: 77  RFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWVEDV---KNERSADNVIFCIVGNKSD 133

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++V +E+ G++  K LG      TS K+  NV   F++IAKS  +    D +  + 
Sbjct: 134 LTDERQVSTEE-GEQKTKVLGAQIFMETSTKAGYNVKNLFKKIAKSLPEFQDTDTNTLDS 192

Query: 568 D 570
           +
Sbjct: 193 N 193

>TBLA0E03190 Chr5 complement(803935..804558) [624 bp, 207 aa] {ON}
           Anc_6.49 YLR262C
          Length = 207

 Score =  135 bits (339), Expect = 4e-39
 Identities = 73/181 (40%), Positives = 111/181 (61%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D + + Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 10  KIVFLGEQGVGKTSLITRFMYDTFDEHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 68

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W  +     N    +     I+GNK D
Sbjct: 69  RFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIQDV---KNERGDDGVILCIVGNKSD 125

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++V +E+ G+  AK LG      TS K+  NV   F++IAKS  +    + +  E+
Sbjct: 126 LSDQRQVSNEE-GENKAKLLGADIFMETSTKAGYNVKNLFKKIAKSLPEFENTEGNPLEN 184

Query: 568 D 570
           +
Sbjct: 185 E 185

>CAGL0F02123g Chr6 (212117..212764) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005w SEC4
          Length = 215

 Score =  135 bits (339), Expect = 5e-39
 Identities = 80/205 (39%), Positives = 127/205 (61%), Gaps = 3/205 (1%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK---SALQQNQND 549
           K D++   +VV+ + G+ LAK LG +P   +SAK+  NV+  F  +A+     +  N+  
Sbjct: 134 KSDMD--TRVVTYEQGEALAKELG-LPFIESSAKNDDNVNEIFFTLARLIQEKIDSNKLS 190

Query: 550 AHAFEDDFNDAINIQLEGESNSCSC 624
                 D N +IN   +G+S+  +C
Sbjct: 191 GPNSGKDGNISINAN-KGDSSKSNC 214

>TDEL0G04210 Chr7 (764766..765434) [669 bp, 222 aa] {ON} Anc_6.49
           YLR262C
          Length = 222

 Score =  135 bits (339), Expect = 6e-39
 Identities = 77/177 (43%), Positives = 111/177 (62%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E+    I+GNK D
Sbjct: 73  RFRSLIPSYIRDSRVAIVVYDITKKKSFEFIDKWIEDV---KNERGEENVILCIVGNKSD 129

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           + D ++V +E+ G+  AK LG      TS K+  NV   F++IAKS L + Q   HA
Sbjct: 130 LADERQVSTEE-GEAKAKLLGAKIFMETSTKAGHNVKNLFKKIAKS-LPEFQEGQHA 184

>AGR257C Chr7 complement(1225880..1226542) [663 bp, 220 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR262C
           (YPT6)
          Length = 220

 Score =  134 bits (338), Expect = 8e-39
 Identities = 73/165 (44%), Positives = 103/165 (62%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K V LDD + + +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYLDD-RTIRLQLWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+TN KSFE I  W ++     N    E+    I+GNK D
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDV---RNERGEENLILCIVGNKSD 129

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           + D +KV  E+ G+  AK L       TS K+  NV   F+ IAK
Sbjct: 130 LVDERKVTVEE-GENKAKLLNAKIFVETSTKAGFNVGALFKRIAK 173

>YFL005W Chr6 (130334..130981) [648 bp, 215 aa] {ON}  SEC4Rab family
           GTPase essential for vesicle-mediated exocytic secretion
           and autophagy; associates with the exocyst component
           Sec15p and may regulate polarized delivery of transport
           vesicles to the exocyst at the plasma membrane
          Length = 215

 Score =  134 bits (337), Expect = 1e-38
 Identities = 74/168 (44%), Positives = 111/168 (66%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           K D+E   +VV+   G+ LAK LG +P   +SAK+  NV+  F  +AK
Sbjct: 134 KSDME--TRVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038c YPT1
          Length = 206

 Score =  134 bits (336), Expect = 1e-38
 Identities = 77/200 (38%), Positives = 124/200 (62%), Gaps = 4/200 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D+ D K+VV     +E A++   +P   TSA  + NV+ AF     +I +S  QQN N+
Sbjct: 123 CDLAD-KRVVEYDVAKEFAEA-NKMPFLETSALDSTNVEEAFLTMARQIKESMTQQNMNE 180

Query: 550 AHAFEDDFNDAINIQLEGES 609
           +   +   ND  N+ L+G+S
Sbjct: 181 S---QQKKNDKGNVNLKGQS 197

>SAKL0E02090g Chr5 complement(160194..160838) [645 bp, 214 aa] {ON}
           highly similar to uniprot|Q99260 Saccharomyces
           cerevisiae YLR262C YPT6 Ras-like GTP binding protein
           involved in the secretory pathway, required for fusion
           of endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 214

 Score =  133 bits (335), Expect = 2e-38
 Identities = 75/177 (42%), Positives = 113/177 (63%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYDVTN KSFE I  W ++     +    E+    I+GNK D
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDV---KSERGEENVILCIVGNKND 129

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           + D ++V +E+ G+  A+ L       TS K+  NV   F++IAKS L + QN +++
Sbjct: 130 LVDERQVSTEE-GERKAQVLNAKIFMETSTKAGFNVKNLFKKIAKS-LPEFQNSSYS 184

>Smik_6.73 Chr6 (143556..144203) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  133 bits (334), Expect = 3e-38
 Identities = 73/168 (43%), Positives = 111/168 (66%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           K D++   +VV+   G+ LAK LG +P   +SAK+  NV+  F  +AK
Sbjct: 134 KSDMD--TRVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  132 bits (331), Expect = 6e-38
 Identities = 77/200 (38%), Positives = 123/200 (61%), Gaps = 4/200 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D++D K+VV     +E A +   +P   TSA  + NV+ AF     +I +S  QQN N+
Sbjct: 123 CDLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 550 AHAFEDDFNDAINIQLEGES 609
               +DD     N+ L+G+S
Sbjct: 181 TTQKKDDKG---NVNLKGQS 197

>KNAG0G00930 Chr7 (183672..184313) [642 bp, 213 aa] {ON} Anc_8.70
           YFL005W
          Length = 213

 Score =  132 bits (331), Expect = 7e-38
 Identities = 78/201 (38%), Positives = 121/201 (60%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V D+++  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 17  SIMKILLVGDSGVGKSCLLVRFVEDRFNPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 75

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NI+ W      HAN    +    +++GN
Sbjct: 76  GQERFRTITTAYYRGAMGIILVYDVTDERTFNNIRQWFTTVTEHAN----DDAQLLLVGN 131

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   +VVS + G+ LA  LG +P   +SAK   NV+  F  + K  L Q++ DA+ 
Sbjct: 132 KSDMD--TRVVSREQGETLAAELG-LPFVESSAKDDDNVNEIFFTLTK--LIQDKIDANT 186

Query: 559 FEDDFNDAINIQLEGESNSCS 621
                    NI +   S   S
Sbjct: 187 VSTGNGKGGNININSSSAKSS 207

>TDEL0C00980 Chr3 (164219..164866) [648 bp, 215 aa] {ON} Anc_8.70
           YFL005W
          Length = 215

 Score =  132 bits (331), Expect = 8e-38
 Identities = 76/199 (38%), Positives = 122/199 (61%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V ++  K   +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVDINGKKT-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NI+ W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIRQWFKTVNEHAN----DDAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           K D++   + V+ + G+ LAK LG +P   +SAK+  NV+  F  +A+   ++  ND  A
Sbjct: 134 KSDMD--TRTVTYEQGETLAKELG-IPFVESSAKNDDNVNEIFFTLARLIQEKIDNDKLA 190

Query: 559 FEDDFNDAINIQLEGESNS 615
              +     NI +   S S
Sbjct: 191 GGANSGREGNININSGSGS 209

>Suva_6.54 Chr6 (102191..102838) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  132 bits (331), Expect = 8e-38
 Identities = 72/168 (42%), Positives = 111/168 (66%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           K D++   +VV+   G+ LAK LG +P   +SAK+  NV+  F  +A+
Sbjct: 134 KSDMD--TRVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAR 178

>TDEL0C00490 Chr3 complement(75792..76418) [627 bp, 208 aa] {ON}
           Anc_8.25 YFL038C
          Length = 208

 Score =  131 bits (330), Expect = 9e-38
 Identities = 78/200 (39%), Positives = 123/200 (61%), Gaps = 4/200 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK----SALQQNQND 549
            D+ED K+VV     +E A++   +P   TSA  + NV+ AF  +AK    S  QQ+  D
Sbjct: 123 CDLED-KRVVEYDVAREFAEA-NKMPFLETSALDSTNVEQAFLTMAKQIKDSMAQQHARD 180

Query: 550 AHAFEDDFNDAINIQLEGES 609
             +   D  D  N+ L+G+S
Sbjct: 181 GGSNAKD--DQGNVNLKGQS 198

>Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON}
           complement(39597..40220) [624 nt, 208 aa]
          Length = 207

 Score =  131 bits (329), Expect = 1e-37
 Identities = 75/204 (36%), Positives = 124/204 (60%), Gaps = 4/204 (1%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVQLDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYD+T+ +SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDITDQESFNGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D+ D K+VV     +E A++   +P   TSA  + NV+ AF     +I +S  QQ Q D
Sbjct: 123 CDLND-KRVVEYDVAKEFAEA-NKMPFLETSALDSTNVEEAFLTMARQIKESISQQQQID 180

Query: 550 AHAFEDDFNDAINIQLEGESNSCS 621
               +DD    +N++ +  +N+ S
Sbjct: 181 DKMGKDDKGGNVNLKGQSLTNTSS 204

>NDAI0G03050 Chr7 complement(711396..712028) [633 bp, 210 aa] {ON}
           Anc_8.25
          Length = 210

 Score =  131 bits (329), Expect = 1e-37
 Identities = 76/198 (38%), Positives = 120/198 (60%), Gaps = 4/198 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+  SF+ +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQDSFDGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D+ED K+VV     +E A S   +P   TSA ++ NV+ AF     +I +S  QQ   D
Sbjct: 123 CDLED-KRVVEYDVAKEFADS-NKMPFLETSALNSTNVEEAFLTMARQIKESMNQQKMED 180

Query: 550 AHAFEDDFNDAINIQLEG 603
           ++A     +   N+ L G
Sbjct: 181 SNAASKGGDKNSNVNLTG 198

>KAFR0C03580 Chr3 (733658..734296) [639 bp, 212 aa] {ON} Anc_8.25
           YFL038C
          Length = 212

 Score =  130 bits (328), Expect = 2e-37
 Identities = 76/204 (37%), Positives = 123/204 (60%), Gaps = 8/204 (3%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K + LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTIELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSAVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF--------EEIAKSALQQ 537
            D+ D K++V     +E A+S  ++P   TSA  + NV+ AF        E  A+  +Q 
Sbjct: 123 CDL-DGKRMVEYDVAKEFAES-NNMPFLETSALDSTNVEEAFLTMARQIKESFAQQKIQD 180

Query: 538 NQNDAHAFEDDFNDAINIQLEGES 609
             N A+A  +  ND  N+ L G+S
Sbjct: 181 GSN-ANANSNLQNDKSNVNLNGQS 203

>Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  130 bits (327), Expect = 2e-37
 Identities = 76/200 (38%), Positives = 123/200 (61%), Gaps = 4/200 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D++D K+VV     +E A +   +P   TSA  + NV+ AF     +I +S  QQN N+
Sbjct: 123 CDLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 550 AHAFEDDFNDAINIQLEGES 609
               ++D     N+ L+G+S
Sbjct: 181 TTQKKEDKG---NVNLKGQS 197

>Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  130 bits (327), Expect = 2e-37
 Identities = 76/200 (38%), Positives = 123/200 (61%), Gaps = 4/200 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D++D K+VV     +E A +   +P   TSA  + NV+ AF     +I +S  QQN N+
Sbjct: 123 CDLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 550 AHAFEDDFNDAINIQLEGES 609
               ++D     N+ L+G+S
Sbjct: 181 TTQKKEDKG---NVNLKGQS 197

>YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}
           YPT1Rab family GTPase, involved in the ER-to-Golgi step
           of the secretory pathway; complex formation with the Rab
           escort protein Mrs6p is required for prenylation of
           Ypt1p by protein geranylgeranyltransferase type II
           (Bet2p-Bet4p)
          Length = 206

 Score =  130 bits (327), Expect = 2e-37
 Identities = 76/200 (38%), Positives = 123/200 (61%), Gaps = 4/200 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D++D K+VV     +E A +   +P   TSA  + NV+ AF     +I +S  QQN N+
Sbjct: 123 CDLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 550 AHAFEDDFNDAINIQLEGES 609
               ++D     N+ L+G+S
Sbjct: 181 TTQKKEDKG---NVNLKGQS 197

>NDAI0I02380 Chr9 complement(542975..543643) [669 bp, 222 aa] {ON} 
          Length = 222

 Score =  130 bits (328), Expect = 3e-37
 Identities = 74/173 (42%), Positives = 109/173 (63%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + LDD K + +Q+WDTAGQE
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-KTIRLQLWDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYD+T  +SF+ I  W ++     N    ++    I+GNK D
Sbjct: 71  RFRSLIPSYIRDSRVAIVVYDITKKESFDFIDKWINDV---KNERGEDNVILCIVGNKND 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQN 546
           + D ++V  E+ G+  AK LG      TS K+  NV T F+ IAKS L + QN
Sbjct: 128 LTDQRQVSIEE-GENKAKQLGANIFMETSTKAGYNVKTLFKRIAKS-LPEFQN 178

>TBLA0C00450 Chr3 complement(84352..84984) [633 bp, 210 aa] {ON}
           Anc_8.25 YFL038C
          Length = 210

 Score =  130 bits (327), Expect = 3e-37
 Identities = 75/201 (37%), Positives = 124/201 (61%), Gaps = 5/201 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D YS  Y +TIG DF  K + +D  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYSNDYISTIGVDFKIKTIEIDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+  SF ++K W  E   +A  S  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQDSFNSVKMWLQEIDRYATSSVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA---KSALQQNQNDA 552
            D++D K++V     +E A++  ++P   TSA  + NV+ AF  +A   K +L Q Q D 
Sbjct: 123 SDLKD-KRIVEYDVAKEFAET-NNMPFLETSALDSTNVEEAFLTMAKQIKESLSQQQKDE 180

Query: 553 HAFE--DDFNDAINIQLEGES 609
                 +  N + N+ L+G+S
Sbjct: 181 RGGNGGNGGNGSDNVNLKGQS 201

>Skud_6.66 Chr6 (132521..133168) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  130 bits (327), Expect = 3e-37
 Identities = 72/168 (42%), Positives = 110/168 (65%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++  KV  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKV-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HA     +    +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAT----DEAQLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           K D++   +VV+   G+ LAK LG +P   +SAK+  NV+  F  +AK
Sbjct: 134 KSDMD--TRVVTVDQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>TBLA0D02650 Chr4 (655924..656577) [654 bp, 217 aa] {ON} Anc_8.70
           YFL005W
          Length = 217

 Score =  130 bits (327), Expect = 3e-37
 Identities = 78/208 (37%), Positives = 124/208 (59%), Gaps = 6/208 (2%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           +I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K + ++  K+  +Q+WDTA
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTIDINGKKI-KLQLWDTA 77

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQERF+++  A+YRGA   +LVYDVT+  +FENI++W      HAN  +      +++GN
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDENTFENIRTWFKTVNEHANGEA----QLLLVGN 133

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK------SALQQN 540
           K D+E   + V+ + G+ LAK LG +P   +SAK   NV+  F  +         + +  
Sbjct: 134 KSDME--TRTVTYEQGESLAKELG-IPFIESSAKDDKNVNEIFFTLTNLIQEKIDSNKMT 190

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           +  A   +D+ N  IN    G S S  C
Sbjct: 191 ETPAAGKKDNVN--INSSNGGSSKSNCC 216

>Ecym_3137 Chr3 (254058..254723) [666 bp, 221 aa] {ON} similar to
           Ashbya gossypii AGR257C
          Length = 221

 Score =  130 bits (327), Expect = 4e-37
 Identities = 80/213 (37%), Positives = 116/213 (54%), Gaps = 14/213 (6%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K V LDD + + +Q+WDTAGQE
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYLDD-RNIRLQLWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           RF+SL  ++ R +   ++VYDVTN +SFE I  W ++          E+    I+GNK D
Sbjct: 73  RFRSLIPSYIRDSHVAIVVYDVTNKRSFEYIDKWVEDVKTE---RGEENLILCIVGNKND 129

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK-----------SALQ 534
           + D +  VS K G+  A+ L       TS K+  NV   F+ IAK           S + 
Sbjct: 130 LVDERS-VSTKEGEMKAQLLNAKIFMETSTKAGFNVKQLFKSIAKLLPEFQNTKVSSGVL 188

Query: 535 QNQNDAHAFEDDFNDAINIQLE---GESNSCSC 624
             +++ H    D    I+I      G  +SC C
Sbjct: 189 DGESEKHNNGGDKPGVIDISTPATGGNESSCQC 221

>ZYRO0F02816g Chr6 complement(237904..238533) [630 bp, 209 aa] {ON}
           highly similar to uniprot|P01123 Saccharomyces
           cerevisiae YFL038C YPT1 Ras-like small GTPase involved
           in the ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 209

 Score =  129 bits (324), Expect = 7e-37
 Identities = 76/200 (38%), Positives = 122/200 (61%), Gaps = 4/200 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVDLDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D++D K+VV     +E A +   +P   TSA  + NV+ AF     +I  S  QQ ++D
Sbjct: 123 CDLKD-KRVVEYDVAKEFADA-NKMPFIETSALDSTNVEEAFLTMARQIKDSMAQQQRHD 180

Query: 550 AHAFEDDFNDAINIQLEGES 609
             A     N+  N+ L+G+S
Sbjct: 181 GGAANGQ-NENGNVNLKGQS 199

>TPHA0D00270 Chr4 complement(37369..37992) [624 bp, 207 aa] {ON}
           Anc_8.25 YFL038C
          Length = 207

 Score =  128 bits (322), Expect = 1e-36
 Identities = 76/206 (36%), Positives = 124/206 (60%), Gaps = 7/206 (3%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+ +SF ++K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNSVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D+ D K+VV     +E A+    +P   TSA  + NV+ AF     +I +S   Q Q +
Sbjct: 123 SDMTD-KRVVEYDVAKEFAEQ-NKMPFLETSALDSTNVEEAFLTMARQIKESISHQQQIE 180

Query: 550 AHAFEDDFNDAINIQ---LEGESNSC 618
             +  DD +  +N++   L   S+SC
Sbjct: 181 MKSGNDDKSGNVNLKGQSLAASSSSC 206

>KNAG0E03100 Chr5 complement(618438..619076) [639 bp, 212 aa] {ON}
           Anc_8.25 YFL038C
          Length = 212

 Score =  127 bits (319), Expect = 5e-36
 Identities = 77/203 (37%), Positives = 123/203 (60%), Gaps = 7/203 (3%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+  SF+ +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQDSFDGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKS-----ALQQNQN 546
            D+ D K+VV     +E A +  ++P   TSA  + NV+ AF  +A+      A Q+ QN
Sbjct: 123 CDLND-KRVVEYDVAKEFADA-NNMPFLETSALDSTNVEEAFLTMARQIKESMAQQKLQN 180

Query: 547 DAH--AFEDDFNDAINIQLEGES 609
            A+  A  +  N   N+ L G+S
Sbjct: 181 GANGQAGNNQQNANKNVNLNGQS 203

>KAFR0J01850 Chr10 complement(356911..357540) [630 bp, 209 aa] {ON}
           Anc_2.196 YNL093W
          Length = 209

 Score =  126 bits (316), Expect = 1e-35
 Identities = 75/208 (36%), Positives = 124/208 (59%), Gaps = 8/208 (3%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V ++++  +  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINNN-TIKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYD+T  +SF   + W  E    A+    +     ++GNKV
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQAS----KDIIIALVGNKV 122

Query: 385 DI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQ---- 543
           DI   ++S++ V+ + G+ LA+  G +  F TSAK+A NV+  F  I +    +N     
Sbjct: 123 DIIENDESERKVAREEGERLAEEEGLI-FFETSAKTAENVNDVFLNIGEKIPLKNDNSSP 181

Query: 544 NDAHAFEDD-FNDAINIQLEGESNSCSC 624
           ND    ED   N A +     E++SCSC
Sbjct: 182 NDTTITEDQRINLAASANATSEASSCSC 209

>KAFR0A03560 Chr1 (729254..729877) [624 bp, 207 aa] {ON} Anc_1.289
           YKR014C
          Length = 207

 Score =  125 bits (315), Expect = 2e-35
 Identities = 70/206 (33%), Positives = 120/206 (58%), Gaps = 7/206 (3%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD---DKVVTMQVWDTA 198
           K+++LGDS VGK+S+++R+V D +    ++TIGA FL++ + L+D   + +V  ++WDTA
Sbjct: 5   KLVLLGDSSVGKSSIVNRFVKDSFEDLRESTIGAAFLSQTIKLNDNGKEVIVKFEIWDTA 64

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQER++SL   +YR A+  ++VYD+T   S    K+W +E     N    ++    ++GN
Sbjct: 65  GQERYKSLAPMYYRNANAALVVYDITELDSLNKAKTWVEEL---KNKVGDDNIVIYLVGN 121

