Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02585g6.25ON73773736470.0
NCAS0H008606.25ON75575418890.0
KAFR0G026606.25ON73574818710.0
SAKL0E01452g6.25ON73774518710.0
NDAI0D008506.25ON79076618550.0
KNAG0M012306.25ON73875818460.0
Suva_15.1766.25ON74574418450.0
ZYRO0C07678g6.25ON74176018410.0
Kpol_1037.296.25ON74676318100.0
Skud_15.1626.25ON73474518080.0
YOR001W (RRP6)6.25ON73374418010.0
Smik_15.1706.25ON77374117950.0
TDEL0G044406.25ON73574417520.0
TPHA0J003706.25ON74374717420.0
KLLA0D01309g6.25ON74474817390.0
TBLA0A071706.25ON77175517280.0
ACL001C6.25ON74575316960.0
Ecym_30306.25ON74775416910.0
Kwal_56.224476.25ON73574816630.0
KLTH0C11066g6.25ON73573416630.0
TPHA0O019302.16ON1081200970.007
Suva_4.4308.573ON855293940.015
TBLA0B080005.75ON1697179920.028
NDAI0I002506.371ON897217910.034
NCAS0E039505.51ON1000208910.035
NDAI0G047901.467ON1164272900.047
TPHA0A048705.131ON30199880.050
KLLA0C17204g4.46ON76898860.13
TPHA0H016805.414ON989223860.14
NDAI0A059003.240ON1231222860.14
KAFR0D033202.506ON560131850.16
Skud_1.137.21ON636168850.16
KAFR0G033104.268ON676221850.17
TBLA0J001707.527ON84566850.17
NDAI0K010108.736ON167295850.19
NCAS0B036308.331ON244798850.19
TBLA0A018606.175ON868115840.23
TBLA0I021103.306ON916207840.23
NCAS0E024807.413ON995223840.23
Kpol_1048.248.605ON1046163840.24
TBLA0B099704.46ON1065138840.24
Kpol_1028.625.12ON28776820.26
NCAS0B069802.159ON639246830.28
Kwal_33.146832.130ON353105820.30
NCAS0C024608.484ON887146830.30
Suva_16.3098.75ON104299830.31
CAGL0D00924g4.238ON1980248830.33
TBLA0A074301.19ON301107810.36
TDEL0E005102.16ON936214820.40
KAFR0D037401.115ON764112810.51
YOL007C (CSI2)6.33ON34176800.51
TPHA0J014405.677ON796187810.51
CAGL0G09174g6.201ON920180810.52
Skud_14.881.110ON131676810.55
SAKL0E01782g6.40ON41279800.56
CAGL0G02497g5.702ON1780238810.56
TBLA0B045308.562ON234192810.57
TBLA0A05960singletonON526203800.61
KLLA0E08471g2.282ON571106800.62
Suva_2.5865.509ON894154800.68
TBLA0E032306.56ON907227800.68
KAFR0K003806.201ON933101800.69
TDEL0A012908.235ON122592800.71
KNAG0A051308.331ON2344226800.75
TBLA0E022307.94ON474200790.77
YHR019C (DED81)1.353ON55476790.81
Sklu_YGOB_Anc_8.6658.665ON615114790.83
Kpol_YGOB_1055.704.268ON666164790.85
Kpol_1055.70singletonOFF668164790.85
TPHA0A011508.604ON818192790.88
KNAG0I029604.46ON964103790.91
KAFR0B043205.88ON986270790.91
TPHA0C044407.186ON1170194790.93
NDAI0G043201.397ON483101781.0
NDAI0K016006.326ON20888761.1
KAFR0H029401.441ON59471781.1
Kpol_388.91.65ON659225781.1
Suva_3.1901.52ON1024211781.2
TBLA0E003403.547ON1100147781.2
CAGL0D06622g4.39ON1178201781.2
TBLA0I025107.463ON1664123781.3
Kpol_228.46.227ON441144771.3
SAKL0F03168g3.479ON706279771.5
NDAI0F007905.630ON315226761.5
Skud_4.6845.509ON891151771.5
Suva_10.4054.46ON916147771.6
NDAI0G045202.637ON917215771.6
Kpol_529.202.16ON957320771.6
Smik_2.357.413ON985197771.6
NDAI0A024707.253ON353104761.6
Kpol_541.108.831ON1056115771.6
Suva_1.487.80ON1128222771.6
CAGL0F05533g8.405ON373103761.6
KAFR0G004208.860ON37451761.6
NCAS0A081305.587ON131794771.6
KLTH0D16764g4.342ON419186761.7
KLLA0F07799g7.93ON462125761.8
Smik_8.841.353ON55476761.8
NCAS0D036706.188ON687194761.9
Suva_10.2288.330ON756107762.0
TBLA0A070806.1ON32159752.0
TBLA0C043904.56ON1272213762.1
TPHA0H010405.99ON12464712.1
KLLA0D02068g8.120ON405116752.2
TBLA0H028402.599ON440101752.3
Smik_12.1658.295ON490995762.3
KAFR0H00100singletonON460146752.3
TDEL0A058208.636ON476224752.3
NDAI0B015002.573ON51578752.4
NDAI0A008301.162ON684183752.5
Kpol_520.167.443ON21389732.6
Suva_8.2518.604ON829242752.6
KLLA0E21517g5.414ON858202752.6
CAGL0M13871g5.11ON1091299752.7
YML117W (NAB6)8.844ON1134135752.7
NDAI0H010405.587ON1420188752.8
Kpol_1036.978.368ON195677752.9
TBLA0I02620singletonON3166102752.9
KLLA0F21164g3.111aON420101742.9
SAKL0H06952g8.659ON453216743.0
Kwal_26.78192.486ON266156733.1
Ecym_47197.354ON51388743.1
Kpol_1024.438.543ON544103743.2
KAFR0J026903.533ON291111733.3
TBLA0A063304.268ON638223743.3
KAFR0G003201.162ON690233743.4
Kpol_1037.426.56ON780211743.4
Smik_15.3828.604ON829222743.5
Kpol_423.103.523ON859115743.5
NDAI0B003901.151ON904147743.5
NDAI0C006002.590ON936124743.5
SAKL0H24200g4.46ON963243743.5
Smik_9.572.257ON1085154743.6
TPHA0L023105.11ON1092168743.6
NCAS0G036902.296ON349112733.6
TBLA0C021004.276ON1141173743.6
Smik_12.1458.259ON1418255743.7
Suva_14.433.61ON164242743.7
NDAI0D010102.240ON422143733.9
ZYRO0F06974g8.659ON437117733.9
Smik_12.2361.397ON487106734.1
KNAG0B025907.354ON499152734.1
NDAI0E005508.787ON523151734.1
NCAS0G004105.677ON561225734.2
YEL013W (VAC8)1.441ON57861734.2
ZYRO0F11308g7.330ON60691734.3
Kpol_303.72.662ON708117734.4
KLTH0E12606g8.544ON75572734.5
Suva_13.3606.252ON762150734.5
Ecym_50207.21ON790168734.5
KNAG0J027104.56ON852136734.6
CAGL0K07700g8.48ON915159734.6
Smik_16.2867.462ON1080138734.7
Kpol_1061.198.416ON1107122734.7
NCAS0F005805.96ON1148180734.7
YHR158C (KEL1)5.88ON1164200734.7
Kpol_345.36.75ON1368107734.8
Suva_9.792.253ON1488311734.8
TBLA0E047704.351ON1655133734.9
Skud_4.1964.238ON1792119734.9
Skud_16.4093.453ON438107725.2
YOR310C (NOP58)8.787ON511159725.4
Smik_15.4918.787ON516161725.4
YMR029C (FAR8)2.583ON523116725.5
Skud_40.1singletonON538140725.5
Ecym_84038.144ON573257725.6
SAKL0B09504g7.102ON657103725.7
Kpol_1002.646.188ON657132725.7
KAFR0A016001.294ON715133725.8
TBLA0D031705.230ON765173725.9
ZYRO0F16698g1.81ON77946725.9
Smik_6.4266.241ON793120725.9
KAFR0E031808.544ON814303726.0
KAFR0I007508.560ON845204726.0
KLLA0E19405g6.201ON908187726.0
Suva_2.5285.414ON944195726.1
KAFR0L003706.16ON963161726.1
KNAG0C021101.377ON1043137726.1
YPR042C (PUF2)7.462ON1075135726.2
Kpol_483.104.237ON1118118726.2
TPHA0K011006.75ON1161103726.2
NCAS0C058604.15ON186862726.5
KAFR0G032004.238ON1869224726.5
Suva_11.3315.702ON1898101726.5
KNAG0B066804.342ON424106716.8
Ecym_20083.6ON477110717.0
TPHA0J004706.38ON489153717.0
KAFR0B035408.787ON499154717.1
KAFR0D015808.787ON501154717.1
Ecym_22766.141ON50485717.1
KLLA0F08613g8.787ON511167717.1
TPHA0C025902.596ON597141717.4
ZYRO0D11154g5.472ON633106717.5
TBLA0E012204.149ON63484717.5
NCAS0F012705.561ON291111707.6