Query: 379 KVDI---EDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIAKSALQQNQN 546
           K+D+   + SK++VS +  +E AK  G   LF+ TSAK+  N+   F+EI +      + 
Sbjct: 122 KLDVCEKDSSKRLVSLEGAKEYAKEQG--LLFIETSAKTGANIKETFQEIGEKLYDIKKT 179

Query: 547 DAHAFEDDFNDAINIQLEGESNSCSC 624
           + +   D     I I     +++ SC
Sbjct: 180 EVNTDLDGNTGEIEISKPSTNDTTSC 205

>KLLA0D02376g Chr4 (201512..202135) [624 bp, 207 aa] {ON} similar to
           uniprot|P36018 Saccharomyces cerevisiae YKR014C YPT52
           rab5-like GTPase involved in vacuolar protein sorting
           and endocytosis probable purine nucleotide- binding
           protein
          Length = 207

 Score =  125 bits (314), Expect = 2e-35
 Identities = 70/205 (34%), Positives = 118/205 (57%), Gaps = 6/205 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLD---DDKVVTMQVWDTA 198
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L    D++V+  ++WDTA
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDTA 64

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++GN
Sbjct: 65  GQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVGN 121

Query: 379 KVDI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           K+D+    +S  +V E   +E A+   ++     SAK+  NV   F++I +    QN++ 
Sbjct: 122 KLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180

Query: 550 AHAFEDDFNDAINIQLEGESNSCSC 624
               +   N+ I++Q    ++S SC
Sbjct: 181 IQESKKPNNNNISLQRPSTNDSQSC 205

>NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON}
           Anc_8.25
          Length = 211

 Score =  125 bits (313), Expect = 3e-35
 Identities = 76/202 (37%), Positives = 119/202 (58%), Gaps = 6/202 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V LD  K V +Q+WDTAG
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG-KTVKLQIWDTAG 66

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QERF+++  ++YRG+   ++VYDVT+  SF  +K W  E   +A  +  +    +++GNK
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEIDRYATSTVLK----LLVGNK 122

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQND 549
            D+ D K+VV     +E A +   +P   TSA ++ NV+ AF     +I +S  QQ   D
Sbjct: 123 CDLTD-KRVVEYDVAKEFADA-NKMPFLETSALNSTNVEEAFLTMARQIKESMSQQKMED 180

Query: 550 AHAFEDDFN--DAINIQLEGES 609
             A   + N     N+ L G+S
Sbjct: 181 GGANGGNKNPDGGNNVNLAGQS 202

>KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.338
           YBR264C
          Length = 212

 Score =  123 bits (308), Expect = 2e-34
 Identities = 77/210 (36%), Positives = 115/210 (54%), Gaps = 11/210 (5%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           KV++LG S VGK+S++ R V  K+ +   ATIGA F  KEV L+D K V + VWDTAGQE
Sbjct: 12  KVVLLGGSSVGKSSIVTRLVTGKFMKN-SATIGAAFSWKEVFLEDKKAVKLSVWDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           R+++L   +YR  D  ++VYDVTN+ S E  KSW +E   + N          ++GNK+D
Sbjct: 71  RYRALTPMYYRNTDVALIVYDVTNSTSIEGAKSWIEELHNYVNEDRRNKISIWLVGNKID 130

Query: 388 I----EDSKKVVSEKAGQELAKSLGDVP----LFLTSAKSAINVDTAFEEIAKSALQQNQ 543
           +    +DS      +    L   + D+P    L   SAK+   ++  F EI++   ++  
Sbjct: 131 LLPTAQDSDTTYPHE--DVLRGIMHDIPNPNELAYVSAKTGAGIEEMFNEISRQVPEE-- 186

Query: 544 NDAHAFEDDFNDAINIQL---EGESNSCSC 624
               AFE    D+  +QL   +  S+SC+C
Sbjct: 187 ----AFEASNKDSELLQLNTTKNSSHSCNC 212

>NCAS0B06720 Chr2 complement(1278798..1279436) [639 bp, 212 aa] {ON}
           Anc_2.196
          Length = 212

 Score =  122 bits (305), Expect = 6e-34
 Identities = 76/212 (35%), Positives = 124/212 (58%), Gaps = 12/212 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V ++D+  V  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINDN-TVKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++GNKV
Sbjct: 67  ERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQAN----KDMIIALVGNKV 122

Query: 385 DI----EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK------SALQ 534
           D+    ED +KV  E+ G++LA+  G +  F TSAK+ +NV   F  I +      +  Q
Sbjct: 123 DVLENNEDERKVAREE-GEKLAEEEG-LLFFETSAKTGLNVTETFVAIGEKIPLKTAGDQ 180

Query: 535 QNQNDAHAFEDD--FNDAINIQLEGESNSCSC 624
           +  ++  A  D+   + A +    G++  CSC
Sbjct: 181 ETDSNGVAISDEQRIDLANSGNAAGQTAGCSC 212

>TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON}
           Anc_1.289 YKR014C
          Length = 220

 Score =  122 bits (305), Expect = 7e-34
 Identities = 68/200 (34%), Positives = 114/200 (57%), Gaps = 4/200 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LGDS VGK+S+++R+V D + +  ++TIGA FL++ + L +  V+  ++WDTAGQE
Sbjct: 5   KLVLLGDSSVGKSSIVNRFVKDSFDELRESTIGAAFLSQTITLKNKTVIKFEIWDTAGQE 64

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           R++SL   +YR A+  ++VYD+T   S    +SW DE     +    E+    ++GNK+D
Sbjct: 65  RYKSLAPMYYRNANAALVVYDITENDSLMKAQSWVDEL---KSKVGDENLVICLVGNKID 121

Query: 388 I---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN-QNDAH 555
           +   ++SK+VV  K  ++ A    ++  +  SAKS  NV   F+ I +   +     D  
Sbjct: 122 LCDEDESKRVVLTKDAKDYADE-QNLMFYEVSAKSGENVKEVFQVIGEKLYEDKILQDKA 180

Query: 556 AFEDDFNDAINIQLEGESNS 615
             E   N  +N    G SN+
Sbjct: 181 NTESQSNSGLNSSNNGGSNN 200

>Smik_14.234 Chr14 (430086..430748) [663 bp, 220 aa] {ON} YNL093W
           (REAL)
          Length = 220

 Score =  121 bits (303), Expect = 1e-33
 Identities = 71/214 (33%), Positives = 120/214 (56%), Gaps = 14/214 (6%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG+S VGK+S++ R+V+D + +  + TIGA FLTK ++ DD KV+  ++WDTAGQ
Sbjct: 13  IKLVLLGESAVGKSSIVLRFVSDDFRESREPTIGAAFLTKRIIRDD-KVIKFEIWDTAGQ 71

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF  L   +YR A   ++V+DVT+  SF   + W  E  +H  +   ++    ++GNK+
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDVTDDGSFHKAQDWIQE--LHEKVG--DNIVIALVGNKI 127

Query: 385 DI-----EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA------KSAL 531
           D+     E+S + V E   Q L K   ++  F  SAK+  N+   F+++       +   
Sbjct: 128 DLLNIQGENSNRAVKEAELQNLCKR-ENLLYFEASAKTGENIHEIFQKLGQKIPYPQKCT 186

Query: 532 QQNQNDAHAFEDDFN---DAINIQLEGESNSCSC 624
           +QN N      DD     +A  ++   E+ +C+C
Sbjct: 187 RQNSNHDLTITDDQRIDLEATTVEGTRETGTCNC 220

>Suva_8.142 Chr8 complement(247554..248183) [630 bp, 209 aa] {ON}
           YOR089C (REAL)
          Length = 209

 Score =  118 bits (296), Expect = 1e-32
 Identities = 71/208 (34%), Positives = 121/208 (58%), Gaps = 8/208 (3%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V +++   V  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEH-TVKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAS----KDIIIALVGNKI 122

Query: 385 DI--EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQN 546
           D+  ED ++ V+ + G++LA+  G +  F TSAK+  NV+  F    E+I     ++  N
Sbjct: 123 DMLQEDGERKVAREEGEKLAEENG-LLFFETSAKTGENVNNVFLGIGEKIPLKNAEEQNN 181

Query: 547 DAHAFEDDFNDAINIQLEGES--NSCSC 624
             +  E +    +N    G S  + CSC
Sbjct: 182 ANNERESNQRVDLNAANNGASANSGCSC 209

>Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON}
           (61782..62417) [636 nt, 212 aa]
          Length = 211

 Score =  118 bits (296), Expect = 1e-32
 Identities = 73/214 (34%), Positives = 119/214 (55%), Gaps = 15/214 (7%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLD-DDKVVTMQVWDTAGQ 204
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + LD DD V+  ++WDTAGQ
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQSIKLDEDDTVIKFEIWDTAGQ 64

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ER++SL   +YR A+  ++VYD+T + S    +SW +E     N  + +     ++GNK+
Sbjct: 65  ERYKSLAPMYYRNANAALVVYDITASDSLSKAQSWVEEL---KNKVADDKLVICLVGNKL 121

Query: 385 DI--EDS-KKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSAL-------- 531
           D+  EDS K+ V     ++ A   G +  F  SAK+   V+  F+ I +S          
Sbjct: 122 DLCQEDSGKRSVEISDAKQYADEQG-LLFFEVSAKTGEKVNDVFKSIGESLYSYKKEELL 180

Query: 532 ---QQNQNDAHAFEDDFNDAINIQLEGESNSCSC 624
              +QN  + H   D     + +Q    S+  SC
Sbjct: 181 SKSEQNGTNTHGQVD-----LQLQKPATSDPTSC 209

>Ecym_6328 Chr6 complement(629586..630203) [618 bp, 205 aa] {ON}
           similar to Ashbya gossypii AAL176C
          Length = 205

 Score =  117 bits (294), Expect = 2e-32
 Identities = 72/204 (35%), Positives = 117/204 (57%), Gaps = 5/204 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLD--DDKVVTMQVWDTAG 201
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L   DD ++  ++WDTAG
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLAEYDDTMIKFEIWDTAG 64

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++SL   +YR A+  ++VYDVT   S    +SW +E     +    +     ++GNK
Sbjct: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL---KSKVGDDDLVICLVGNK 121

Query: 382 VDI--EDSK-KVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDA 552
           VD+  EDSK KV+ E   ++ A+  G +     SAKS   V   F+ I +  L   + D+
Sbjct: 122 VDLAEEDSKSKVIDEDDAKDYAEQHGLI-FHEVSAKSGRGVIEVFQNIGE-RLYLQRKDS 179

Query: 553 HAFEDDFNDAINIQLEGESNSCSC 624
            A +      I +Q    +++ SC
Sbjct: 180 LAAQSQQPSNIQLQRPTTNDATSC 203

>TPHA0I02780 Chr9 complement(614605..615231) [627 bp, 208 aa] {ON}
           Anc_1.289 YKR014C
          Length = 208

 Score =  117 bits (294), Expect = 2e-32
 Identities = 69/207 (33%), Positives = 121/207 (58%), Gaps = 8/207 (3%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDD-KVVTMQVWDTAGQ 204
           K+++LGDS VGK+S+++R+V D + +  ++TIGA FL++ + L+++ +V+  ++WDTAGQ
Sbjct: 5   KLVLLGDSSVGKSSIVYRFVKDSFDEFRESTIGAAFLSQTITLEENNQVIKFEIWDTAGQ 64

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ER++SL   +YR A+  ++VYDVT   S    KSW +E          E     ++GNKV
Sbjct: 65  ERYKSLAPMYYRNANAALVVYDVTAPDSLMKAKSWIEELKKKV---GNEELVICLVGNKV 121

Query: 385 DI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDA- 552
           DI   +D+K+ +  +  ++ A    ++  +  SAK+  NV   F++I +   +  + +  
Sbjct: 122 DICEEDDTKRKIEFEEAKDWAND-ENLLFYEVSAKTGYNVKEVFQKIGEQLYEYKKAEQA 180

Query: 553 -HAFEDDFNDAINIQLE--GESNSCSC 624
               +D+ N   NI+L+    SN  SC
Sbjct: 181 NKGTQDNSNITSNIRLQEPQASNPTSC 207

>Smik_15.269 Chr15 complement(451402..452034) [633 bp, 210 aa] {ON}
           YOR089C (REAL)
          Length = 210

 Score =  117 bits (294), Expect = 2e-32
 Identities = 68/209 (32%), Positives = 123/209 (58%), Gaps = 9/209 (4%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V +++   V  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEH-TVKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAS----KDIIIALVGNKI 122

Query: 385 DI--EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSA---LQQNQND 549
           D+  E  ++ V+ + G++LA+  G +  F TSAK+  NV+  F  I +      ++ QN+
Sbjct: 123 DMLQEGGERKVAREEGEKLAEEKG-LLFFETSAKTGENVNDVFLGIGEKVPLKKEEEQNN 181

Query: 550 AHAFEDDFNDAINIQL----EGESNSCSC 624
           A+   +  +  +++         +N+CSC
Sbjct: 182 ANNERESNSKRVDLNAANNGSSTNNACSC 210

>Kpol_1029.16 s1029 (30724..31359) [636 bp, 211 aa] {ON}
           (30724..31359) [636 nt, 212 aa]
          Length = 211

 Score =  117 bits (294), Expect = 2e-32
 Identities = 75/212 (35%), Positives = 120/212 (56%), Gaps = 12/212 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +DD   V  ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIDDH-TVKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDV+  +SF   + W  E    A+          + GNKV
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVSKPQSFIKARHWVKELQERAS----SDIIIALAGNKV 122

Query: 385 DI--EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQN 546
           DI  +  ++ V+ + GQ+LA   G +  F TSAK+  NV+  F    E+I      ++ N
Sbjct: 123 DIVEDGGERKVATEEGQKLADEEG-LLFFETSAKTGQNVNEVFLAIGEKIPIKKPNEHAN 181

Query: 547 DAHAFEDDFNDAINIQLEGESNS------CSC 624
           +A+A  D  ND   + +    N+      C+C
Sbjct: 182 NANA--DGSNDNNRVDITSSDNNAAAVSGCNC 211

>CAGL0G07689g Chr7 complement(729919..730566) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein
          Length = 215

 Score =  117 bits (294), Expect = 3e-32
 Identities = 72/209 (34%), Positives = 118/209 (56%), Gaps = 13/209 (6%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD---DKVVTMQVWDTA 198
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V + D   D V+  ++WDTA
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++GN
Sbjct: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVGN 121

Query: 379 KVDI---EDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEI------AKSA 528
           KVDI   ++S + +  + G E A++     LF   SAK+   V   F+EI       K A
Sbjct: 122 KVDIVEADESARKIETEEGAEYAQA--QKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKA 179

Query: 529 LQQNQNDAHAFEDDFNDAINIQLEGESNS 615
             +N++ +   +   ++ ++IQ +  S +
Sbjct: 180 SLKNKDQSRRTDSVSSNTVDIQTQRPSTN 208

>Skud_15.253 Chr15 complement(446672..447301) [630 bp, 209 aa] {ON}
           YOR089C (REAL)
          Length = 209

 Score =  117 bits (292), Expect = 5e-32
 Identities = 71/208 (34%), Positives = 125/208 (60%), Gaps = 8/208 (3%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V +++   V  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEH-TVKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAS----KDIIIALVGNKI 122

Query: 385 DI--EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA-KSALQQNQNDAH 555
           D+  +  ++ V+++ G++LA+  G +  F TSAK+  NV+  F  I  K  L++ +   +
Sbjct: 123 DVLQDGGERKVAKEEGEKLAEEKG-LLFFETSAKTGENVNNVFLGIGEKIPLKKAEEQNN 181

Query: 556 AFEDDFNDA---INIQLEGES--NSCSC 624
           A E + N+    +N    G S  ++CSC
Sbjct: 182 ANEGESNNQRVDLNAANNGTSANSACSC 209

>YOR089C Chr15 complement(490196..490828) [633 bp, 210 aa] {ON}
           VPS21Rab family GTPase required for endocytic transport
           and for sorting of vacuolar hydrolases; localized in
           endocytic intermediates; detected in mitochondria;
           geranylgeranylation required for membrane association;
           mammalian Rab5 homolog
          Length = 210

 Score =  117 bits (292), Expect = 5e-32
 Identities = 69/209 (33%), Positives = 119/209 (56%), Gaps = 9/209 (4%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V +++   V  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEH-TVKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAS----KDIIIALVGNKI 122

Query: 385 DI--EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKS---ALQQNQND 549
           D+  E  ++ V+ + G++LA+  G +  F TSAK+  NV+  F  I +       + QN 
Sbjct: 123 DMLQEGGERKVAREEGEKLAEEKG-LLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNS 181

Query: 550 AHAFEDDFNDAINIQLEGESNS----CSC 624
           A    +  N  +++    +  S    CSC
Sbjct: 182 ASNERESNNQRVDLNAANDGTSANSACSC 210

>AER434C Chr5 complement(1466442..1467052,1467106..1467154) [660 bp,
           219 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YGL210W (YPT32) and YER031C (YPT31); 1-intron
          Length = 219

 Score =  117 bits (292), Expect = 6e-32
 Identities = 67/180 (37%), Positives = 114/180 (63%), Gaps = 4/180 (2%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  D+++   K+TIG +F T+ + ++  KV   Q+WDTAG
Sbjct: 14  LFKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKA-QIWDTAG 72

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E+    ++GNK
Sbjct: 73  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----ENVAVGLIGNK 128

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIAKSALQ---QNQND 549
            D+   + V +++A +  A+  G+  LF  TSA +A NVD AF E+  +  Q   +NQ D
Sbjct: 129 SDLAHLRAVPTDEA-KNFAQ--GNQMLFTETSALNAENVDLAFRELITAIYQMVSKNQVD 185

>TBLA0B01820 Chr2 complement(415800..416438) [639 bp, 212 aa] {ON}
           Anc_2.196 YNL093W
          Length = 212

 Score =  116 bits (291), Expect = 7e-32
 Identities = 70/211 (33%), Positives = 120/211 (56%), Gaps = 11/211 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + +   +  ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIGNH-TIKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++GNK 
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQAN----KGIIIALVGNKA 122

Query: 385 DI--EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           DI  +  ++ V+ +  ++LA+  G +  F TSAK+  NV+  F  I +    +N + A+ 
Sbjct: 123 DIIEDGEERKVAREEAEKLAEEEG-LLFFETSAKTGNNVNETFLAIGEKIPLKNSSSAND 181

Query: 559 FEDDFNDAINIQLEGESN---------SCSC 624
              D N+  N +++ ++N          CSC
Sbjct: 182 QHHDTNNNNNQRIDLDNNPVDAASNAPGCSC 212

>TPHA0I02590 Chr9 complement(571327..572004) [678 bp, 225 aa] {ON}
           Anc_1.338 YBR264C
          Length = 225

 Score =  116 bits (291), Expect = 9e-32
 Identities = 61/171 (35%), Positives = 102/171 (59%), Gaps = 4/171 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVL----DDDKVVTMQVWD 192
           LK+++LG+S VGK+S++ RYV  K+++   ATIGA F+TKE+       + +VV +++WD
Sbjct: 15  LKLVLLGESSVGKSSVVSRYVTGKFNKT-NATIGAAFITKEIKFVSEEGEHRVVNLEIWD 73

Query: 193 TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVIL 372
           TAGQER++SL   +YR  D  V+V+D+T   S     +W DE L +      E     ++
Sbjct: 74  TAGQERYRSLAPMYYRNTDVAVIVFDLTVPDSAAKALAWVDELLSYVEKERREEIVITVV 133

Query: 373 GNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKS 525
           GNK D+ +    +     Q++A +L   P++  SAK+   ++  F++I +S
Sbjct: 134 GNKNDLIEGDDKIDSAMEQDIA-TLAKRPIWRVSAKTGEGIEELFQDIVRS 183

>TDEL0D01570 Chr4 (310454..311107) [654 bp, 217 aa] {ON} Anc_1.289
           YKR014C
          Length = 217

 Score =  116 bits (290), Expect = 1e-31
 Identities = 65/210 (30%), Positives = 118/210 (56%), Gaps = 14/210 (6%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD-----DKVVTMQVWD 192
           K+++LGDS VGK+S+++R+V + + +  ++TIGA FL++ + + +     + V+  ++WD
Sbjct: 5   KLVLLGDSSVGKSSIVYRFVKNSFDEFRESTIGAAFLSQTIKVKESDDGEETVIKFEIWD 64

Query: 193 TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVIL 372
           TAGQER++SL   +YR A+  ++VYDVT   S    +SW +E     N    +     ++
Sbjct: 65  TAGQERYKSLAPMYYRNANAALVVYDVTQQDSLVKAQSWVNEL---KNKVGDDDLVICLV 121

Query: 373 GNKVDI-----EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ 537
           GNKVD+     ED+K+ V  +  +  A    ++  +  SAK+ +NV   F+ I +   + 
Sbjct: 122 GNKVDLCDEDAEDNKRAVGTEEARSYANE-QNLLFYEVSAKTGLNVQQIFQSIGEKLFET 180

Query: 538 NQNDAHAFED----DFNDAINIQLEGESNS 615
              +  A ++      ND +N+QL+  S +
Sbjct: 181 KSEEIAAAKNRQIGSSNDHVNVQLQRASTN 210