YBL050W (SEC17)7.493ON29281707.6
YLR440C (SEC39)4.323ON709219717.6
NCAS0B062302.292ON72397717.7
Suva_13.4118.754ON75289717.7
TBLA0C003708.12ON30176707.7
NDAI0H035001.377ON86899717.9
TBLA0F021307.309ON880152717.9
NDAI0A028907.309ON908139717.9
TDEL0B026505.658ON901148717.9
TBLA0E024007.69ON939112718.0
KAFR0A007702.476ON952106718.0
Suva_5.1927.270ON21295698.1
TBLA0D037201.509ON1074192718.1
NDAI0C007905.577ON1084111718.1
NDAI0G056301.295ON1229110718.2
TBLA0E044108.259ON1422180718.3
TBLA0A006802.662ON1494279718.3
CAGL0M10829g6.341ON1667249718.4
Kpol_1019.122.634ON391233708.7
TBLA0B018508.215ON39259708.7
TPHA0C010008.295ON490194718.8
Kwal_14.25031.334ON429111708.9
Kwal_47.168814.342ON431123708.9
TPHA0G021402.396ON440176709.0
CAGL0F02849g5.514ON248147699.1
CAGL0J11572g3.149ON460156709.1
Kwal_26.67457.4ON182125689.2
NCAS0J022104.366ON253171699.2
NDAI0C032605.87ON491227709.3
AFR328C8.787ON51374709.4
ZYRO0F11792g7.354ON51393709.4
KNAG0G031908.787ON52380709.4
Skud_5.831.441ON57861709.7
TBLA0G022202.532ON27886699.8
NDAI0F004605.677ON657196709.9
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CAGL0E02585g
         (2214 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...  1409   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   732   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   725   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   725   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   719   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   715   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   715   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   713   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   701   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   701   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   698   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   696   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   679   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   675   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   674   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   670   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   657   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   655   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   645   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   645   0.0  
TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2...    42   0.007
Suva_4.430 Chr4 complement(756076..758643) [2568 bp, 855 aa] {ON...    41   0.015
TBLA0B08000 Chr2 (1900021..1905114) [5094 bp, 1697 aa] {ON} Anc_...    40   0.028
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    40   0.034
NCAS0E03950 Chr5 complement(773762..776764) [3003 bp, 1000 aa] {...    40   0.035
NDAI0G04790 Chr7 (1151205..1154699) [3495 bp, 1164 aa] {ON}            39   0.047
TPHA0A04870 Chr1 complement(1102393..1103298) [906 bp, 301 aa] {...    39   0.050
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    38   0.13 