>AAL176C Chr1 complement(31588..32205) [618 bp, 205 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR014C
           (YPT52)
          Length = 205

 Score =  115 bits (288), Expect = 2e-31
 Identities = 67/204 (32%), Positives = 118/204 (57%), Gaps = 5/204 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVL--DDDKVVTMQVWDTAG 201
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L   DD ++  ++WDTAG
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++SL   +YR A+  ++VYDVT   S    +SW +E     +    E     ++GNK
Sbjct: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL---KSKVGDEDLVIFLVGNK 121

Query: 382 VDI--EDSK-KVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDA 552
           +D+  ED K +V+  +  Q  A++ G +     SAK+   +   F+ I    L + + ++
Sbjct: 122 LDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIG-GKLYEQRRES 179

Query: 553 HAFEDDFNDAINIQLEGESNSCSC 624
            A +   + +I +Q    +++ SC
Sbjct: 180 LAAQPQHSSSIQLQRPTTNDATSC 203

>TBLA0C04910 Chr3 complement(1193590..1194285) [696 bp, 231 aa] {ON}
           Anc_3.521 YER031C
          Length = 231

 Score =  115 bits (289), Expect = 2e-31
 Identities = 65/201 (32%), Positives = 121/201 (60%), Gaps = 3/201 (1%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++   S+EN + W  E   +A+ +        ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKPSSYENCQHWLTELRGNADANVAVG----LIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ---QNQNDA 552
            D++  + V +++A +  A+    +    TSA  + NVD AF E+  +  Q   ++Q D 
Sbjct: 128 SDLDHMRAVPTDEA-KNFAQE-NQLLFTETSALQSSNVDQAFRELITAIYQMVSKHQVDM 185

Query: 553 HAFEDDFNDAINIQLEGESNS 615
            A ++D N   N     +SN+
Sbjct: 186 AANDNDPNSNSNNSSNNKSNN 206

>Kwal_14.2394 s14 (738645..739268) [624 bp, 207 aa] {ON} YKR014C
           (YPT52) - probable purine nucleotide-binding protein
           [contig 225] FULL
          Length = 207

 Score =  115 bits (287), Expect = 2e-31
 Identities = 70/206 (33%), Positives = 118/206 (57%), Gaps = 7/206 (3%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLD--DDKVVTMQVWDTAG 201
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L+  +D  +  ++WDTAG
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTAG 64

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++SL   +YR A+  ++VYDVT A S    +SW +E     N    +     ++GNK
Sbjct: 65  QERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGNK 121

Query: 382 VDI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDA 552
           +D+   E+  + V ++  Q  A+  G +     SAK+   V   F+EI ++ + Q +  A
Sbjct: 122 LDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGEN-VYQKKGAA 179

Query: 553 HAFEDDFNDAINIQLEGES--NSCSC 624
            A         N++L+  S  +S SC
Sbjct: 180 TAASPQARKTPNVKLQRPSTNDSTSC 205

>CAGL0J08635g Chr10 complement(856102..856728) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P36017 Saccharomyces
           cerevisiae YOR089c VPS21 GTP-binding protein
          Length = 208

 Score =  115 bits (287), Expect = 2e-31
 Identities = 70/208 (33%), Positives = 118/208 (56%), Gaps = 8/208 (3%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           LK+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +++   V  ++WDTAGQ
Sbjct: 8   LKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTINEH-TVKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQAS----KDIIIALVGNKI 122

Query: 385 DI--EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           D+    +++ VS +  ++LA+   ++  F TSAKS  N+   F  I +    +  N A+ 
Sbjct: 123 DVLENGTERSVSREEAEKLAEE-ENLLFFETSAKSGENITDVFLAIGEKVPLKTANQANV 181

Query: 559 FEDDFNDAINIQLEGESN------SCSC 624
             ++ N+   + L    N      SCSC
Sbjct: 182 -PNNANENQRVDLTSVVNNPAANSSCSC 208

>KLTH0H09768g Chr8 (840625..841314) [690 bp, 229 aa] {ON} similar to
           uniprot|P36018 Saccharomyces cerevisiae YKR014C YPT52
           rab5-like GTPase involved in vacuolar protein sorting
           and endocytosis probable purine nucleotide- binding
           protein
          Length = 229

 Score =  115 bits (288), Expect = 3e-31
 Identities = 70/206 (33%), Positives = 115/206 (55%), Gaps = 7/206 (3%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD--DKVVTMQVWDTAG 201
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L+   D  +  ++WDTAG
Sbjct: 27  KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHPDVTIKFEIWDTAG 86

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++SL   +YR A+  ++VYDVT   S    +SW +E     N    +     + GNK
Sbjct: 87  QERYKSLAPMYYRNANAALIVYDVTQPGSLVKAQSWVEEL---KNKVGDQDLVICLAGNK 143

Query: 382 VDIED---SKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDA 552
           VDI D   + + V  +  Q  A+  G +  + TSAK+   V   F+EI +   Q+   + 
Sbjct: 144 VDICDEDATAREVQREDAQLYAQEQG-LLFYETSAKTGAGVSAIFQEIGERVYQKKGMEV 202

Query: 553 HAFEDDFNDAINIQLEGES--NSCSC 624
            +        +N++L+  S  +S SC
Sbjct: 203 PS-STQARKPLNVELQRPSTNDSTSC 227

>Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W
           (REAL)
          Length = 220

 Score =  115 bits (287), Expect = 3e-31
 Identities = 68/214 (31%), Positives = 116/214 (54%), Gaps = 14/214 (6%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG+S VGK+S++ R++++ +++  + TIGA FLTK +  DD K +  ++WDTAGQ
Sbjct: 13  IKLVLLGESAVGKSSIVLRFISNDFTESREPTIGAAFLTKRITRDD-KAIKFEIWDTAGQ 71

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF  L   +YR A   ++V+D+TN +SF   + W +E  +H  +   ++    ++GNK+
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDITNEQSFRKAQDWVEE--LHEKLG--DNIIIALVGNKM 127

Query: 385 DI-----EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           D+     E S + V+E   Q L +   ++  F  SAK+  N+   F+ + +       N 
Sbjct: 128 DLLTMQGEISNRAVNEDEIQNLCQQ-ENLLYFEVSAKTGKNIHEVFQAVGEKIPFPTHNV 186

Query: 550 AHAFEDD--FNDAINIQLEG-------ESNSCSC 624
               E D    D   I LE        E+  C+C
Sbjct: 187 GRTSEHDLTITDDQRIDLESTTVEGARETGGCNC 220

>SAKL0D05940g Chr4 (485575..486198) [624 bp, 207 aa] {ON} highly
           similar to uniprot|Q75F92 Ashbya gossypii AAL176C
           AAL176Cp and similar to YKR014C uniprot|P36018
           Saccharomyces cerevisiae YKR014C YPT52 rab5-like GTPase
           involved in vacuolar protein sorting and endocytosis
           probable purine nucleotide-binding protein
          Length = 207

 Score =  114 bits (286), Expect = 3e-31
 Identities = 69/206 (33%), Positives = 113/206 (54%), Gaps = 9/206 (4%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD--DKVVTMQVWDTAG 201
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L D  D VV  ++WDTAG
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++SL   +YR A+  ++VYDVT   S    ++W DE     +    E     ++GNK
Sbjct: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLVGNK 121

Query: 382 VDI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDA 552
           +D+   E  ++ V +   Q  A   G +     SAK+   V   F+EI +    Q ++  
Sbjct: 122 LDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL 180

Query: 553 HAFEDDFNDAINIQLE----GESNSC 618
            A        +N++L+     ++ SC
Sbjct: 181 EA-ASQTRHVVNVELQRPTTNDATSC 205

>Suva_7.51 Chr7 (90232..90897) [666 bp, 221 aa] {ON} YGL210W (REAL)
          Length = 221

 Score =  115 bits (287), Expect = 3e-31
 Identities = 60/172 (34%), Positives = 110/172 (63%), Gaps = 1/172 (0%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + ++D K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVEDKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIAKSALQ 534
            D+   + V +++A      ++ +  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEARN---FAMENQMLFTETSALNSDNVDKAFRELIVAIFQ 176

>Ecym_1207 Chr1 (420728..420773,421159..421766) [654 bp, 217 aa]
           {ON} similar to Ashbya gossypii AER434C  1-intron
          Length = 217

 Score =  114 bits (286), Expect = 4e-31
 Identities = 63/179 (35%), Positives = 110/179 (61%), Gaps = 3/179 (1%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  D+++   K+TIG +F T+ + ++  KV   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E+    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLAELRENAD----ENVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ---QNQND 549
            D+   + V +++A     ++   +    TSA +A NVD AF E+  +  Q   +NQ D
Sbjct: 128 SDLAHLRAVPTDEAKNYAQEN--QMLFTETSALNAENVDLAFRELITAIYQMVSKNQVD 184

>Kpol_423.12 s423 (26761..27423) [663 bp, 220 aa] {ON}
           (26761..27423) [663 nt, 221 aa]
          Length = 220

 Score =  114 bits (286), Expect = 5e-31
 Identities = 63/190 (33%), Positives = 116/190 (61%), Gaps = 1/190 (0%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  D++  + K+TIG +F T+ + +D  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFHLESKSTIGVEFATRTIDVDGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKQSSYENCNHWLAELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ-NQNDAHA 558
            D+   + V +++A ++ A+    +    TSA ++ NVD AF E+  S  Q  +++    
Sbjct: 128 SDLSHLRAVPTDEA-KKFAQE-NQLLFTETSALNSENVDQAFRELITSIYQMISKHQVDL 185

Query: 559 FEDDFNDAIN 588
             D+ N+ +N
Sbjct: 186 GVDNNNNTLN 195

>CAGL0K09394g Chr11 complement(930063..930728) [666 bp, 221 aa] {ON}
           highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210w YPT32 or uniprot|P38555 Saccharomyces
           cerevisiae YER031c YPT31
          Length = 221

 Score =  114 bits (286), Expect = 5e-31
 Identities = 59/167 (35%), Positives = 109/167 (65%), Gaps = 2/167 (1%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++D K+   Q+WDTAG
Sbjct: 14  LFKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKVEDKKIKA-QIWDTAG 72

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    ++    ++GNK
Sbjct: 73  QERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENAD----DNVAIGLIGNK 128

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFL--TSAKSAINVDTAFEEI 516
            D+E  + V +E+A    +++     LF   TSA ++ NVD AF E+
Sbjct: 129 SDLEHLRAVPTEEARGFASEN----QLFFTETSALNSENVDLAFREL 171

>Smik_5.154 Chr5 complement(218975..219646) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  114 bits (286), Expect = 5e-31
 Identities = 59/172 (34%), Positives = 107/172 (62%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D  K +  Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDG-KRIKAQIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ 537
            D+   + V +E+A  +       +    TSA ++ NVD AFEE+  +  Q+
Sbjct: 128 SDLAHLRAVPTEEA--KTFAQENQLLFTETSALNSENVDKAFEELINTIYQK 177

>SAKL0E09922g Chr5 complement(829249..829890) [642 bp, 213 aa] {ON}
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 213

 Score =  114 bits (285), Expect = 5e-31
 Identities = 72/211 (34%), Positives = 119/211 (56%), Gaps = 11/211 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D   +  ++WDTAGQ
Sbjct: 9   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDH-TIKFEIWDTAGQ 67

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++GNK+
Sbjct: 68  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAN----KGIIIALVGNKL 123

Query: 385 DIEDS--KKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK-------SALQQ 537
           D+ ++  ++ V+++ G++LA+  G +  F TSAK+  NV+  F  I +         LQQ
Sbjct: 124 DLLENGGERKVAKEEGEKLAEEEG-LLFFETSAKTGDNVNEVFLAIGEKIPLHTPEELQQ 182

Query: 538 NQNDAHAFEDDFND--AINIQLEGESNSCSC 624
            Q      ED   D  A      G +  C+C
Sbjct: 183 QQGGLRVTEDSRVDLTANANGSTGAAGPCNC 213

>TPHA0P00950 Chr16 complement(193256..193897) [642 bp, 213 aa] {ON}
           Anc_2.196 YNL093W
          Length = 213

 Score =  114 bits (285), Expect = 5e-31
 Identities = 68/180 (37%), Positives = 107/180 (59%), Gaps = 5/180 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +DD   +  ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVVRFVSNDFSENKEPTIGAAFLTQRVNIDDH-TIKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S        + GNKV
Sbjct: 67  ERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWVKE--LHEQASG--DIVIALAGNKV 122

Query: 385 DI-----EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           D+     E+ +KV +E+ GQ+LA    ++  F TSAK+  NV+  F  +      +  ND
Sbjct: 123 DLIEENGENERKVATEE-GQKLADE-ENLLFFETSAKTGYNVNEIFLAVGDKIPLKRPND 180

>CAGL0C02453g Chr3 (247493..248149) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P38555 Saccharomyces cerevisiae
           YER031c YPT31
          Length = 218

 Score =  114 bits (285), Expect = 6e-31
 Identities = 59/172 (34%), Positives = 110/172 (63%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDVDGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ 537
            D+   + V +E+A Q  +++   +    TSA ++ NVD AF+E+  +  Q+
Sbjct: 128 SDLAHLRAVPTEEAKQFASEN--QLLFTETSALNSDNVDLAFKELITAIHQK 177

>Suva_14.247 Chr14 (448490..449146) [657 bp, 218 aa] {ON} YNL093W
           (REAL)
          Length = 218

 Score =  114 bits (284), Expect = 9e-31
 Identities = 67/212 (31%), Positives = 118/212 (55%), Gaps = 12/212 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +KV++LG+S VGK+S++ R+V++ ++Q  + TIGA FLTK +  +D+  +  ++WDTAGQ
Sbjct: 13  IKVVLLGESAVGKSSIVLRFVSNDFTQSREPTIGAAFLTKRISRNDE-AIKFEIWDTAGQ 71

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF  L   +YR A   ++V+D+TN +SF   ++W ++  +H  + +       ++GNK+
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDITNEQSFHKAQNWVEQ--LHERVGN--HIIIALVGNKI 127

Query: 385 DI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAH 555
           D+   ++  + V  +  ++L +   ++  F TSAK+  N+   F+ I +      QN   
Sbjct: 128 DLLSMQNVNRAVRIEVVEDLCQR-ENLLYFETSAKTGENIHEVFQAIGEKTPYPKQNTRR 186

Query: 556 AFEDD--FNDAINIQLEG-------ESNSCSC 624
             + D    D   I LE        E+  CSC
Sbjct: 187 NSDHDLTITDDQRIDLESTTVEGARETGGCSC 218

>ZYRO0B09152g Chr2 complement(714608..715279) [672 bp, 223 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 223

 Score =  114 bits (284), Expect = 1e-30
 Identities = 70/203 (34%), Positives = 108/203 (53%), Gaps = 5/203 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV-VLDDDKVV---TMQVWD 192
           LK+++LG+S VGKTS++ RY    Y Q+  ATIGA F TK + V  +D VV    +++WD
Sbjct: 35  LKLVLLGESSVGKTSIVTRYTTGNY-QKTNATIGAAFFTKAINVPSEDGVVRKVNVEIWD 93

Query: 193 TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES-FPFVI 369
           TAGQER++SL   +YR  D   +V+DVT  +S E   SW +E   + +   PE+    ++
Sbjct: 94  TAGQERYRSLTPVYYRNTDAAFIVFDVTKPESLEKAHSWIEELNEYCSSDRPENEINTIV 153

Query: 370 LGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           +GNK+D++                   D+   L SAK+   +   FE++A+S L +    
Sbjct: 154 VGNKIDLDHGPFET-------------DLQYVLVSAKTGEGIVKLFEKLAQSVLNEKYVR 200

Query: 550 AHAFEDDFNDAINIQLEGESNSC 618
               ED   D   ++   E+ SC
Sbjct: 201 EETLEDLPKDPFKMKRRKETCSC 223

>YNL093W Chr14 (449868..450530) [663 bp, 220 aa] {ON}  YPT53Rab
           family GTPase, similar to Ypt51p and Ypt52p and to
           mammalian rab5; required for vacuolar protein sorting
           and endocytosis
          Length = 220

 Score =  113 bits (283), Expect = 1e-30
 Identities = 69/214 (32%), Positives = 114/214 (53%), Gaps = 14/214 (6%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +KV++LG+S VGK+S++ R+V+D + +  + TIGA FLTK +  D  KV+  ++WDTAGQ
Sbjct: 13  IKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDG-KVIKFEIWDTAGQ 71

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF  L   +YR A   ++V+DVTN  SF   ++W +E  +H  +         ++GNK+
Sbjct: 72  ERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEE--LHEKVG--HDIVIALVGNKM 127

Query: 385 DI-----EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKS--ALQQNQ 543
           D+     E+  + +   A Q L +   ++  F  SAK+  N+   F+ + +     +QN 
Sbjct: 128 DLLNNDDENENRAMKAPAVQNLCER-ENLLYFEASAKTGENIYQIFQTLGEKVPCPEQNT 186

Query: 544 NDAHAFEDDFNDAINIQLEG-------ESNSCSC 624
             +   +    D   I LE        E+  C+C
Sbjct: 187 RQSSTHDRTITDNQRIDLESTTVESTRETGGCNC 220

>Suva_5.128 Chr5 complement(190103..190774) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  113 bits (283), Expect = 1e-30
 Identities = 58/172 (33%), Positives = 107/172 (62%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D  K +  Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDG-KRIKAQIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ 537
            D+   + V +E++  +       +    TSA ++ NVD AFEE+  +  Q+
Sbjct: 128 SDLAHLRAVPTEES--KTFAQENQLLFTETSALNSENVDKAFEELINTIYQK 177

>Skud_5.140 Chr5 complement(211975..212646) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  113 bits (283), Expect = 1e-30
 Identities = 58/172 (33%), Positives = 107/172 (62%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D  K +  Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDG-KRIKAQIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ 537
            D+   + V +E++  +       +    TSA ++ NVD AFEE+  +  Q+
Sbjct: 128 SDLAHLRAVPTEES--KTFAQENQLLFTETSALNSENVDEAFEELINTIYQK 177

>YER031C Chr5 complement(214076..214747) [672 bp, 223 aa] {ON}
           YPT31Rab family GTPase, very similar to Ypt32p; involved
           in the exocytic pathway; mediates intra-Golgi traffic or
           the budding of post-Golgi vesicles from the trans-Golgi
          Length = 223

 Score =  113 bits (283), Expect = 1e-30
 Identities = 58/172 (33%), Positives = 107/172 (62%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D  K +  Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDG-KRIKAQIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQ 537
            D+   + V +E++  +       +    TSA ++ NVD AFEE+  +  Q+
Sbjct: 128 SDLAHLRAVPTEES--KTFAQENQLLFTETSALNSENVDKAFEELINTIYQK 177

>KLTH0G08206g Chr7 (666127..666765) [639 bp, 212 aa] {ON} highly
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 212

 Score =  113 bits (282), Expect = 1e-30
 Identities = 74/212 (34%), Positives = 120/212 (56%), Gaps = 12/212 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D   +  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDH-TIKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQAS----KDIIIALVGNKL 122

Query: 385 DIEDS---KKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA-----KSALQQN 540
           D+ ++   +KV  E+A + LA   G +  F TSAK+  NV+  F  I      KSA QQ 
Sbjct: 123 DMVETGAERKVALEEA-ENLASQEG-LLFFETSAKTGSNVNEVFLAIGQKIPLKSAQQQQ 180

Query: 541 QNDAHA---FEDDFNDAINIQLEGES-NSCSC 624
           Q    +     DD    +    +G + +SC+C
Sbjct: 181 QGQGSSGLRINDDSRVDLRAAQDGPAPSSCNC 212

>Skud_7.58 Chr7 (99129..99797) [669 bp, 222 aa] {ON} YGL210W (REAL)
          Length = 222

 Score =  113 bits (282), Expect = 2e-30
 Identities = 59/172 (34%), Positives = 110/172 (63%), Gaps = 1/172 (0%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + +++ K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIAKSALQ 534
            D+   + V +++A      ++ +  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEAKN---FAMENQMLFTETSALNSDNVDRAFRELIVAIFQ 176

>YGL210W Chr7 (93792..94460) [669 bp, 222 aa] {ON}  YPT32Rab family
           GTPase, very similar to Ypt31p; involved in the exocytic
           pathway; mediates intra-Golgi traffic or the budding of
           post-Golgi vesicles from the trans-Golgi
          Length = 222

 Score =  113 bits (282), Expect = 2e-30
 Identities = 59/172 (34%), Positives = 110/172 (63%), Gaps = 1/172 (0%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + +++ K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIAKSALQ 534
            D+   + V +++A      ++ +  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEAKN---FAMENQMLFTETSALNSDNVDKAFRELIVAIFQ 176

>KAFR0C04310 Chr3 (855871..856470) [600 bp, 199 aa] {ON} Anc_1.338
           YBR264C
          Length = 199

 Score =  112 bits (280), Expect = 2e-30
 Identities = 68/204 (33%), Positives = 114/204 (55%), Gaps = 4/204 (1%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           LK+++LG+S VGK+S++ R+V  K+ Q+  ATIGA F +K + LDD K V +++WDTAGQ
Sbjct: 11  LKLVLLGESSVGKSSIVTRFVTGKF-QKNNATIGAAFTSKSIKLDDYKEVNLEIWDTAGQ 69

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ER++SL   +YR  D  ++V+DVTN +S E  +SW DE   +       +   +++ NK 
Sbjct: 70  ERYRSLAPMYYRETDVALVVFDVTNKRSLERAQSWIDELNFYIVSERQHAVKIMLVANKA 129

Query: 385 DIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFE 564
           D+           G ++  ++ D+     SAK+   +   F++I    L Q   D+    
Sbjct: 130 DL---------ITGMDIDTNV-DLSFTKVSAKTGEGIQELFDQI----LSQIPEDSFRSP 175

Query: 565 D-DFNDAINIQLEGESNS---CSC 624
           D D  + I+I  +  +++   C+C
Sbjct: 176 DHDNKNVISINKDNATSNVSYCTC 199

>Smik_7.53 Chr7 (88592..89260) [669 bp, 222 aa] {ON} YGL210W (REAL)
          Length = 222

 Score =  112 bits (281), Expect = 3e-30
 Identities = 59/172 (34%), Positives = 110/172 (63%), Gaps = 1/172 (0%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + +++ K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIAKSALQ 534
            D+   + V +++A      ++ +  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEAKN---FAMENQMLFTETSALNSDNVDRAFRELIIAIFQ 176

>Ecym_5362 Chr5 (735204..735833) [630 bp, 209 aa] {ON} similar to
           Ashbya gossypii ACL084C
          Length = 209

 Score =  112 bits (280), Expect = 3e-30
 Identities = 71/207 (34%), Positives = 117/207 (56%), Gaps = 7/207 (3%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + + + +  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMGN-QTIKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYD+T  +SF   + W  E    A+    +S    ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQAS----KSIIIALVGNKL 122

Query: 385 DI--EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA-----KSALQQNQ 543
           D+   D ++ V+ +  + LA+  G +  F TSAK+  NV+  F  I      K    QN 
Sbjct: 123 DLLESDEERKVAREEAESLAQEEG-LLFFETSAKTGDNVNEVFLGIGEKIPLKQQEVQNG 181

Query: 544 NDAHAFEDDFNDAINIQLEGESNSCSC 624
           N A   E    D +N+     +NS  C
Sbjct: 182 NGASVNEVSRVD-LNVAGSSGANSSGC 207

>KLTH0G01760g Chr7 (132121..132166,132307..132917) [657 bp, 218 aa]
           {ON} highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210W YPT32 probably involved in
           intra-Golgi transport or in the formation of transport
           vesicles at the most distal Golgi compartment; ras-like
           GTPase, highly homologous to YPT31
          Length = 218

 Score =  112 bits (280), Expect = 3e-30
 Identities = 58/171 (33%), Positives = 108/171 (63%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E+    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----ENVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
            D+   + V +++A +  A+    +    TSA ++ NVD AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEA-KNFAQE-NQLLFTETSALNSENVDQAFRELITAIYQ 176

>ACL084C Chr3 complement(199020..199643) [624 bp, 207 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR089C
           (VPS21) and YNL093W (YPT53)
          Length = 207

 Score =  112 bits (279), Expect = 4e-30
 Identities = 65/206 (31%), Positives = 118/206 (57%), Gaps = 6/206 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +D  K +  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMDS-KTIKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYD+T  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQAS----KGIVIALVGNKL 122

Query: 385 DIEDS--KKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF----EEIAKSALQQNQN 546
           D+ ++   + VS +  ++LA+  G +  F TSAK+   ++  F    E+I  + + +   
Sbjct: 123 DLLENGEARKVSREEAEKLAEEEG-LLFFETSAKTGDKINEVFLAIGEKIPLAKVGEQPA 181

Query: 547 DAHAFEDDFNDAINIQLEGESNSCSC 624
              + ++   D   +     +NSC+C
Sbjct: 182 SGPSVDNARLDLNAVSSNQHANSCNC 207

>SAKL0F01914g Chr6 (162387..162432,162627..163246) [666 bp, 221 aa]
           {ON} highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210W YPT32 probably involved in
           intra-Golgi transport or in the formation of transport
           vesicles at the most distal Golgi compartment ras-like
           GTPase highly homologous to YPT31
          Length = 221

 Score =  112 bits (280), Expect = 4e-30
 Identities = 58/171 (33%), Positives = 108/171 (63%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E+    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSNSYENCNHWLTELRENAD----ENVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
            D+   + V +++A +  A+    +    TSA ++ NVD AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEA-KNFAQE-NQLLFTETSALNSENVDLAFRELITAIYQ 176

>TPHA0D03430 Chr4 complement(719751..720422) [672 bp, 223 aa] {ON}
           Anc_3.521 YER031C
          Length = 223

 Score =  112 bits (280), Expect = 4e-30
 Identities = 59/171 (34%), Positives = 107/171 (62%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + +++ K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNDFNLESKSTIGVEFATRTIEVENKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKQSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
            D+   + V +E+A +  A+    +    TSA ++ NVD AF E+  S  Q
Sbjct: 128 SDLSHLRAVPTEEA-KNFAQE-NQLLFTETSALNSENVDQAFRELITSIYQ 176

>ZYRO0C15554g Chr3 complement(1218190..1218825) [636 bp, 211 aa]
           {ON} highly similar to uniprot|P36017 Saccharomyces
           cerevisiae YOR089C VPS21 Rab5-like GTPase involved in
           vacuolar protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 211

 Score =  112 bits (279), Expect = 4e-30
 Identities = 71/209 (33%), Positives = 116/209 (55%), Gaps = 9/209 (4%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + + + V  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIGE-QTVKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYD+T  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQAS----KGIVIALVGNKL 122

Query: 385 DIEDS---KKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF------EEIAKSALQQ 537
           D+ ++   +KV  E+A ++LA+  G +  F TSAKS  NV+  F        I K   Q 
Sbjct: 123 DMIENGGERKVAKEEA-EKLAEEEG-LLFFETSAKSGENVNEVFLGIGEKIPIKKPGEQA 180

Query: 538 NQNDAHAFEDDFNDAINIQLEGESNSCSC 624
           N+       DD    +   + G   S  C
Sbjct: 181 NEQSGLRITDDQRVDLTNSVNGPVRSAGC 209

>KAFR0F04160 Chr6 complement(819022..819759) [738 bp, 245 aa] {ON}
           Anc_3.521 YER031C
          Length = 245

 Score =  112 bits (281), Expect = 5e-30
 Identities = 62/190 (32%), Positives = 114/190 (60%), Gaps = 1/190 (0%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEMEGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLSELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
            D+   + V +++A      +L +  LF  TSA ++ NVD AF E+  +  Q        
Sbjct: 128 SDLAHLRAVPTDEAKN---FALENQLLFTETSALNSENVDQAFRELITAIYQMVSKHQVD 184

Query: 559 FEDDFNDAIN 588
             D  N+ IN
Sbjct: 185 LGDSGNNDIN 194

>KLLA0B00671g Chr2 complement(50393..51006,51417..51462) [660 bp,
           219 aa] {ON} highly similar to uniprot|P51996
           Saccharomyces cerevisiae YGL210W YPT32 probably involved
           in intra-Golgi transport or in the formation of
           transport vesicles at the most distal Golgi compartment;
           ras-like GTPase, highly homologous to YPT31
          Length = 219

 Score =  111 bits (278), Expect = 7e-30
 Identities = 61/187 (32%), Positives = 110/187 (58%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++   K TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTANEFNLDSKTTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YR A   ++VYD+T + S+EN   W  E   +A+    E+    ++GNK
Sbjct: 72  QERYRAITTAYYRAAVGALIVYDITKSSSYENCNHWLAELKQNAD----ENVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAF 561
            D++  + V +++A     ++   +    TSA +A NVD AF  +  +  Q    +    
Sbjct: 128 SDLDHKRAVPTDEARNYAQEN--QLLFTETSALNADNVDEAFRALITAIYQMISKN---- 181

Query: 562 EDDFNDA 582
           + D NDA
Sbjct: 182 QLDLNDA 188

>KLLA0C13728g Chr3 (1173329..1173955) [627 bp, 208 aa] {ON} highly
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 208

 Score =  111 bits (277), Expect = 8e-30
 Identities = 70/208 (33%), Positives = 111/208 (53%), Gaps = 8/208 (3%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D   +  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMADH-TIKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAS----KGIVIALVGNKM 122

Query: 385 DI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA-----KSALQQN 540
           D+   E+ +KV  E+A  E      ++  F TSAK+  NV+  F  I      K +   N
Sbjct: 123 DLLESEEDRKVAKEEA--EKLSQEENLLFFETSAKTGDNVNEVFLAIGEKIPLKKSDGSN 180

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
            +     ED   D          NSC C
Sbjct: 181 TDGLRGTEDGRIDLNKPDDTSNPNSCGC 208

>TDEL0C04660 Chr3 complement(845203..845838) [636 bp, 211 aa] {ON}
           Anc_2.196 YNL093W
          Length = 211

 Score =  111 bits (277), Expect = 8e-30
 Identities = 72/211 (34%), Positives = 120/211 (56%), Gaps = 11/211 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D+  V  ++WDTAGQ
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFTENKEPTIGAAFLTQRVNIGDE-TVKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAS----KGIIIALVGNKI 122

Query: 385 DIEDS---KKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA------KSALQQ 537
           D+ +S   +KV  E+A ++LA+   ++  F TSAK+  NV+  F  I       K+  Q 
Sbjct: 123 DVLESGEERKVAREEA-EKLAEE-ENLLYFETSAKTGENVNEVFLAIGEKIPLKKAEDQA 180

Query: 538 NQNDAHAFEDDFNDAINIQLEG--ESNSCSC 624
           NQ       DD    +     G  +++ C+C
Sbjct: 181 NQQHGLRITDDQRIDLASSTNGPVKASGCNC 211

>ZYRO0E08492g Chr5 complement(676074..676684,676766..676811) [657
           bp, 218 aa] {ON} highly similar to uniprot|P51996
           Saccharomyces cerevisiae YGL210W YPT32 probably involved
           in intra-Golgi transport or in the formation of
           transport vesicles at the most distal Golgi compartment;
           ras-like GTPase, highly homologous to YPT31
          Length = 218

 Score =  110 bits (275), Expect = 2e-29
 Identities = 57/171 (33%), Positives = 106/171 (61%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNDFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKPSSYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
            D++  + V +++A +  A+    +    TSA  + NVD AF E+  +  Q
Sbjct: 128 SDLDHLRAVPTDEA-KNFAQE-NQLLFTETSALKSENVDLAFRELITAIYQ 176

>NDAI0I02910 Chr9 complement(688721..689380) [660 bp, 219 aa] {ON}
           Anc_3.521
          Length = 219

 Score =  109 bits (273), Expect = 4e-29
 Identities = 58/172 (33%), Positives = 109/172 (63%), Gaps = 1/172 (0%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLTELKENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIAKSALQ 534
            D+   + V +++A      +L +  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEAKN---FALENQLLFTETSALNSENVDQAFRELITAIYQ 176

>Kwal_23.2978 s23 (97956..98591) [636 bp, 211 aa] {ON} YOR089C
           (VPS21) - small GTP-binding protein; geranylgeranylated;
           geranylgeranylation required for membrane association;
           also involved in endocytosis post vesicle
           internalization [contig 247] FULL
          Length = 211

 Score =  109 bits (272), Expect = 4e-29
 Identities = 73/213 (34%), Positives = 116/213 (54%), Gaps = 13/213 (6%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D   +  ++WDTAGQ
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDH-TIKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQAS----KDIVIALVGNKL 122

Query: 385 DIEDS---KKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIA-----KSALQQN 540
           DI +S   +KV  E+A    A+    +  F TSAK+  NV+  F  I      KS  QQ 
Sbjct: 123 DIVESGGERKVAREEAENLAAQE--QLLFFETSAKTGSNVNEVFLGIGQKIPLKSPQQQQ 180

Query: 541 QNDAHAFEDDFNDAINIQL---EGES--NSCSC 624
                      ND   + L   +G S  ++C+C
Sbjct: 181 AQGPSGLR--INDDARVDLRAAQGNSAQSNCNC 211

>NDAI0B04980 Chr2 complement(1216833..1217516) [684 bp, 227 aa] {ON}
           Anc_1.289
          Length = 227

 Score =  109 bits (272), Expect = 7e-29
 Identities = 70/225 (31%), Positives = 112/225 (49%), Gaps = 26/225 (11%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKV-----VTMQVWD 192
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL + + + D +      +  ++WD
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLAQTIKIKDTETQEDIDIKFEIWD 64

Query: 193 TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVIL 372
           TAGQER++SL   +YR A+  ++VYD+T   S     SW DE     +    E     ++
Sbjct: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKNSLSKAMSWVDEL---KSKVGDEDLVIYLV 121

Query: 373 GNKVDI--------------EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFE 510
           GNK+D+              E++K+VV+ +     AK  G +     SAK+   V   F+
Sbjct: 122 GNKLDLCDNVENRGGKEQEEEENKRVVTTQEADSYAKDQG-LLFAEISAKTGQGVKEVFQ 180

Query: 511 -------EIAKSALQQNQNDAHAFEDDFNDAINIQLEGESNSCSC 624
                  EI K  L   +N  +         INIQ    ++  SC
Sbjct: 181 TIGEKLYEIKKPELLAKKNREYGRNSSEAVDINIQRPNTNDPTSC 225

>NCAS0E00600 Chr5 (102956..103615) [660 bp, 219 aa] {ON} Anc_3.521
          Length = 219

 Score =  108 bits (271), Expect = 8e-29
 Identities = 58/187 (31%), Positives = 112/187 (59%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDNAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAF 561
            D+   + V + +A    +++  ++    TSA ++ NVD AF E+  +  Q         
Sbjct: 128 SDLAHLRAVPTAEAKNFASEN--ELLFTETSALNSENVDQAFRELITAIYQMVSKHQVDL 185

Query: 562 EDDFNDA 582
            D  N+A
Sbjct: 186 GDSGNNA 192

>NCAS0B07360 Chr2 complement(1389230..1389907) [678 bp, 225 aa] {ON}
           Anc_1.338
          Length = 225

 Score =  108 bits (271), Expect = 9e-29
 Identities = 63/171 (36%), Positives = 103/171 (60%), Gaps = 5/171 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVV-LDDDKV--VTMQVWDT 195
           LK+++LG+S VGKTS++ R+   K+ Q+  ATIGA FL K +  +D+D +  V +++WDT
Sbjct: 23  LKLVLLGESSVGKTSIVTRFTTGKF-QRNNATIGAAFLNKNIRWVDEDNIYEVDLEIWDT 81

Query: 196 AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILG 375
           AGQER++SL   +YR  D  ++V+DVT++ +F+  +SW DE   + +    +     ++G
Sbjct: 82  AGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYLIG 141

Query: 376 NKVDIEDSKKVVSEKAGQELAK-SLGDVPLFL-TSAKSAINVDTAFEEIAK 522
           NK D+E           + +AK ++ D+  F   SAK    +   FEEIA+
Sbjct: 142 NKCDLEH----------ESIAKTAILDMCTFKEVSAKRDEGIQELFEEIAR 182

>KNAG0B00580 Chr2 (94797..95474) [678 bp, 225 aa] {ON} Anc_3.521
           YER031C
          Length = 225

 Score =  108 bits (271), Expect = 9e-29
 Identities = 56/171 (32%), Positives = 108/171 (63%)
 Frame = +1

Query: 22  ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAG 201
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++  K+   Q+WDTAG
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKA-QIWDTAG 71

Query: 202 QERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNK 381
           QER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    ++    ++GNK
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLTELRENAD----DNVAVGLIGNK 127

Query: 382 VDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
            D+   + V +++A +  A+    +    TSA ++ NVD AF E+  +  Q
Sbjct: 128 SDLAHLRAVPTDEA-KNFAQE-NQLLFTETSALNSENVDQAFRELITAIYQ 176

>Smik_2.408 Chr2 complement(723817..724416) [600 bp, 199 aa] {ON}
           YBR264C (REAL)
          Length = 199

 Score =  108 bits (269), Expect = 9e-29
 Identities = 71/207 (34%), Positives = 114/207 (55%), Gaps = 7/207 (3%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVVLDD---DKVVTMQVW 189
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK  E+  DD   DK + M++W
Sbjct: 5   IKVVLLGDSSVGKTSVVTRLKSGKFLAKHAATIGAAFITKTIEIPSDDTTTDKRIHMEIW 64

Query: 190 DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVI 369
           DTAGQER++SL   +YR A+  +LV+++ +  S +  K+W  +    A     +    ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELGDISSLQCAKTWFQDLQDRA-----QGTQVIL 119

Query: 370 LGNKVDIEDSKKVVSEKAGQE--LAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQ 543
           +GNK D+      V E+   E  +   L D+P  L SAK+  N DT    I  S + ++Q
Sbjct: 120 VGNKYDL------VREEHLDEVTIPAELQDLPYVLVSAKTGYNFDT-LNGIIISLVPESQ 172

Query: 544 NDAHAFEDDFNDAINIQLEGESNSCSC 624
                 +D+  + + I  +    SC C
Sbjct: 173 FKRLLKDDEQGNKLEISKKKSGGSCIC 199

>KNAG0C01600 Chr3 (317298..317942) [645 bp, 214 aa] {ON} Anc_1.289
           YKR014C
          Length = 214

 Score =  108 bits (269), Expect = 1e-28
 Identities = 59/174 (33%), Positives = 100/174 (57%), Gaps = 9/174 (5%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDK----VVTMQVWDT 195
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++ +     V+  ++WDT
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTIKVESEDQQEVVIKFEIWDT 64

Query: 196 AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILG 375
           AGQER++SL   +YR A+  ++VYDVT   S    K+W +E     N    E     ++G
Sbjct: 65  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLNKAKAWVEEL---KNKVGDEDLVIFLVG 121

Query: 376 NKVDI-----EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           NKVD+      + K+ V+    ++ A+  G +     SAK+   V   F+ I +
Sbjct: 122 NKVDLCEGSDNEDKRAVAATLAKQYAEDQG-LMFDEVSAKTGHGVKEVFQAIGQ 174

>KNAG0I01080 Chr9 (207327..208088) [762 bp, 253 aa] {ON} Anc_2.196
           YNL093W
          Length = 253

 Score =  108 bits (270), Expect = 2e-28
 Identities = 59/170 (34%), Positives = 107/170 (62%), Gaps = 3/170 (1%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           +K+++LG+  VGK+S++ R+V++ +++  + TIGA FLT+ V +++   +  ++WDTAGQ
Sbjct: 8   IKLVLLGEVAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNINEH-TIKFEIWDTAGQ 66

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 384
           ERF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAS----KDIIIALVGNKI 122

Query: 385 DIED---SKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKS 525
           D+ D   +++ V+ + G++LA+   ++  F TSAK+  NV+  F +I ++
Sbjct: 123 DMLDEDPTERKVAREEGEKLAQE-ENLLFFETSAKTGANVNEVFLKIGEN 171

>AEL187C Chr5 complement(284984..285610) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR264C
           (YPT10)
          Length = 208

 Score =  106 bits (265), Expect = 5e-28
 Identities = 61/176 (34%), Positives = 99/176 (56%), Gaps = 10/176 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDD----------KVV 174
           +K+++LG+S VGK+S++ R+   ++ +  +ATIGA F T+ V  ++D          + V
Sbjct: 9   VKLVLLGESSVGKSSIVTRFTTGEFRKN-QATIGAAFTTRSVQWEEDAGDGSDAKEVRSV 67

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
           T ++WDTAGQER++SL   +YR  D  ++VYDVT  +SF+N +SW DE   +   +    
Sbjct: 68  TFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQRND 127

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
               I+GNK+D+          AG +L + L        SAK+   ++  F +IAK
Sbjct: 128 VVVRIVGNKIDLH---------AGGQLEQPLPSAT--FVSAKTGEGIEELFMDIAK 172

>TDEL0D05890 Chr4 complement(1067167..1067856) [690 bp, 229 aa] {ON}
           Anc_3.521 YER031C
          Length = 229

 Score =  107 bits (266), Expect = 5e-28
 Identities = 57/172 (33%), Positives = 106/172 (61%)
 Frame = +1

Query: 19  NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTA 198
           N + V+++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + ++  K+   Q+WDTA
Sbjct: 24  NWVIVVLIGDSGVGKSNLLSRFTTNDFNMESKSTIGVEFATRTIEVEGKKIKA-QIWDTA 82

Query: 199 GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 378
           GQER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    ++    ++GN
Sbjct: 83  GQERYRAITSAYYRGAVGALIVYDISKPSSYENCNHWLTELRENAD----DNVAVGLIGN 138

Query: 379 KVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
           K D++  + V +++A +  A+    +    TSA  + NV+ AF E+  +  Q
Sbjct: 139 KSDLDHLRAVPTDEA-RNFAQE-NQLLFTETSALKSENVELAFRELITAIYQ 188

>Smik_11.271 Chr11 complement(452840..453544) [705 bp, 234 aa] {ON}
           YKR014C (REAL)
          Length = 234

 Score =  107 bits (266), Expect = 6e-28
 Identities = 64/221 (28%), Positives = 111/221 (50%), Gaps = 26/221 (11%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD-------DKVVTMQV 186
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +         D ++  ++
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGGEVKDVIIKFEI 64

Query: 187 WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFV 366
           WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +     
Sbjct: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVIY 121

Query: 367 ILGNKVDI-------------------EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAI 489
           +LGNKVD+                   E   +V+S +  ++ A+  G +     SAK+  
Sbjct: 122 LLGNKVDLCQESASTEPSPESNKGEDDEQKVRVISTEEAKQYAQEQG-LLFREVSAKTGE 180

Query: 490 NVDTAFEEIAKSALQQNQNDAHAFEDDFNDAINIQLEGESN 612
            V   F++I +             +D+     N Q+ G +N
Sbjct: 181 GVKEIFQDIGEKLYDSK-------KDEILSKQNRQINGSNN 214

>Skud_11.247 Chr11 complement(445982..446686) [705 bp, 234 aa] {ON}
           YKR014C (REAL)
          Length = 234

 Score =  106 bits (265), Expect = 8e-28
 Identities = 66/221 (29%), Positives = 113/221 (51%), Gaps = 26/221 (11%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD-------DKVVTMQV 186
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +         D V+  ++
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNGAKDVVIKFEI 64

Query: 187 WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFV 366
           WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +     
Sbjct: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVIY 121

Query: 367 ILGNKVDI-----------------EDSKKV--VSEKAGQELAKSLGDVPLFLTSAKSAI 489
           +LGNKVD+                 +D +KV  +S +  ++ A+  G +     SAK+  
Sbjct: 122 LLGNKVDLCQDMPGSETIPELNEGEDDEQKVRAISTEEAKQYAQEQG-LLFREVSAKTGD 180

Query: 490 NVDTAFEEIAKSALQQNQNDAHAFEDDFNDAINIQLEGESN 612
            +   F+EI +             +D+     N Q+ G +N
Sbjct: 181 GIKEIFQEIGEKLYDSK-------KDEILSKQNRQINGGNN 214

>Ecym_6309 Chr6 (585998..586624) [627 bp, 208 aa] {ON} similar to
           Ashbya gossypii AEL187C
          Length = 208

 Score =  105 bits (262), Expect = 1e-27
 Identities = 67/212 (31%), Positives = 110/212 (51%), Gaps = 12/212 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDD-----------KV 171
           LK+++LG+S VGK+S++ R+   ++ +  +ATIGA F T+ +   ++           K 
Sbjct: 9   LKLVLLGESSVGKSSIVTRFTTGEFHKN-QATIGAAFTTRTISWKENPTNRSSEELITKS 67

Query: 172 VTMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPE 351
           V  ++WDTAGQER++SL   +YR  D  ++V+D+T+  S E  +SW DE   + + S  +
Sbjct: 68  VNFEIWDTAGQERYRSLAPMYYRNTDVALIVFDITDESSLEKAQSWIDELNTYVDESRQK 127

Query: 352 SFPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSAL 531
                I+GNK+D++DSK V   K G +           L SAKS   ++  F  IAK   
Sbjct: 128 QIVIKIVGNKMDLKDSKFV---KGGWKTVS--------LVSAKSGEGIEDLFMCIAKEVP 176

Query: 532 QQNQNDAHAFEDDFNDAINIQLEGESNS-CSC 624
           ++             + +N+     SN  C+C
Sbjct: 177 KEKFLVKEVVNKKPKNILNLLGTTSSNDRCNC 208

>YKR014C Chr11 complement(465367..466071) [705 bp, 234 aa] {ON}
           YPT52Rab family GTPase, similar to Ypt51p and Ypt53p and
           to mammalian rab5; required for vacuolar protein sorting
           and endocytosis
          Length = 234

 Score =  105 bits (263), Expect = 2e-27
 Identities = 67/232 (28%), Positives = 114/232 (49%), Gaps = 33/232 (14%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD-------DKVVTMQV 186
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +         D V+  ++
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64

Query: 187 WDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFV 366
           WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +     
Sbjct: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVIY 121

Query: 367 ILGNKVDI-------------------EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAI 489
           +LGNKVD+                   E   + +S +  ++ A+  G +     SAK+  
Sbjct: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG-LLFREVSAKTGE 180

Query: 490 NVDTAFEEIA-------KSALQQNQNDAHAFEDDFNDAINIQLEGESNSCSC 624
            V   F++I        K  +   QN      ++    IN+Q    ++  SC
Sbjct: 181 GVKEIFQDIGEKLYDLKKDEILSKQNRQIGGGNNGQVDINLQRPSTNDPTSC 232

>NCAS0B07630 Chr2 complement(1443664..1444314) [651 bp, 216 aa] {ON}
           Anc_1.289
          Length = 216

 Score =  105 bits (261), Expect = 2e-27
 Identities = 57/181 (31%), Positives = 100/181 (55%), Gaps = 7/181 (3%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVL-----DDDKVVTMQVWD 192
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +     ++D V+  ++WD
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIWD 64

Query: 193 TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVIL 372
           TAGQER++SL   +YR A+  ++VYD+T   S    +SW +E     N    E     ++
Sbjct: 65  TAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFLV 121

Query: 373 GNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLT--SAKSAINVDTAFEEIAKSALQQNQN 546
           GNK+D+ + ++ +      E      +  L  T  SAK+   V   F  I +      ++
Sbjct: 122 GNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKKD 181

Query: 547 D 549
           +
Sbjct: 182 E 182

>ZYRO0G21384g Chr7 complement(1763055..1763711) [657 bp, 218 aa]
           {ON} highly similar to uniprot|Q75F92 Ashbya gossypii
           AAL176C AAL176Cp and similar to YKR014C uniprot|P36018
           Saccharomyces cerevisiae YKR014C YPT52 rab5-like GTPase
           involved in vacuolar protein sorting and endocytosis
           probable purine nucleotide-binding protein
          Length = 218

 Score =  105 bits (261), Expect = 2e-27
 Identities = 61/210 (29%), Positives = 110/210 (52%), Gaps = 14/210 (6%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD-----DKVVTMQVWD 192
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++D     + V+  ++WD
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKIEDKGSQQEVVIKFEIWD 64

Query: 193 TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVIL 372
           TAGQER++SL   +YR A+  ++VYDVT   S    + W +E          +     ++
Sbjct: 65  TAGQERYKSLAPMYYRNANAALVVYDVTQQDSLAKAQGWVNELKTKV---GEDDLVICLV 121

Query: 373 GNKVDI------EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
           GNK+D+        SK    E +  E   +   +     SAK+   V   F+ I +   +
Sbjct: 122 GNKLDLCTEEGESSSKPKAVESSDAEGYANEQGLLFHEVSAKTGEGVKQVFQSIGEKLYE 181

Query: 535 QNQND---AHAFEDDFNDAINIQLEGESNS 615
             +++   +   +    D +N+QL+  S +
Sbjct: 182 FKKHELANSKGRQGAGGDTVNVQLQRPSTN 211

>Kwal_56.22441 s56 complement(130807..131163) [357 bp, 118 aa] {OFF}
           [contig 185] FULL
          Length = 118

 Score =  102 bits (253), Expect = 2e-27
 Identities = 63/117 (53%), Positives = 70/117 (59%)
 Frame = -2

Query: 590 MLMASLKXXXXXXXXXXXXXXXXXAISSKAVSTFMALLALVKKRGTXXXXXXXXXXXXSL 411
           MLMASLK                 AISS AVST +  LALV+KRG              L
Sbjct: 1   MLMASLKSSSKASASAWLCCSALRAISSNAVSTLIEPLALVRKRGMFPKDLAMSCADLLL 60

Query: 410 TTFLESSISTLLPRITKGKDSGEDILA*TKNSSFQDFIFSKDFAFVTS*TSTQQSAP 240
           TTFL+SS S LLPRIT GK SGE+  A T+NSS  D +FSKD AFVTS T+TQQSAP
Sbjct: 61  TTFLDSSTSNLLPRITNGKVSGEETFAWTRNSSLHDLMFSKDLAFVTSYTNTQQSAP 117

>Suva_11.246 Chr11 complement(449412..450122) [711 bp, 236 aa] {ON}
           YKR014C (REAL)
          Length = 236

 Score =  104 bits (260), Expect = 5e-27
 Identities = 65/223 (29%), Positives = 110/223 (49%), Gaps = 28/223 (12%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD---------DKVVTM 180
           K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +           D V+  
Sbjct: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNEANAKDVVIKF 64

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
           ++WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +   
Sbjct: 65  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLV 121

Query: 361 FVILGNKVDI-------------------EDSKKVVSEKAGQELAKSLGDVPLFLTSAKS 483
             +LGNKVD+                   E  ++ +S +  ++ A+  G +     SAK+
Sbjct: 122 IYLLGNKVDLCLGTPGAEIGQESKEDGDNEPKERAISTEEARQYAQEQG-LLFREVSAKT 180

Query: 484 AINVDTAFEEIAKSALQQNQNDAHAFEDDFNDAINIQLEGESN 612
              V   F EI +      +       D+     N Q+ G +N
Sbjct: 181 GEGVKDIFREIGEKLYDLKR-------DEILSKQNRQINGGNN 216

>Suva_4.526 Chr4 complement(909423..910019) [597 bp, 198 aa] {ON}
           YBR264C (REAL)
          Length = 198

 Score =  103 bits (257), Expect = 5e-27
 Identities = 66/205 (32%), Positives = 113/205 (55%), Gaps = 5/205 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVVLDD---DKVVTMQVW 189
           +KV++LGDS VGKTS++ R  + K+ +++ ATIGA F+TK  EV   D   +K + M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFPEKHAATIGAAFVTKTIEVPTSDTSTEKRIHMEIW 64

Query: 190 DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVI 369
           DTAGQER++SL   +YR A+  +LV+++ NA S +   +W  +    A     +    ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELNNAASLQCAMTWFQDLQDRA-----QETKVIL 119

Query: 370 LGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           +GNK D+   +    + +  E+   L  VP    SAK+  N D A  +I  S +  +Q  
Sbjct: 120 VGNKHDLVSQE----QSSEVEIPVELQGVPYVPVSAKTGYNFD-ALNKIIISLIPDDQFK 174

Query: 550 AHAFEDDFNDAINIQLEGESNSCSC 624
             + +++  + + +  +   N C C
Sbjct: 175 T-SKDNEQGNKVELNNKSSRNGCIC 198

>YBR264C Chr2 complement(737770..738369) [600 bp, 199 aa] {ON}
           YPT10Rab family GTP-binding protein that contains the
           PEST signal sequence specific for proteolytic enzymes;
           may be involved in vesicular transport; overexpression
           leads to accumulation of Golgi-like cisternae with
           budding vesicles
          Length = 199

 Score =  103 bits (256), Expect = 8e-27
 Identities = 66/206 (32%), Positives = 114/206 (55%), Gaps = 6/206 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVVLDD---DKVVTMQVW 189
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK  EV  +D   +K + M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 190 DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVI 369
           DTAGQER++SL   +YR A+  ++V+++ +  S +  K+W  +    A     +    +I
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRA-----QGTQVII 119

Query: 370 LGNKVDIEDSKKVVSEKAGQ-ELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQN 546
           +GNK D+     V  E +G+  +   L  +P    SAK+  N DT   +I  S + ++Q 
Sbjct: 120 VGNKYDL-----VCEEHSGEVTIPAELQGLPYVAVSAKTGYNFDT-LNKIIISLVPESQF 173

Query: 547 DAHAFEDDFNDAINIQLEGESNSCSC 624
              +  ++  + + I  +   + C C
Sbjct: 174 KTLSKNNEQGNILEINKKKSGSGCIC 199

>NDAI0B04180 Chr2 (1055285..1056274) [990 bp, 329 aa] {ON} Anc_2.182
          Length = 329

 Score =  105 bits (263), Expect = 1e-26
 Identities = 68/190 (35%), Positives = 109/190 (57%), Gaps = 6/190 (3%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  + ++  +  +Y  TI  D   K+VV+DD KV 
Sbjct: 1   MSLNKSNIREFKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTI-EDSYRKQVVIDD-KVT 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + V DTAGQE + ++   + R  +  VLVY +T+  SFE + ++  +      +   + 
Sbjct: 59  VLDVLDTAGQEEYSAMREQYMRTGEGFVLVYSITSKNSFEELMTYYQQI---QRVKDSDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK---- 522
            P VI+GNK D+ED ++ VS +AG  LAK + + P   TSAK AINV+ AF  + +    
Sbjct: 116 IPVVIVGNKSDLEDERQ-VSYQAGVNLAKQM-NAPFLETSAKQAINVEEAFYTLVRLVRD 173

Query: 523 SALQQNQNDA 552
           +  + N+N+A
Sbjct: 174 NGGEYNKNNA 183

>CAGL0I09306g Chr9 complement(897357..897977) [621 bp, 206 aa] {ON}
           similar to uniprot|P38146 Saccharomyces cerevisiae
           YBR264c GTP-binding protein
          Length = 206

 Score =  102 bits (254), Expect = 2e-26
 Identities = 61/206 (29%), Positives = 109/206 (52%), Gaps = 6/206 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVVLDDDKV-VTMQVWDT 195
           LKV++LG+S VGK++++ R+   KY +   ATIGA ++TK  E + D D   V +++WDT
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKYLRN-NATIGAAYVTKDLEYIRDGDVYQVRLEIWDT 69

Query: 196 AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILG 375
           AGQER++SL   +YR  D  ++V+DV+N +S      W DE   +      E    V++G
Sbjct: 70  AGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINIVLVG 129

Query: 376 NKVDI--EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           NK+D+  ++ +  + ++  ++             SAKS   ++  F+ I K         
Sbjct: 130 NKMDLCSDEERSTLPQRVEEQFQ---------AVSAKSGEGIEELFDHIVKGIPSDQFTL 180

Query: 550 AHAFEDDFNDAINIQLEGE-SNSCSC 624
             A  +  ++ +N+  +    ++C+C
Sbjct: 181 KSAAVEQPDNVVNLNNKSVLQSTCNC 206

>TDEL0D02060 Chr4 (403098..403706) [609 bp, 202 aa] {ON} Anc_1.338
           YBR264C
          Length = 202

 Score =  102 bits (253), Expect = 2e-26
 Identities = 57/168 (33%), Positives = 94/168 (55%), Gaps = 4/168 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVVLDDDKV--VTMQVWD 192
           LK+++LG+S VGK+S++ RYV   + Q+  ATIGA F T+  EV   D  +  + +++WD
Sbjct: 13  LKLVLLGESSVGKSSIVMRYVTGSF-QKTNATIGAAFTTRTFEVPQCDGSIKRINLEIWD 71

Query: 193 TAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVIL 372
           TAGQER++SL   ++R  D  ++V+DVT  +S    +SW +E   +      +     ++
Sbjct: 72  TAGQERYRSLAPMYFRNTDIALVVFDVTKPESLRKAQSWIEELNSYVEEDRRDDLRIKVI 131

Query: 373 GNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEI 516
           GNK D+E            +   ++  +PLF  SAK+   +D  FE +
Sbjct: 132 GNKKDLE-----------HDPVGTIEGLPLFTVSAKTGEGIDELFESL 168

>SAKL0D06490g Chr4 complement(531028..531684) [657 bp, 218 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 218

 Score =  101 bits (252), Expect = 5e-26
 Identities = 68/216 (31%), Positives = 107/216 (49%), Gaps = 16/216 (7%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD---------DKVVT 177
           LK+++LG+S VGK+S++ R+    + +   ATIGA F TK + L+          DK + 
Sbjct: 9   LKLVLLGESSVGKSSIVTRFTTGNFHRS-NATIGAAFTTKTLSLESIVPETGETIDKKIK 67

Query: 178 MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESF 357
           +++WDTAGQER++SL   +YR  D  ++V+DVTN  S    +SW DE   + N    E  
Sbjct: 68  LEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHEER 127

Query: 358 PFV--ILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSA- 528
             +  I+GNK+D+    +   E       +  G    F  SAK+   +D  F+ I K   
Sbjct: 128 GILIKIVGNKIDLNPEAR---ETQNLPYIQDQG-YNWFPVSAKTGDGIDELFDTIVKEIP 183

Query: 529 ----LQQNQNDAHAFEDDFNDAINIQLEGESNSCSC 624
                +QN    +         +++  +   NSCSC
Sbjct: 184 WEKFTRQNLQKTNEIRPK-KSIVDLGSQKVMNSCSC 218

>Skud_2.397 Chr2 complement(706771..707370) [600 bp, 199 aa] {ON}
           YBR264C (REAL)
          Length = 199

 Score =  100 bits (250), Expect = 6e-26
 Identities = 67/208 (32%), Positives = 113/208 (54%), Gaps = 8/208 (3%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVVLDD---DKVVTMQVW 189
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK  EV   D   +K + M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFVTKTIEVPCGDAAIEKRIHMEIW 64

Query: 190 DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVI 369
           DTAGQER++SL   +YR A+  +LV+++ +  S     +W  +    A     +    ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELGDTASLRCAMTWFQDLQDRA-----QETQVIL 119

Query: 370 LGNKVDI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
           +GNK D+   E SK+V       ++   L  +P    SAK+  N   A  +I    + ++
Sbjct: 120 VGNKYDLVGEERSKEV-------DIPAELQGLPYVPVSAKTGYNFG-ALNDIVIRLVPED 171

Query: 541 QNDAHAFEDDFNDAINIQLEGESNSCSC 624
           Q    + +++ N+ + I  +G   SC C
Sbjct: 172 QFKTLSKDNEQNNRLEINKKGSRGSCIC 199

>YOR101W Chr15 (515244..516173) [930 bp, 309 aa] {ON}  RAS1GTPase
           involved in G-protein signaling in the adenylate cyclase
           activating pathway, plays a role in cell proliferation;
           localized to the plasma membrane; homolog of mammalian
           RAS proto-oncogenes
          Length = 309

 Score =  101 bits (252), Expect = 3e-25
 Identities = 59/165 (35%), Positives = 98/165 (59%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++G  GVGK++L  +++   +  +Y  TI  D   K+VV+DD KV  + + DTAGQE
Sbjct: 12  KIVVVGGGGVGKSALTIQFIQSYFVDEYDPTI-EDSYRKQVVIDD-KVSILDILDTAGQE 69

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY VT+  SF+ + S+  +      +   +  P V++GNK+D
Sbjct: 70  EYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLD 126

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +E+ ++ VS + G  LAK L + P   TSAK AINVD AF  + +
Sbjct: 127 LENERQ-VSYEDGLRLAKQL-NAPFLETSAKQAINVDEAFYSLIR 169

>Smik_15.281 Chr15 (476294..477232) [939 bp, 312 aa] {ON} YOR101W
           (REAL)
          Length = 312

 Score =  101 bits (252), Expect = 3e-25
 Identities = 63/187 (33%), Positives = 107/187 (57%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+DD KV  + + DTAGQE
Sbjct: 12  KLVVVGGGGVGKSALTIQLIQSYFVDEYDPTI-EDSYRKQVVIDD-KVSILDILDTAGQE 69

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY VT+  SF+ + S+  +      +   +  P V++GNK+D
Sbjct: 70  EYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLD 126

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           +E+ ++ VS + G  LAK L + P   TSAK AINVD AF  + +  ++ +    ++  D
Sbjct: 127 LENERQ-VSYEDGLRLAKQL-NAPFLETSAKQAINVDEAFYSLIR-LVRDDGGQYNSMND 183

Query: 568 DFNDAIN 588
             +DA N
Sbjct: 184 QPDDAAN 190

>Skud_15.266 Chr15 (471563..472504) [942 bp, 313 aa] {ON} YOR101W
           (REAL)
          Length = 313

 Score =  101 bits (251), Expect = 4e-25
 Identities = 67/207 (32%), Positives = 113/207 (54%), Gaps = 2/207 (0%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M+  K  I   K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+DD KV 
Sbjct: 1   MLGNKSTIREYKIVVVGGGGVGKSALTIQLIQSYFVDEYDPTI-EDSYRKQVVIDD-KVS 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY VT+  SF+ + S+  +      +   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
            P V++GNK+D+E+ ++ VS + G  LAK L + P   TSAK AINVD AF  + +  ++
Sbjct: 116 IPVVVVGNKLDLENERQ-VSYEDGLRLAKQL-NAPFLETSAKQAINVDEAFYSLIR-LVR 172

Query: 535 QNQNDAHAFEDDFNDAINIQLEGESNS 615
            +    ++     +DA       +SNS
Sbjct: 173 DDGGKYNSMNGQADDATTPNKTRKSNS 199

>NCAS0B06850 Chr2 (1305199..1306173) [975 bp, 324 aa] {ON} Anc_2.182
          Length = 324

 Score =  100 bits (250), Expect = 7e-25
 Identities = 63/176 (35%), Positives = 101/176 (57%), Gaps = 2/176 (1%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  + ++  +  +Y  TI  D   K+VV+DD KV 
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTI-EDSYRKQVVIDD-KVT 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + V DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  +      +   + 
Sbjct: 59  VLDVLDTAGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQI---QRVKDSDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
            P VI+GNK D+ED ++ V  ++G  LAK + + P   TSAK AINV+ AF  + +
Sbjct: 116 IPVVIVGNKSDLEDERQ-VPYQSGVNLAKQM-NAPFLETSAKQAINVEEAFYTLVR 169

>NDAI0B04680 Chr2 complement(1157279..1157950) [672 bp, 223 aa] {ON}
           Anc_1.338
          Length = 223

 Score = 98.6 bits (244), Expect = 8e-25
 Identities = 67/214 (31%), Positives = 114/214 (53%), Gaps = 14/214 (6%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKV--------VTM 180
           LKV++LG+S VGKTS++ +    K+ Q+  ATIGA F TK++  ++ +         V++
Sbjct: 13  LKVVLLGESSVGKTSIVTKISTGKF-QKGAATIGAAFTTKQIQFNEIEENGVEQCFKVSI 71

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISS--PES 354
           ++WDTAGQER++SL   +YR  D  ++V+D+T   S +  +SW DE   + + SS   + 
Sbjct: 72  EIWDTAGQERYRSLTPMYYRNTDVALIVFDLTQEASLKKARSWIDELKSYLDSSSRRDKH 131

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAK--SLGDVPLFLTSAKSAINVDTAFEEIAKSA 528
              +++ NKVD+  +K   +    Q L       + PL + SAK+   ++  F++I K  
Sbjct: 132 ISMILVANKVDLV-AKNDGTFDINQYLENWDIPSEYPLKIVSAKTNEGINELFDDIIKKI 190

Query: 529 LQQN--QNDAHAFEDDFNDAINIQLEGESNSCSC 624
            +    + DA A        +N  +   S  C+C
Sbjct: 191 PKDQFVKEDAQARRPS-TIQLNSSIADNSTGCNC 223

>TPHA0B03000 Chr2 complement(683258..684175) [918 bp, 305 aa] {ON}
           Anc_2.182 YNL098C
          Length = 305

 Score =  100 bits (248), Expect = 1e-24
 Identities = 63/189 (33%), Positives = 105/189 (55%), Gaps = 5/189 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++G  GVGK++L  + +   +  +Y  TI  D   K++VLD+D V  + + DTAGQE
Sbjct: 11  KLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQIVLDND-VSILDILDTAGQE 68

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY VT+  S+E + ++  +      +   +  P V++GNK D
Sbjct: 69  EYSAMREQYMRTGEGFLLVYSVTSRNSYEELLNYYQQI---QRVKDADYIPIVVVGNKSD 125

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN-----QNDA 552
           +E +++ VS + G  LAK +   P F TSAK  INV  AF E+++    +      QN  
Sbjct: 126 LE-TERQVSYEEGMNLAKHM-TAPFFETSAKQDINVQDAFYELSRLVRDEGGAYNIQNIE 183

Query: 553 HAFEDDFND 579
           HA E D N+
Sbjct: 184 HANEHDENN 192

>Suva_8.155 Chr8 (272370..273320) [951 bp, 316 aa] {ON} YOR101W
           (REAL)
          Length = 316

 Score = 99.4 bits (246), Expect = 2e-24
 Identities = 63/171 (36%), Positives = 99/171 (57%), Gaps = 2/171 (1%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M A K  I   K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+DD KV 
Sbjct: 1   MPANKSTIREYKLVVVGGGGVGKSALTIQLIQSYFVDEYDPTI-EDSYRKQVVIDD-KVS 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY VT+  SF+ + S+  +      +   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF 507
            P V++GNK+D+E+ ++ VS + G  LAK L + P   TSAK AINVD AF
Sbjct: 116 IPVVVVGNKLDLENERQ-VSYEDGLRLAKQL-NAPFLETSAKQAINVDEAF 164

>TDEL0F01360 Chr6 complement(241607..242470) [864 bp, 287 aa] {ON}
           Anc_2.182 YNL098C
          Length = 287

 Score = 98.6 bits (244), Expect = 3e-24
 Identities = 60/176 (34%), Positives = 99/176 (56%), Gaps = 2/176 (1%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+DD KV 
Sbjct: 1   MSMNKSNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQVVIDD-KVT 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY VT+  SF+ + ++  +      +   E 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELMTYYQQI---QRVKDVEY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
            P V++GNK D+E+ ++V  E  G  +AK + + P   TSAK A+NVD AF  + +
Sbjct: 116 VPVVVVGNKSDLEEERQVAYED-GLNMAKQI-NAPFLETSAKQAVNVDEAFYTLVR 169

>KAFR0J01970 Chr10 (379033..379989) [957 bp, 318 aa] {ON} Anc_2.182
           YNL098C
          Length = 318

 Score = 99.0 bits (245), Expect = 3e-24
 Identities = 61/176 (34%), Positives = 101/176 (57%), Gaps = 2/176 (1%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  + ++  +  +Y  TI  D   K+VV+D+ KV 
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTI-EDSYRKQVVIDN-KVT 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  +      +   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQI---QRVKDSDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
            P VI+GNK D+ED ++ VS + GQ +A  + + P   TSAK AINV+ AF  + +
Sbjct: 116 IPVVIVGNKSDLEDERQ-VSYEDGQHIATQM-NAPFLETSAKQAINVEEAFYSLVR 169

>KLLA0C13387g Chr3 complement(1142002..1142841,1143162..1143176)
           [855 bp, 284 aa] {ON} similar to uniprot|P01120
           Saccharomyces cerevisiae YNL098C RAS2 GTP-binding
           protein that regulates the nitrogen starvation response,
           sporulation, and filamentous growth; farnesylation and
           palmitoylation required for activity and localization to
           plasma membrane; homolog of mammalian Ras
           proto-oncogenes
          Length = 284

 Score = 97.8 bits (242), Expect = 5e-24
 Identities = 59/171 (34%), Positives = 95/171 (55%), Gaps = 2/171 (1%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  + +   +  +Y  TI   +  + V+  DDKV 
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQAVI--DDKVS 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  + L    +   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQIL---RVKDSDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF 507
            P  ++GNK D+ED ++ VS + GQ LAK   D P   TSAK  INV+ +F
Sbjct: 116 VPVFVIGNKSDLEDERQ-VSYEEGQTLAKQF-DAPFLETSAKQNINVEESF 164

>CAGL0B04521g Chr2 complement(439732..440751) [1020 bp, 339 aa] {ON}
           similar to uniprot|P01120 Saccharomyces cerevisiae
           YNL098c RAS2 GTP-binding protein or uniprot|P01119
           Saccharomyces cerevisiae YOR101w RAS1
          Length = 339

 Score = 98.6 bits (244), Expect = 6e-24
 Identities = 60/165 (36%), Positives = 96/165 (58%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++G  GVGK++L  + V+  +  +Y  TI  D   K+VV+DD KV  + + DTAGQE
Sbjct: 10  KLVVVGGGGVGKSALTIQLVHSHFVDEYDPTI-EDSYRKQVVIDD-KVTILDILDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY VT+  SFE + ++  +      +   E  P V++GNK D
Sbjct: 68  EYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQI---QRVKDVEYIPVVVVGNKSD 124

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +E  ++V  E+ G  LAK L + P   TSAK AINV+ AF  + +
Sbjct: 125 LETERQVSFEE-GASLAKQL-NAPFLETSAKQAINVEDAFYTLVR 167

>TBLA0B01750 Chr2 complement(392769..393890) [1122 bp, 373 aa] {ON}
           Anc_2.182 YNL098C
          Length = 373

 Score = 99.0 bits (245), Expect = 7e-24
 Identities = 64/196 (32%), Positives = 105/196 (53%), Gaps = 12/196 (6%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  R +   +  +Y  TI  D   K+VV+DD KV 
Sbjct: 1   MPLNKSNIREYKLVVVGGGGVGKSALTIRLIQSHFVDEYDPTI-EDSYRKQVVIDD-KVT 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  +      +   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFEELMNYYQQI---QRVKDTDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK---- 522
            P +++GNK D+E  ++V  E+ G  +AK +   P   TSAK AINV+ AF  + +    
Sbjct: 116 VPIMVVGNKSDLEIERQVTFEE-GMTMAKQMNS-PFLETSAKEAINVEDAFYNLVRLVRD 173

Query: 523 ------SALQQNQNDA 552
                  +LQ N +D+
Sbjct: 174 DGGKFNKSLQNNNDDS 189

>KAFR0D02040 Chr4 complement(412576..413382,413464..413481) [825 bp,
           274 aa] {ON} Anc_2.182 YNL098C
          Length = 274

 Score = 96.7 bits (239), Expect = 1e-23
 Identities = 57/196 (29%), Positives = 112/196 (57%)
 Frame = +1

Query: 31  VIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQER 210
           + ++G  G+GK+++  R++  +++ +Y  TI  D   K++ +D+ K  T+ + DTAGQE 
Sbjct: 16  IAVVGSGGIGKSAITIRFIQSRFTDEYDPTI-EDSYRKQLTVDNAKY-TIDILDTAGQEE 73

Query: 211 FQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVDI 390
           +  +   + R  D  +LVY +++ +S++ + ++  + L    +   E  P V++GNK D+
Sbjct: 74  YYMMREQYMRNCDGFLLVYSISSMQSYDELLNFYHQIL---RVKEVEYIPIVVIGNKSDL 130

Query: 391 EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFEDD 570
           E S++ VS K G+++  ++   P F TSAK  +N+D AF+ + +  L+ N  + +   D 
Sbjct: 131 E-SERQVSFKEGEQMGCNISG-PFFETSAKYGLNIDVAFQSLVR-LLRDNGGEYNKTNDI 187

Query: 571 FNDAINIQLEGESNSC 618
            N A ++     S+SC
Sbjct: 188 ENAASSV-----SSSC 198

>Kpol_1029.8 s1029 complement(15899..16816) [918 bp, 305 aa] {ON}
           complement(15899..16816) [918 nt, 306 aa]
          Length = 305

 Score = 97.1 bits (240), Expect = 1e-23
 Identities = 57/165 (34%), Positives = 95/165 (57%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++G  GVGK++L  + +  ++  +Y  TI  D   K++VLDD  V  + + DTAGQE
Sbjct: 12  KLVVVGGGGVGKSALTIQLIQSQFVDEYDPTI-EDSYRKQIVLDDS-VAILDILDTAGQE 69

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY VT+  S+E + S+  +      +   E  P V++GNK D
Sbjct: 70  EYSAMREQYMRTGEGFLLVYSVTSRNSYEELMSYYQQI---QRVKDTEYIPVVVVGNKSD 126

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +E +++ VS + G  LAK + + P   TSAK  INV  AF  +A+
Sbjct: 127 LE-TERQVSYEEGMSLAKQM-NAPFLETSAKQDINVQDAFYNLAR 169

>Kpol_1066.11 s1066 complement(18137..18865) [729 bp, 242 aa] {ON}
           complement(18137..18865) [729 nt, 243 aa]
          Length = 242

 Score = 95.1 bits (235), Expect = 3e-23
 Identities = 59/187 (31%), Positives = 96/187 (51%), Gaps = 21/187 (11%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKV----------- 171
           LK+++LGDS VGKTS++ R     +     ATIGA F+T  + +DD+++           
Sbjct: 19  LKLVLLGDSSVGKTSIVGRLTTGNFINS-NATIGAAFVTTTIEVDDEEMINGGNNGMSSK 77

Query: 172 ------VTMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHA 333
                 V  ++WDTAGQER++SL   +YR  D  ++V+D++  +SF+  +SW +E   + 
Sbjct: 78  RSIKKRVNFEIWDTAGQERYRSLAPMYYRNTDVALIVFDLSRPQSFKGAQSWIEELNSYV 137

Query: 334 NISSPESFPFVILGNKVDIE----DSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDT 501
             SS      V++G+K DIE        ++      +  K+L  V     SAK+   +  
Sbjct: 138 EESSRGEIITVLVGSKKDIEIGQPSMAPIIDNFDKLKFTKNLQKV-----SAKTGEGIQE 192

Query: 502 AFEEIAK 522
            FE I +
Sbjct: 193 LFENIVR 199

>YNL098C Chr14 complement(439602..440570) [969 bp, 322 aa] {ON}
           RAS2GTP-binding protein that regulates the nitrogen
           starvation response, sporulation, and filamentous
           growth; farnesylation and palmitoylation required for
           activity and localization to plasma membrane; homolog of
           mammalian Ras proto-oncogenes
          Length = 322

 Score = 96.7 bits (239), Expect = 3e-23
 Identities = 64/208 (30%), Positives = 107/208 (51%), Gaps = 12/208 (5%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  +     +  +Y  TI  D   K+VV+DD+ V 
Sbjct: 1   MPLNKSNIREYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDE-VS 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY +T+  S + + ++  + L    +   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK---- 522
            P V++GNK D+E+ K+ VS + G  +AK + + P   TSAK AINV+ AF  +A+    
Sbjct: 116 VPIVVVGNKSDLENEKQ-VSYQDGLNMAKQM-NAPFLETSAKQAINVEEAFYTLARLVRD 173

Query: 523 ------SALQQNQNDAHAFEDDFNDAIN 588
                   L +N N     +D      N
Sbjct: 174 EGGKYNKTLTENDNSKQTSQDTKGSGAN 201

>Suva_14.241 Chr14 complement(437053..438021) [969 bp, 322 aa] {ON}
           YNL098C (REAL)
          Length = 322

 Score = 95.9 bits (237), Expect = 5e-23
 Identities = 59/176 (33%), Positives = 100/176 (56%), Gaps = 2/176 (1%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  +     +  +Y  TI  D   K+VV+DD+ V 
Sbjct: 1   MPLNKSNIREYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDE-VS 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY +T+  S + + ++  + L    +   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
            P V++GNK D+E+ K+ VS + G  +AK + + P   TSAK AINV+ AF  +A+
Sbjct: 116 VPIVVVGNKSDLENEKQ-VSYQDGLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>Kwal_26.8387 s26 (763564..764442) [879 bp, 292 aa] {ON} YNL098C
           (RAS2) - Small, GTP-binding protein [contig 60] FULL
          Length = 292

 Score = 95.1 bits (235), Expect = 6e-23
 Identities = 56/160 (35%), Positives = 93/160 (58%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+DD KV  + + DTAGQE
Sbjct: 18  KLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQVVIDD-KVSILDILDTAGQE 75

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY VT+  SF+ + ++  + L    +   +  P  ++GNK D
Sbjct: 76  EYSAMREQYMRTGEGFLLVYSVTSRTSFDELMTYYQQIL---RVKDADYVPVFLVGNKSD 132

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF 507
           +ED ++V  E+ G  LAK   + P   TSAK AINV+ +F
Sbjct: 133 LEDERQVAYEE-GVSLAKQF-NAPFMETSAKQAINVEDSF 170

>KLTH0D08932g Chr4 (742772..742786,742899..743762) [879 bp, 292 aa]
           {ON} similar to uniprot|P01120 Saccharomyces cerevisiae
           YNL098C RAS2 GTP-binding protein that regulates the
           nitrogen starvation response, sporulation, and
           filamentous growth; farnesylation and palmitoylation
           required for activity and localization to plasma
           membrane; homolog of mammalian Ras proto-oncogenes
          Length = 292

 Score = 94.7 bits (234), Expect = 9e-23
 Identities = 63/189 (33%), Positives = 102/189 (53%), Gaps = 4/189 (2%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+D  KV 
Sbjct: 1   MSLNKNNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQVVVDG-KVS 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  + L    +   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQIL---RVKDADY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
            P  ++GNK D+ED ++V  E+ G  LAK   + P   TSAK AINV+ +F  + +    
Sbjct: 116 VPVFLVGNKSDLEDERQVAYEE-GVSLAKQF-NAPFLETSAKQAINVEESFYGLVRLVRD 173

Query: 535 QN--QNDAH 555
           +    N AH
Sbjct: 174 EGAVYNPAH 182

>Smik_14.227 Chr14 complement(419257..420225) [969 bp, 322 aa] {ON}
           YNL098C (REAL)
          Length = 322

 Score = 95.1 bits (235), Expect = 1e-22
 Identities = 55/165 (33%), Positives = 96/165 (58%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++G  GVGK++L  +     +  +Y  TI  D   K+VV+DD+ V  + + DTAGQE
Sbjct: 12  KLVVVGGGGVGKSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDE-VSILDILDTAGQE 69

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY +T+  S + + ++  + L    +   +  P V++GNK D
Sbjct: 70  EYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGNKSD 126

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +E+ K+ VS + G  +AK + + P   TSAK AINV+ AF  +A+
Sbjct: 127 LENEKQ-VSYQDGLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>Skud_14.232 Chr14 complement(429739..430710) [972 bp, 323 aa] {ON}
           YNL098C (REAL)
          Length = 323

 Score = 95.1 bits (235), Expect = 1e-22
 Identities = 55/165 (33%), Positives = 96/165 (58%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++G  GVGK++L  +     +  +Y  TI  D   K+VV+DD+ V  + + DTAGQE
Sbjct: 12  KLVVVGGGGVGKSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDE-VSILDILDTAGQE 69

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY +T+  S + + ++  + L    +   +  P V++GNK D
Sbjct: 70  EYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGNKSD 126

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +E+ K+ VS + G  +AK + + P   TSAK AINV+ AF  +A+
Sbjct: 127 LENEKQ-VSYQDGLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>KNAG0H03380 Chr8 (632140..633114) [975 bp, 324 aa] {ON} Anc_2.182
           YNL098C
          Length = 324

 Score = 94.7 bits (234), Expect = 1e-22
 Identities = 56/165 (33%), Positives = 94/165 (56%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K +++G  GVGK++L  R+++  +  +Y  TI  D   K+V+LD  +V  + + DTAGQE
Sbjct: 11  KAVVVGGGGVGKSALTIRFIHSHFVDEYDPTI-EDSYRKQVILDG-QVKVLDILDTAGQE 68

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY VT+  SFE + ++  +      +   +  P V++GNK D
Sbjct: 69  EYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQI---QRVKDSDYVPVVVVGNKSD 125

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +ED ++ VS   G  LA+ +   P   TSAK AIN D +F  +A+
Sbjct: 126 LEDERQ-VSYDEGVALAQQM-KAPFLETSAKQAINTDESFYTLAR 168

>Kwal_14.2484 s14 complement(777938..778549) [612 bp, 203 aa] {ON}
           YOR089C (VPS21) - small GTP-binding protein;
           geranylgeranylated; geranylgeranylation required for
           membrane association; also involved in endocytosis post
           vesicle internalization [contig 224] FULL
          Length = 203

 Score = 91.3 bits (225), Expect = 3e-22
 Identities = 58/185 (31%), Positives = 96/185 (51%), Gaps = 10/185 (5%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDD---KVVTMQVWDT 195
           LK+++LG+S VGK++L+ R+    + +   ATIGA F TK +  + +   K V  ++WDT
Sbjct: 10  LKLVLLGESSVGKSALVTRFTTGSFHKS-NATIGAAFTTKVISWETETARKEVKFEIWDT 68

Query: 196 AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILG 375
           AGQER+++L   +YR  D   +V+DVT   +     SW  E   +       +    ++G
Sbjct: 69  AGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIKLIG 128

Query: 376 NKVDIEDS---KKV----VSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
           NK+D+ D    +KV    VS K G+ +A     V   + S+K  + +DT     A + + 
Sbjct: 129 NKIDLLDEVPPRKVGWTPVSAKTGEGVADLFESVAREVPSSKFKV-IDTTAPSSADNTVD 187

Query: 535 QNQND 549
              +D
Sbjct: 188 LRSSD 192

>KLLA0F01232g Chr6 complement(114430..115062) [633 bp, 210 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 210

 Score = 91.3 bits (225), Expect = 4e-22
 Identities = 65/214 (30%), Positives = 105/214 (49%), Gaps = 14/214 (6%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTK--EVVLDDDKV---VTMQVW 189
           +K+++LG+S VGK++++ R+   ++      TIGA F TK  E V  +D +   V  ++W
Sbjct: 10  VKLVLLGESSVGKSTIVTRFTTGEFHIN-SPTIGAAFSTKAMEWVDSEDGIKRRVNFEIW 68

Query: 190 DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVI 369
           DTAGQER++SL   +YR  D  ++V+DVT   S +  +SW DE   +      ++    +
Sbjct: 69  DTAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRV 128

Query: 370 LGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK----SALQQ 537
           +GNK+D+ D          +E  ++  D    L SAK+   +D  F +I K         
Sbjct: 129 VGNKIDLVD----------EETLQNWNDAE--LVSAKTGEGIDELFLKIGKDIPIDKFTL 176

Query: 538 NQNDAHAFEDDFNDAINIQLEG-----ESNSCSC 624
            Q D        N+   I LE       + +CSC
Sbjct: 177 LQEDVPQSTSTSNEGGGINLEQSPEAVSTGNCSC 210

>KLTH0H10274g Chr8 complement(882443..883048) [606 bp, 201 aa] {ON}
           weakly similar to uniprot|P36018 Saccharomyces
           cerevisiae YKR014C YPT52 rab5-like GTPase involved in
           vacuolar protein sorting and endocytosis; probable
           purine nucleotide-binding protein
          Length = 201

 Score = 90.9 bits (224), Expect = 4e-22
 Identities = 57/165 (34%), Positives = 86/165 (52%), Gaps = 10/165 (6%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDD---KVVTMQVWDT 195
           LK+++LG+S VGK++L+ R+    + +   ATIGA F TK V  + +   K V  ++WDT
Sbjct: 10  LKLVLLGESSVGKSALVTRFTTGAFHKN-NATIGAAFTTKVVSWETNEAIKQVKFEIWDT 68

Query: 196 AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILG 375
           AGQER++SL   +YR  D   +V+DVT+  +F    SW DE   +            ++G
Sbjct: 69  AGQERYRSLTPMYYRKTDVAFVVFDVTDDATFSKAGSWIDELKGYMQSEDAHDIIIKLVG 128

Query: 376 NKVDIED-------SKKVVSEKAGQELAKSLGDVPLFLTSAKSAI 489
           NK D+ D           VS K G+ +A     V   + S+K  I
Sbjct: 129 NKTDLLDHVPDTTLEWTPVSAKTGEGVANLFESVAREVPSSKFTI 173

>Ecym_5349 Chr5 complement(708225..709076,709277..709288) [864 bp,
           287 aa] {ON} similar to Ashbya gossypii ADL262W
          Length = 287

 Score = 92.0 bits (227), Expect = 8e-22
 Identities = 62/198 (31%), Positives = 105/198 (53%), Gaps = 4/198 (2%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           MI       K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+D  +V  +
Sbjct: 2   MIKNSIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQVVIDG-QVSIL 59

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
            + DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  + L    +   +  P
Sbjct: 60  DILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQIL---RVKDVDYVP 116

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ-- 534
             ++GNK D+ED ++ VS + G  LAK   +     TSAK AINV+ +F  +A+      
Sbjct: 117 IFVVGNKSDLEDERQ-VSYEEGVNLAKHF-NASFLETSAKQAINVEDSFYGLARLVRDDG 174

Query: 535 --QNQNDAHAFEDDFNDA 582
              N N++  F+   +DA
Sbjct: 175 GIHNINNSKRFDHSNDDA 192

>SAKL0E10252g Chr5 (855721..855735,855900..856691) [807 bp, 268 aa]
           {ON} similar to uniprot|P01119 Saccharomyces cerevisiae
           YOR101W RAS1 GTPase involved in G-protein signaling in
           the adenylate cyclase activating pathway, plays a role
           in cell proliferation; localized to the plasma membrane;
           homolog of mammalian RAS proto-oncogenes
          Length = 268

 Score = 91.7 bits (226), Expect = 8e-22
 Identities = 55/160 (34%), Positives = 94/160 (58%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+D+  V  + + DTAGQE
Sbjct: 13  KLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQVVIDNH-VSILDILDTAGQE 70

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            + ++   + R  +  +LVY VT+  SFE + ++  + L    +   +  P +++GNK D
Sbjct: 71  EYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQIL---RVKDVDYVPVLVVGNKSD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF 507
           +E S++ VS + G ++AK   + P   TSAK AINV+ AF
Sbjct: 128 LE-SERQVSYEEGAKMAKQF-NAPFLETSAKQAINVEEAF 165

>ZYRO0D14784g Chr4 complement(1247520..1248164) [645 bp, 214 aa]
           {ON} highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 90.1 bits (222), Expect = 1e-21
 Identities = 59/214 (27%), Positives = 109/214 (50%), Gaps = 18/214 (8%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 9   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF-------------EEIAKSA 528
           +++ +KV ++       K+L     +  SAKS  N +  F             E +A  A
Sbjct: 123 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPA 178

Query: 529 L-----QQNQNDAHAFEDDFNDAINIQLEGESNS 615
           L     Q ++N  H ++ +   A  + L  E ++
Sbjct: 179 LAPPEVQVDENLMHQYQQEMEQATALPLPDEDDA 212

>CAGL0J05632g Chr10 complement(539466..540032) [567 bp, 188 aa] {ON}
           highly similar to uniprot|P06781 Saccharomyces
           cerevisiae YNL090w RHO2
          Length = 188

 Score = 89.4 bits (220), Expect = 1e-21
 Identities = 55/181 (30%), Positives = 99/181 (54%), Gaps = 5/181 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++I+GD   GKTSL++ +   K+ +QY  T+  +++T   V  D   V++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDCRV--DGIKVSLALWDTAGQE 66

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WKDEFLVHANISSPESFPFVILGNKV 384
            ++ L    Y GAD  ++ + V N +S  N ++ W +E   +     P++ P +++G K 
Sbjct: 67  EYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYC----PDA-PVILVGLKE 121

Query: 385 DIEDSKK----VVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDA 552
           D+  SK+     V+ +  +++AK++G       SA +   VD  FE   +S+L  ++   
Sbjct: 122 DLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVDDVFELATRSSLLMHKEPD 181

Query: 553 H 555
           H
Sbjct: 182 H 182

>ZYRO0B09438g Chr2 (738659..739555) [897 bp, 298 aa] {ON} similar to
           uniprot|P01120 Saccharomyces cerevisiae YNL098C RAS2
           GTP-binding protein that regulates the nitrogen
           starvation response sporulation and filamentous growth
           farnesylation and palmitoylation required for activity
           and localization to plasma membrane homolog of mammalian
           Ras proto-oncogenes
          Length = 298

 Score = 91.7 bits (226), Expect = 1e-21
 Identities = 57/176 (32%), Positives = 98/176 (55%), Gaps = 2/176 (1%)
 Frame = +1

Query: 1   MIARKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVV 174
           M   K NI   K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+DD KV 
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQVVIDD-KVT 58

Query: 175 TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPES 354
            + + DTAGQE + ++   + R  +  +LVY VT+  SF+ + ++  +      +   + 
Sbjct: 59  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELLTYYQQI---QRVKDSDY 115

Query: 355 FPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
            P +++GNK D+ D ++ VS + G  +A+ +   P   TSAK AINV+ AF  + +
Sbjct: 116 VPVLVVGNKSDL-DEERQVSYEDGLHMAQQM-SAPFLETSAKQAINVEEAFYTLVR 169

>KLTH0G14850g Chr7 (1304240..1304884) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293C GSP1 GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization RNA processing and transport regulated by
           Prp20p Rna1p Yrb1p Yrb2p Yrp4p Yrb30p Cse1p and Kap95p
           yeast Gsp2p homolog
          Length = 214

 Score = 89.7 bits (221), Expect = 2e-21
 Identities = 53/174 (30%), Positives = 95/174 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        D  ++    VWDTAGQE
Sbjct: 9   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTDFGEL-KFDVWDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+      Q D
Sbjct: 123 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLD 172

>Suva_7.443 Chr7 complement(764401..765216) [816 bp, 271 aa] {ON}
           YGR152C (REAL)
          Length = 271

 Score = 90.9 bits (224), Expect = 2e-21
 Identities = 56/196 (28%), Positives = 106/196 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGIA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S E +   +++ L    I   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + ++++V+S + G E++   G VP + TSA    NVD  F ++ +  + +N+ ++ A +D
Sbjct: 120 L-NNERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQII-RNEMESVAIKD 177

Query: 568 DFNDAINIQLEGESNS 615
             N +        S+S
Sbjct: 178 ARNQSEQFNKNMSSSS 193

>Kwal_56.23361 s56 complement(508046..508690) [645 bp, 214 aa] {ON}
           YLR293C (GSP1) - GTP-binding protein [contig 181] FULL
          Length = 214

 Score = 89.4 bits (220), Expect = 2e-21
 Identities = 53/174 (30%), Positives = 95/174 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        D  ++    VWDTAGQE
Sbjct: 9   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTDFGEL-KFDVWDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+      Q D
Sbjct: 123 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLD 172

>Suva_8.241 Chr8 complement(432445..433107) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 89.4 bits (220), Expect = 3e-21
 Identities = 58/214 (27%), Positives = 109/214 (50%), Gaps = 18/214 (8%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 15  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 73

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF-------------EEIAKSA 528
           +++ +KV ++       K+L     +  SAKS  N +  F             E +A  A
Sbjct: 129 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPA 184

Query: 529 L-----QQNQNDAHAFEDDFNDAINIQLEGESNS 615
           L     Q ++   H ++ + + A  + L  E ++
Sbjct: 185 LAPPEVQVDEQLMHQYQQEMDQATALPLPDEDDA 218

>Smik_15.370 Chr15 complement(637457..638119) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 89.4 bits (220), Expect = 3e-21
 Identities = 58/214 (27%), Positives = 109/214 (50%), Gaps = 18/214 (8%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 15  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 73

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF-------------EEIAKSA 528
           +++ +KV ++       K+L     +  SAKS  N +  F             E +A  A
Sbjct: 129 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPA 184

Query: 529 L-----QQNQNDAHAFEDDFNDAINIQLEGESNS 615
           L     Q ++   H ++ + + A  + L  E ++
Sbjct: 185 LAPPEVQVDEQLMHQYQQEMDQATALPLPDEDDA 218

>YOR185C Chr15 complement(681444..682106) [663 bp, 220 aa] {ON}
           GSP2GTP binding protein (mammalian Ranp homolog)
           involved in the maintenance of nuclear organization, RNA
           processing and transport; interacts with Kap121p,
           Kap123p and Pdr6p (karyophilin betas); Gsp1p homolog
           that is not required for viability
          Length = 220

 Score = 89.4 bits (220), Expect = 3e-21
 Identities = 58/214 (27%), Positives = 109/214 (50%), Gaps = 18/214 (8%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 15  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 73

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAF-------------EEIAKSA 528
           +++ +KV ++       K+L     +  SAKS  N +  F             E +A  A
Sbjct: 129 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPA 184

Query: 529 L-----QQNQNDAHAFEDDFNDAINIQLEGESNS 615
           L     Q ++   H ++ + + A  + L  E ++
Sbjct: 185 LAPPEVQVDEQLMHQYQQEMDQATALPLPDEDDA 218

>TDEL0F02770 Chr6 complement(507090..507806) [717 bp, 238 aa] {ON}
           Anc_4.73 YGR152C
          Length = 238

 Score = 89.7 bits (221), Expect = 3e-21
 Identities = 54/179 (30%), Positives = 95/179 (53%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ V  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSY--RKTVEIDNKVADLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S E +   +++ L    I      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELLDLREQVL---RIKDMNRVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFE 564
           ++D ++V+S + G E++   G VP + TSA    NVD  F ++ +  ++       A E
Sbjct: 120 LKD-ERVISVEEGIEVSSDWGKVPFYETSALLRSNVDEVFIDLVRQIIRNELESVTAPE 177

>Kwal_14.2244 s14 (671441..672175) [735 bp, 244 aa] {ON} YGR152C
           (RSR1) - GTP-binding protein, ras superfamily [contig
           227] FULL
          Length = 244

 Score = 89.7 bits (221), Expect = 3e-21
 Identities = 54/177 (30%), Positives = 98/177 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTMEIDNKVFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S E +   +++ L    I      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVL---RIKDNSRVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           ++D ++V+S + G E++   G VP + TSA    NVD  F ++ +  + +N+ +A A
Sbjct: 120 LQD-ERVISVEEGIEMSSKWGKVPFYETSALLRSNVDEVFVDVVRQII-RNEIEAQA 174

>ADL262W Chr4 (243996..244010,244072..244869) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR101W
           (RAS1) and YNL098C (RAS2); 1-intron
          Length = 270

 Score = 90.1 bits (222), Expect = 3e-21
 Identities = 60/196 (30%), Positives = 100/196 (51%)
 Frame = +1

Query: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 180
           MI       K++++G  GVGK++L  + +   +  +Y  TI  D   K+VV+D  +V  +
Sbjct: 3   MIKNSIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQVVIDG-QVSIL 60

Query: 181 QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 360
            + DTAGQE + ++   + R  +  +LVY VT+  SFE + ++  + L    +   E  P
Sbjct: 61  DILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQIL---RVKDVEYVP 117

Query: 361 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 540
             ++GNK D+E  ++V  E+ G ELA+   +     TSAK AINV+ +F  +A+      
Sbjct: 118 IFVVGNKSDLEGERQVSFEE-GAELARHF-NASFLETSAKQAINVEESFYGLARLVRDDG 175

Query: 541 QNDAHAFEDDFNDAIN 588
            +     E    D  N
Sbjct: 176 IHAGKRLESSPEDPAN 191

>Suva_10.389 Chr10 complement(681930..682589) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 89.0 bits (219), Expect = 3e-21
 Identities = 50/165 (30%), Positives = 93/165 (56%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 14  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 128 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 168

>Skud_12.375 Chr12 complement(661797..662456) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 89.0 bits (219), Expect = 3e-21
 Identities = 50/165 (30%), Positives = 93/165 (56%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 14  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 128 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 168

>Smik_12.371 Chr12 complement(658971..659630) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 89.0 bits (219), Expect = 3e-21
 Identities = 50/165 (30%), Positives = 93/165 (56%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 14  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 128 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 168

>YLR293C Chr12 complement(720771..721430) [660 bp, 219 aa] {ON}
           GSP1Ran GTPase, GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization, RNA processing and transport; regulated by
           Srm1p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and
           Kap95p; yeast Gsp2p homolog
          Length = 219

 Score = 89.0 bits (219), Expect = 3e-21
 Identities = 50/165 (30%), Positives = 93/165 (56%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 14  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 128 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 168

>Skud_15.352 Chr15 complement(632241..632903) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 89.0 bits (219), Expect = 4e-21
 Identities = 50/165 (30%), Positives = 93/165 (56%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 15  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 73

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 129 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 169

>KAFR0F03670 Chr6 complement(726736..727527) [792 bp, 263 aa] {ON}
           Anc_4.73 YGR152C
          Length = 263

 Score = 89.7 bits (221), Expect = 4e-21
 Identities = 50/174 (28%), Positives = 94/174 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S + +   +++ L    I   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDQRSLDELMELREQVL---RIKDSDKVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           + D ++V+S + G E++   G VP + TSA    NVD  F ++ +  ++    +
Sbjct: 120 LTD-ERVISVEDGIEISSKWGKVPFYETSALLRSNVDEVFVDVVRQIIRNEMEN 172

>Ecym_3097 Chr3 (181482..182126) [645 bp, 214 aa] {ON} similar to
           Ashbya gossypii AGR294C
          Length = 214

 Score = 88.2 bits (217), Expect = 6e-21
 Identities = 52/174 (29%), Positives = 95/174 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 9   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEI-KFDVWDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+      Q D
Sbjct: 123 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLD 172

>AGR294C Chr7 complement(1287036..1287680) [645 bp, 214 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR185C
           (GSP2) and YLR293C (GSP1)
          Length = 214

 Score = 88.2 bits (217), Expect = 6e-21
 Identities = 52/174 (29%), Positives = 95/174 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 9   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEI-KFDVWDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+      Q D
Sbjct: 123 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLD 172

>KLLA0A04499g Chr1 complement(404732..405376) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 88.2 bits (217), Expect = 6e-21
 Identities = 52/174 (29%), Positives = 95/174 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 9   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEI-KFDVWDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+      Q D
Sbjct: 123 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLD 172

>KLLA0C05126g Chr3 complement(463657..464301) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 88.2 bits (217), Expect = 6e-21
 Identities = 52/174 (29%), Positives = 95/174 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 9   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEI-KFDVWDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+      Q D
Sbjct: 123 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLARKLAGNPQLD 172

>Smik_6.257 Chr6 complement(414005..414820) [816 bp, 271 aa] {ON}
           YGR152C (REAL)
          Length = 271

 Score = 89.0 bits (219), Expect = 9e-21
 Identities = 54/185 (29%), Positives = 102/185 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGIA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S E +   +++ L    I   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           +  +++V+S + G E++   G VP + TSA    NVD  F ++ +  + +N+ ++ A +D
Sbjct: 120 L-INERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQII-RNEMESVAIKD 177

Query: 568 DFNDA 582
             N +
Sbjct: 178 ARNQS 182

>TDEL0G03810 Chr7 (699414..700082) [669 bp, 222 aa] {ON} Anc_6.90
           YLR293C
          Length = 222

 Score = 87.8 bits (216), Expect = 1e-20
 Identities = 50/165 (30%), Positives = 93/165 (56%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 17  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDVWDTAGQE 75

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 76  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 130

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 131 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 171

>NDAI0D03820 Chr4 complement(908209..909015) [807 bp, 268 aa] {ON}
           Anc_4.73
          Length = 268

 Score = 88.6 bits (218), Expect = 1e-20
 Identities = 50/169 (29%), Positives = 93/169 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S + +   +++ L    I      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLDELMELREQVL---RIKDSSKVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
           + D ++V+S + G E++ + G VP + TSA    NVD  F ++ +  ++
Sbjct: 120 LND-ERVISVEEGIEVSSTWGKVPFYETSALLRSNVDEVFVDLVRQIMR 167

>SAKL0A07744g Chr1 (688406..689050) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293C GSP1 GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization RNA processing and transport regulated by
           Prp20p Rna1p Yrb1p Yrb2p Yrp4p Yrb30p Cse1p and Kap95p
           yeast Gsp2p homolog
          Length = 214

 Score = 87.4 bits (215), Expect = 1e-20
 Identities = 50/165 (30%), Positives = 93/165 (56%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 9   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEI-KFDVWDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 123 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 163

>Skud_7.476 Chr7 complement(778308..779126) [819 bp, 272 aa] {ON}
           YGR152C (REAL)
          Length = 272

 Score = 88.6 bits (218), Expect = 1e-20
 Identities = 53/185 (28%), Positives = 102/185 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGIA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S E +   +++ L    I   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           +  +++++S + G E++   G VP + TSA    NVD  F ++ +  + +N+ ++ A +D
Sbjct: 120 L-INERIISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQII-RNEMESVAIKD 177

Query: 568 DFNDA 582
             N +
Sbjct: 178 ARNQS 182

>YGR152C Chr7 complement(794674..795492) [819 bp, 272 aa] {ON}
           RSR1GTP-binding protein of the ras superfamily required
           for bud site selection, morphological changes in
           response to mating pheromone, and efficient cell fusion;
           localized to the plasma membrane; significantly similar
           to mammalian Rap GTPases
          Length = 272

 Score = 88.6 bits (218), Expect = 1e-20
 Identities = 54/185 (29%), Positives = 102/185 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGIA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S E +   +++ L    I   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           +  +++V+S + G E++   G VP + TSA    NVD  F ++ +  + +N+ ++ A +D
Sbjct: 120 L-INERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQII-RNEMESVAVKD 177

Query: 568 DFNDA 582
             N +
Sbjct: 178 ARNQS 182

>ZYRO0G07018g Chr7 complement(559273..560025) [753 bp, 250 aa] {ON}
           similar to uniprot|P13856 Saccharomyces cerevisiae
           YGR152C RSR1 GTP-binding protein of the ras superfamily
           required for bud site selection, morphological changes
           in response to mating pheromone, and efficient cell
           fusion; localized to the plasma membrane; significantly
           similar to mammalian Rap GTPases
          Length = 250

 Score = 87.8 bits (216), Expect = 2e-20
 Identities = 52/169 (30%), Positives = 92/169 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S E +   +++ L    I      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELLDLREQVL---RIKDVSRVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
           + D ++VVS + G E++   G VP + TSA    NVD  F ++ +  ++
Sbjct: 120 LGD-ERVVSVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIMR 167

>NCAS0A01890 Chr1 complement(364746..365561) [816 bp, 271 aa] {ON}
           Anc_4.73
          Length = 271

 Score = 88.2 bits (217), Expect = 2e-20
 Identities = 53/196 (27%), Positives = 98/196 (50%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S + +   +++ L    I   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQVL---RIKDTDRVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + +  +V+S + G E++   G VP + TSA    NVD  F ++ +  ++         E 
Sbjct: 120 LTED-RVISVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIIRNEMETVAKSEA 178

Query: 568 DFNDAINIQLEGESNS 615
            +    N+     S S
Sbjct: 179 RYPSQQNLSTRNTSRS 194

>KLTH0H09042g Chr8 (776732..777460) [729 bp, 242 aa] {ON} similar to
           uniprot|P13856 Saccharomyces cerevisiae YGR152C RSR1
           GTP-binding protein of the ras superfamily required for
           bud site selection, morphological changes in response to
           mating pheromone, and efficient cell fusion; localized
           to the plasma membrane; significantly similar to
           mammalian Rap GTPases
          Length = 242

 Score = 87.4 bits (215), Expect = 2e-20
 Identities = 51/169 (30%), Positives = 93/169 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTMEIDNKVFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S E +   +++ L    I      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVL---RIKDSTRVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
           ++D ++V+S + G E++ + G VP + TSA    NVD  F +  +  ++
Sbjct: 120 LQD-ERVISVEEGIEMSSNWGKVPFYETSALLRSNVDEVFVDAVRQIIR 167

>CAGL0I00594g Chr9 (44835..45479) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293c GSP1
          Length = 214

 Score = 86.7 bits (213), Expect = 2e-20
 Identities = 50/165 (30%), Positives = 93/165 (56%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++    VWDTAGQE
Sbjct: 9   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFHTNFGEI-KFDVWDTAGQE 67

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 123 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 163

>Kpol_1009.9 s1009 complement(23990..24631) [642 bp, 213 aa] {ON}
           complement(23990..24631) [642 nt, 214 aa]
          Length = 213

 Score = 85.9 bits (211), Expect = 4e-20
 Identities = 49/165 (29%), Positives = 92/165 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQE
Sbjct: 8   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNFGEI-KFDCWDTAGQE 66

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 67  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 121

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 122 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 162

>TPHA0K01060 Chr11 (219078..219719) [642 bp, 213 aa] {ON} Anc_6.90
           YLR293C
          Length = 213

 Score = 85.9 bits (211), Expect = 4e-20
 Identities = 49/165 (29%), Positives = 92/165 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQE
Sbjct: 8   KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNFGEI-KFDCWDTAGQE 66

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 67  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 121

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 122 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 162

>NCAS0F00440 Chr6 complement(79004..79663) [660 bp, 219 aa] {ON}
           Anc_6.90 YLR293C
          Length = 219

 Score = 85.9 bits (211), Expect = 5e-20
 Identities = 49/165 (29%), Positives = 92/165 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQE
Sbjct: 14  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNYGEI-KFDCWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 128 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 168

>KAFR0A04800 Chr1 (954630..955289) [660 bp, 219 aa] {ON} Anc_6.90
           YLR293C
          Length = 219

 Score = 85.9 bits (211), Expect = 5e-20
 Identities = 49/165 (29%), Positives = 92/165 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQE
Sbjct: 14  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDCWDTAGQE 72

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 128 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 168

>NDAI0D02670 Chr4 (618909..619571) [663 bp, 220 aa] {ON} Anc_6.90
          Length = 220

 Score = 85.9 bits (211), Expect = 5e-20
 Identities = 49/165 (29%), Positives = 92/165 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQE
Sbjct: 15  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNYGEI-KFDCWDTAGQE 73

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 129 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 169

>TBLA0E00980 Chr5 (224289..224954) [666 bp, 221 aa] {ON} Anc_6.90
           YLR293C
          Length = 221

 Score = 85.9 bits (211), Expect = 5e-20
 Identities = 49/165 (29%), Positives = 92/165 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQE
Sbjct: 16  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDCWDTAGQE 74

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 75  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 129

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 130 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 170

>KNAG0F03180 Chr6 complement(598089..598973) [885 bp, 294 aa] {ON}
           Anc_6.90 YLR293C
          Length = 294

 Score = 87.0 bits (214), Expect = 7e-20
 Identities = 49/165 (29%), Positives = 92/165 (55%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++++GD G GKT+ + R++  ++ ++Y ATIG +        +  ++     WDTAGQE
Sbjct: 89  KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEI-KFDCWDTAGQE 147

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F  L   +Y  A C ++++DVT+  +++N+ +W  +      +   E+ P V+ GNKVD
Sbjct: 148 KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 202

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           +++ +KV ++       K+L     +  SAKS  N +  F  +A+
Sbjct: 203 VKE-RKVKAKTITFHRKKNL---QYYDISAKSNYNFEKPFLWLAR 243

>Kwal_47.19055 s47 complement(1078494..1079033) [540 bp, 179 aa]
           {ON} YGL210W (YPT32) - ras-like GTPase, highly
           homologous to YPT31 [contig 188] FULL
          Length = 179

 Score = 84.0 bits (206), Expect = 1e-19
 Identities = 48/141 (34%), Positives = 84/141 (59%)
 Frame = +1

Query: 112 KATIGADFLTKEVVLDDDKVVTMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSF 291
           K+TIG +F T+ + ++  K+   Q+WDTAGQER++++  A+YRGA   ++VYD++ + S+
Sbjct: 4   KSTIGVEFATRTIEVEGKKIKA-QIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSY 62

Query: 292 ENIKSWKDEFLVHANISSPESFPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLT 471
           EN   W  E   +A+    E+    ++GNK D+   + V +++A +  A+    +    T
Sbjct: 63  ENCNHWLTELRENAD----ENVAVGLIGNKSDLAHLRAVPTDEA-KNFAQE-NQLLFTET 116

Query: 472 SAKSAINVDTAFEEIAKSALQ 534
           SA ++ NVD AF E+  +  Q
Sbjct: 117 SALNSENVDQAFRELISAIYQ 137

>TBLA0B01410 Chr2 complement(304771..306687) [1917 bp, 638 aa] {ON}
           Anc_2.182 YNL098C
          Length = 638

 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 60/195 (30%), Positives = 99/195 (50%), Gaps = 8/195 (4%)
 Frame = +1

Query: 13  KKNILKVIILGDSGVGKTSLMHRYVNDKYSQ-QYKATIGADFLTKEVVLDDDKVVTMQVW 189
           K+   K++ILG  GVGK+S+  + V +K+ + QY  TI  D   KE+   ++   ++ + 
Sbjct: 8   KEKEYKIVILGAGGVGKSSITLQLVQNKFIEDQYDPTI-EDIFKKELFFQNN-YYSLNIL 65

Query: 190 DTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSP------- 348
           DTAGQ  +  L   + +     + VY + +  SF  + S   + L   N           
Sbjct: 66  DTAGQSEYSQLRENYMKLGQGFLFVYSIESRTSFLELLSHYQQLLRAKNFPQEKSEKALN 125

Query: 349 ESFPFVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSA 528
           +S P V++GNK D++  ++V  ++ G  +AK+ GD P   TSAKS IN+  AFE + K  
Sbjct: 126 QSIPIVVVGNKSDLDYEREVTYDE-GINIAKNFGDFPFLETSAKSNINILKAFEILIKQI 184

Query: 529 LQQNQNDAHAFEDDF 573
               +N     +D+F
Sbjct: 185 DSNVENSTTTNDDEF 199

>ZYRO0E03608g Chr5 complement(279670..280272) [603 bp, 200 aa] {ON}
           similar to uniprot|P25378 Saccharomyces cerevisiae
           YCR027C RHB1 Putative Rheb-related GTPase involved in
           regulating canavanine resistance and arginine uptake
           member of the Ras superfamily of G-proteins
          Length = 200

 Score = 84.3 bits (207), Expect = 1e-19
 Identities = 57/179 (31%), Positives = 90/179 (50%), Gaps = 9/179 (5%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+ +LG   VGKT+L  R+V + + + Y  TI  DF   ++V       T+++ DTAGQ+
Sbjct: 11  KIAVLGARNVGKTTLTVRFVEEHFVESYYPTIENDFT--KIVQFKGNNYTLEILDTAGQD 68

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            F  L      G    VL Y V+N  SFE I    D+ +   +    +  P V++ NK+D
Sbjct: 69  EFSLLNAKSLIGVKGIVLCYSVSNRPSFELIPVVWDKLV---DQLGRDDLPCVVVANKID 125

Query: 388 IED---SKKVVSEKAGQELAKSLGDVP------LFLTSAKSAINVDTAFEEIAKSALQQ 537
           + D   S + +S + G+ELAK++G             SAK  +NV+ A+  + +   QQ
Sbjct: 126 VRDSASSTEFISSQEGRELAKTIGSTDGKHKAGFVECSAKQDVNVEGAYRAVLEKMRQQ 184

>Kpol_1026.12 s1026 complement(27073..28062) [990 bp, 329 aa] {ON}
           complement(27073..28062) [990 nt, 330 aa]
          Length = 329

 Score = 86.3 bits (212), Expect = 2e-19
 Identities = 49/174 (28%), Positives = 95/174 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKVFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S + +   +++ L    I      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDKQSLDELLELREQVL---KIKDSSKVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 549
           ++ +++V+S + G E++ + G VP + TSA    NVD  F ++ +  ++    +
Sbjct: 120 LK-NERVISVEDGIEVSSTWGKVPFYETSALLRSNVDEVFIDLVRQIIRDEMEN 172

>KAFR0J01240 Chr10 complement(229638..230201) [564 bp, 187 aa] {ON}
           Anc_2.200 YNL090W
          Length = 187

 Score = 83.2 bits (204), Expect = 3e-19
 Identities = 52/180 (28%), Positives = 98/180 (54%), Gaps = 3/180 (1%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T   V  D   V++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVTDCRV--DGIKVSLALWDTAGQE 66

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
            ++ L    Y  AD  ++ + V + +S EN    +D++ V A    PE  P +++G K D
Sbjct: 67  EYERLRPFSYSNADVILIAFAVDDVESLENT---RDKWAVEALRYCPE-VPIILVGLKKD 122

Query: 388 I---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHA 558
           +    +  ++V  +  Q++A+++G       SA +   VD  FE   +++L   ++  H+
Sbjct: 123 LRQANNKNRMVRPEDVQKIARAVGAKNYMECSALTGEGVDDVFEVATRTSLLVKEDPGHS 182

>KLLA0C12001g Chr3 complement(1029092..1029871) [780 bp, 259 aa]
           {ON} similar to uniprot|P13856 Saccharomyces cerevisiae
           YGR152C RSR1 GTP-binding protein of the ras superfamily
           required for bud site selection, morphological changes
           in response to mating pheromone, and efficient cell
           fusion; localized to the plasma membrane; significantly
           similar to mammalian Rap GTPases
          Length = 259

 Score = 84.7 bits (208), Expect = 3e-19
 Identities = 49/175 (28%), Positives = 93/175 (53%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSY--RKTMEIDNKVFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY V++ +S   +   +++ L    I   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVSDRQSLNELLELREQVL---RIKDSDRVPIVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDA 552
           ++D ++V+S + G E++   G VP +  SA    NVD  F ++ +  ++     A
Sbjct: 120 LQD-ERVISVEEGIEVSSKWGKVPFYEASALLRSNVDEVFIDLVRQIIRNELESA 173

>KLLA0C13816g Chr3 (1183412..1183975) [564 bp, 187 aa] {ON} highly
           similar to uniprot|P06781 Saccharomyces cerevisiae
           YNL090W RHO2 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins involved in the
           establishment of cell polarity and in microtubule
           assembly
          Length = 187

 Score = 82.8 bits (203), Expect = 4e-19
 Identities = 51/180 (28%), Positives = 100/180 (55%), Gaps = 4/180 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++I+GD   GKTSL++ +   ++ ++Y  T+  +++T   V  D   V + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVTDCRV--DGIKVQLTLWDTAGQE 66

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WKDEFLVHANISSPESFPFVILGNKV 384
            ++ L    Y  AD  ++ + + + +S  N ++ W +E L +     PE+ P V++G K 
Sbjct: 67  EYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYC----PEA-PVVLVGLKK 121

Query: 385 DI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAH 555
           D+   ++  ++V+ +  +++A+++G       SA +  NVD  FE   +++L  N+   H
Sbjct: 122 DLRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVFEVATRTSLLVNKQPGH 181

>ZYRO0D01452g Chr4 complement(104471..105133) [663 bp, 220 aa] {ON}
           similar to uniprot|P06780 Saccharomyces cerevisiae
           YPR165W RHO1 GTP-binding protein of the rho subfamily of
           Ras-like proteins involved in establishment of cell
           polarity regulates protein kinase C (Pkc1p) and the cell
           wall synthesizing enzyme 1 3-beta-glucan synthase (Fks1p
           and Gsc2p)
          Length = 220

 Score = 83.6 bits (205), Expect = 4e-19
 Identities = 54/186 (29%), Positives = 91/186 (48%), Gaps = 12/186 (6%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++I+GD   GKTSL+  +   K+ + Y  T+  +++    V  D + V + +WDTAGQE
Sbjct: 18  KLVIVGDGACGKTSLLIVFAKGKFPEVYVPTVFDNYVADVEV--DGRHVELALWDTAGQE 75

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENI-KSWKDEFLVHANISSPESFPFVILGNKV 384
            +  L    Y  ++  ++ Y V    S +N+ + W  E L        +  PFV++G K 
Sbjct: 76  DYDRLRPLSYPDSNVVLVCYSVDLPDSLDNVMEKWVSEVLHFC-----QGVPFVLVGCKA 130

Query: 385 DIEDSKKV-----------VSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSAL 531
           D+ D  ++           VS   GQ  A+++G V     SAK+ + V   FE   +++L
Sbjct: 131 DLRDDPRIVESLREAGQEPVSHATGQNAAETMGAVSFCECSAKTGMGVREVFEAATRASL 190

Query: 532 QQNQND 549
              QN+
Sbjct: 191 MGKQNN 196

>Ecym_5365 Chr5 (743477..744046) [570 bp, 189 aa] {ON} similar to
           Ashbya gossypii ACL087C
          Length = 189

 Score = 82.8 bits (203), Expect = 4e-19
 Identities = 55/179 (30%), Positives = 95/179 (53%), Gaps = 6/179 (3%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++I+GD   GKTSL+H +   K+ ++Y+ TI  +++T   V  D   V + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYQPTIFENYVTDCRV--DGIRVQLALWDTAGQE 66

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIK-SWKDEFLVHANISSPESFPFVILGNKV 384
            ++ L    Y  AD  ++ + + +A+S  N +  W  E L +       S P +++G K 
Sbjct: 67  EYERLRPMSYSKADIILIGFAIDDAESLLNAREKWTVEALRYC-----PSAPIILVGLKK 121

Query: 385 DIE-----DSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQN 546
           D+      D  ++V+    QE+AK++G       SA +   VD  FE   +++L  N++
Sbjct: 122 DLRKSNSIDRAEMVNLSQAQEVAKAIGAKKYMECSALTGEGVDDVFELATRTSLLVNRD 180

>KNAG0I01930 Chr9 (376663..377622) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 85.1 bits (209), Expect = 5e-19
 Identities = 49/164 (29%), Positives = 92/164 (56%)
 Frame = +1

Query: 31  VIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQER 210
           ++++G  GVGK++L  +    ++  +Y  TI  D   K+VVLD++ V  + + DTAGQE 
Sbjct: 16  LVVVGGGGVGKSALTIKLTQSRFVDEYDPTI-EDSYRKQVVLDNE-VTIIDILDTAGQEE 73

Query: 211 FQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVDI 390
           + ++   + R  +  +LVY  T+  SF+ + ++  + L    +   +  P V++GNK+D+
Sbjct: 74  YSAMREQYMRTGEGFLLVYSSTSKNSFDELITYYHQIL---RVKDTDYVPIVVVGNKIDL 130

Query: 391 EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
              ++V  + +G +LA  +   P   TSAK  +NV+ AF  + +
Sbjct: 131 SGERQVPFD-SGLKLANEM-SAPFLETSAKEGVNVEEAFYTLVR 172

>SAKL0H20746g Chr8 (1817259..1818014) [756 bp, 251 aa] {ON} similar
           to uniprot|P13856 Saccharomyces cerevisiae YGR152C RSR1
           GTP-binding protein of the ras superfamily required for
           bud site selection, morphological changes in response to
           mating pheromone, and efficient cell fusion; localized
           to the plasma membrane; significantly similar to
           mammalian Rap GTPases
          Length = 251

 Score = 84.0 bits (206), Expect = 5e-19
 Identities = 49/165 (29%), Positives = 89/165 (53%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+KV  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTMEIDNKVFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S E +   +++ L    I   +  P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAK 522
           ++D +  +S   G  ++ + G VP + TSA    NVD  F ++ +
Sbjct: 120 LQDERS-ISVNEGIGVSSNWGKVPFYETSALLRSNVDEVFIDLVR 163

>KNAG0M01830 Chr13 complement(339904..340464) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 82.4 bits (202), Expect = 5e-19
 Identities = 53/179 (29%), Positives = 100/179 (55%), Gaps = 3/179 (1%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++I+GD   GKTSL++ +   ++ Q+Y+ T+  +++T +  +D  KV+ + +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPQEYQPTVFENYVT-DCRVDGIKVM-LALWDTAGQE 66

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIK-SWKDEFLVHANISSPESFPFVILGNKV 384
            ++ L    Y  AD  V+ + V +  S EN +  W  E   +     P++ P V++G K 
Sbjct: 67  EYERLRPFSYSKADIIVIGFAVDDEDSLENARDKWAQEVFRYC----PDA-PIVLVGLKN 121

Query: 385 DIEDS--KKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAH 555
           D+ ++   K+VS +  +++A+++G       SA +   VD  FE   +++L   ++  H
Sbjct: 122 DLRNNVDAKLVSPQMAEQVARAIGAKKYMECSALTGEGVDDVFEVATRTSLLVKKDPGH 180

>KNAG0D03780 Chr4 complement(688854..689768) [915 bp, 304 aa] {ON}
           Anc_4.73 YGR152C
          Length = 304

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 48/169 (28%), Positives = 92/169 (54%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+K+  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGIYLDSYDPTIEDSY--RKTIEIDNKIFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S + + + +++ L    I      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDKQSLDELMALREQVL---RIKDSSRVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQ 534
           + D ++V+S + G  ++   G VP + TSA    NVD  F ++ +  ++
Sbjct: 120 LTD-ERVISVEDGITVSSKWGKVPFYETSALLRSNVDEVFVDLVRQLIR 167

>NCAS0G02730 Chr7 (491357..491920) [564 bp, 187 aa] {ON} 
          Length = 187

 Score = 82.4 bits (202), Expect = 5e-19
 Identities = 52/176 (29%), Positives = 98/176 (55%), Gaps = 4/176 (2%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K++I+GD   GKTSL++ +   K+ Q+Y  T+  +++T   V  D   V++ +WDTAGQE
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVTDCRV--DGIKVSLTLWDTAGQE 66

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WKDEFLVHANISSPESFPFVILGNKV 384
            ++ L    Y  AD  ++ + + + +S +N ++ W +E L +     PE+ P +++G K 
Sbjct: 67  EYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYC----PEA-PIILVGLKK 121

Query: 385 DI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQ 543
           D+   +D  ++V  +  Q++A+ +G       SA +   VD  FE   +++L  N+
Sbjct: 122 DLRQKQDGVEMVKPEDAQQVARIIGAKKYVECSALTGEGVDDVFELATRTSLLVNK 177

>TPHA0K01820 Chr11 complement(385771..386733) [963 bp, 320 aa] {ON}
           Anc_4.73 YGR152C
          Length = 320

 Score = 84.7 bits (208), Expect = 6e-19
 Identities = 51/187 (27%), Positives = 97/187 (51%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI   +  ++ +  D+K+  +++ DTAG  
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY--RKTIEIDNKLFDLEILDTAGVA 62

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+  S   +   +++ L    I      P V++GNK D
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDKNSLNELLELREQVL---KIKDSNKVPMVLVGNKAD 119

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           ++  + V+S + G E++   G VP + TSA    NVD  F ++ +  ++    + +   +
Sbjct: 120 LKYDR-VISVEDGIEVSSRWGRVPFYETSALLRSNVDEVFVDLVRQIIRDELENVNNNTN 178

Query: 568 DFNDAIN 588
           + N+ IN
Sbjct: 179 NQNNGIN 185

>NDAI0B05400 Chr2 (1326549..1327436) [888 bp, 295 aa] {ON} Anc_1.215
          Length = 295

 Score = 84.3 bits (207), Expect = 7e-19
 Identities = 53/182 (29%), Positives = 92/182 (50%), Gaps = 4/182 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           LK++++GD  VGKT L+  YVN+++   Y  T+  +++T  V + + +V+ + +WDTAGQ
Sbjct: 73  LKIVVVGDGNVGKTCLLISYVNNEFPTDYIPTVFENYVT-SVNMPNREVIELALWDTAGQ 131

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WKDEFLVHANISSPESFPFVILGNK 381
           E +  L    Y   D  ++ Y V N  S E+++  W  E             P +++G K
Sbjct: 132 EEYNRLRPLSYTDVDVLMVCYSVDNKTSLEHVEELWFPEVRHFCG-----KTPVMLIGLK 186

Query: 382 VDI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDA 552
            D+   +  + +V  K  + +AK +G       SAKS  NV+  F +  +  L  ++ D 
Sbjct: 187 SDLYAEDKGEGLVETKHAELIAKKMGAFVHLQCSAKSRDNVEEVFNKAIEIVLGDSRGDG 246

Query: 553 HA 558
            A
Sbjct: 247 KA 248

>KNAG0C01260 Chr3 complement(243934..244833) [900 bp, 299 aa] {ON}
           Anc_1.215 YKR055W
          Length = 299

 Score = 84.3 bits (207), Expect = 7e-19
 Identities = 54/166 (32%), Positives = 87/166 (52%), Gaps = 4/166 (2%)
 Frame = +1

Query: 25  LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 204
           LK++++GD  VGKTSL+  YV   +  +Y  T+  +++T  +    DK + + +WDTAGQ
Sbjct: 82  LKIVVVGDGTVGKTSLLMSYVQKTFPTEYVPTVFENYVTT-IEGPQDKCIELALWDTAGQ 140

Query: 205 ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS-WKDEFLVHANISSPESFPFVILGNK 381
           E +  L    Y   D  ++ Y V N  SF+N +  W  E + H    +P+    +++G K
Sbjct: 141 EEYNRLRPLSYTNVDILMICYAVDNRNSFKNAEDIWYPE-VKHFCSGTPK----ILVGLK 195

Query: 382 VDI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFE 510
            D+   E   ++V  K G  LA+ +G V     SAK   N+D  F+
Sbjct: 196 SDLYAGEHINEMVEPKEGDLLAEKIGAVLHLQCSAKLRDNIDELFD 241

>TBLA0B00370 Chr2 (68828..69868) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 84.7 bits (208), Expect = 8e-19
 Identities = 57/196 (29%), Positives = 98/196 (50%)
 Frame = +1

Query: 28  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQE 207
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+ K  ++++ DTAG  
Sbjct: 8   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKNIEIDN-KQFSLEILDTAGVA 65

Query: 208 RFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKVD 387
           +F ++   + +     +LVY VT+ +S + +   +++ L    I   +  P V++GNK D
Sbjct: 66  QFTAMRELYIKSGMGFLLVYSVTDRQSLQELMELREQVL---RIKDMDHVPMVLIGNKAD 122

Query: 388 IEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQNDAHAFED 567
           + D ++VV  + G  L+   G VP + TSA    NVD  F ++ +  L+           
Sbjct: 123 LID-ERVVPVEEGIALSGEWGKVPFYETSALLRSNVDEVFVDLVRQILRDELAAQQEVRT 181

Query: 568 DFNDAINIQLEGESNS 615
             + AI   +   SNS
Sbjct: 182 HGHSAIGNGVNNRSNS 197

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,913,529
Number of extensions: 1111934
Number of successful extensions: 5601
Number of sequences better than 10.0: 646
Number of HSP's gapped: 4986
Number of HSP's successfully gapped: 662
Length of query: 209
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 104
Effective length of database: 41,441,469
Effective search space: 4309912776
Effective search space used: 4309912776
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)