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    38   0.14 
NDAI0A05900 Chr1 (1338449..1342144) [3696 bp, 1231 aa] {ON} Anc_...    38   0.14 
KAFR0D03320 Chr4 (653123..654805) [1683 bp, 560 aa] {ON} Anc_2.5...    37   0.16 
Skud_1.13 Chr1 complement(30899..32809) [1911 bp, 636 aa] {ON} Y...    37   0.16 
KAFR0G03310 Chr7 (682336..684366) [2031 bp, 676 aa] {ON} Anc_4.2...    37   0.17 
TBLA0J00170 Chr10 complement(20249..22786) [2538 bp, 845 aa] {ON...    37   0.17 
NDAI0K01010 Chr11 complement(230318..235336) [5019 bp, 1672 aa] ...    37   0.19 
NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8....    37   0.19 
TBLA0A01860 Chr1 (452220..454826) [2607 bp, 868 aa] {ON} Anc_6.1...    37   0.23 
TBLA0I02110 Chr9 (479430..482180) [2751 bp, 916 aa] {ON} Anc_3.3...    37   0.23 
NCAS0E02480 Chr5 (490695..493682) [2988 bp, 995 aa] {ON} Anc_7.4...    37   0.23 
Kpol_1048.24 s1048 complement(75760..78900) [3141 bp, 1046 aa] {...    37   0.24 
TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]...    37   0.24 
Kpol_1028.62 s1028 (140309..141172) [864 bp, 287 aa] {ON} (14030...    36   0.26 
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    37   0.28 
Kwal_33.14683 s33 (770893..771954) [1062 bp, 353 aa] {ON} YNL136...    36   0.30 
NCAS0C02460 Chr3 complement(457257..459920) [2664 bp, 887 aa] {O...    37   0.30 
Suva_16.309 Chr16 complement(539454..540172,540248..540493,54090...    37   0.31 
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    37   0.33 
TBLA0A07430 Chr1 complement(1839818..1840723) [906 bp, 301 aa] {...    36   0.36 
TDEL0E00510 Chr5 complement(114384..117194) [2811 bp, 936 aa] {O...    36   0.40 
KAFR0D03740 Chr4 complement(722559..724853) [2295 bp, 764 aa] {O...    36   0.51 
YOL007C Chr15 complement(311342..312367) [1026 bp, 341 aa] {ON} ...    35   0.51 
TPHA0J01440 Chr10 (334822..337212) [2391 bp, 796 aa] {ON} Anc_5....    36   0.51 
CAGL0G09174g Chr7 (875195..877957) [2763 bp, 920 aa] {ON} simila...    36   0.52 
Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250...    36   0.55 
SAKL0E01782g Chr5 (136231..137469) [1239 bp, 412 aa] {ON} simila...    35   0.56 
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    36   0.56 
TBLA0B04530 Chr2 (1042985..1050010) [7026 bp, 2341 aa] {ON} Anc_...    36   0.57 
TBLA0A05960 Chr1 (1469108..1470688) [1581 bp, 526 aa] {ON}             35   0.61 
KLLA0E08471g Chr5 (761242..762957) [1716 bp, 571 aa] {ON} simila...    35   0.62 
Suva_2.586 Chr2 (1040961..1043645) [2685 bp, 894 aa] {ON} YDR409...    35   0.68 
TBLA0E03230 Chr5 complement(810836..813559) [2724 bp, 907 aa] {O...    35   0.68 
KAFR0K00380 Chr11 (82200..85001) [2802 bp, 933 aa] {ON} Anc_6.20...    35   0.69 
TDEL0A01290 Chr1 (222024..225701) [3678 bp, 1225 aa] {ON} Anc_8....    35   0.71 
KNAG0A05130 Chr1 complement(748935..755969) [7035 bp, 2344 aa] {...    35   0.75 
TBLA0E02230 Chr5 (552207..553631) [1425 bp, 474 aa] {ON} Anc_7.9...    35   0.77 
YHR019C Chr8 complement(141894..143558) [1665 bp, 554 aa] {ON}  ...    35   0.81 
Sklu_YGOB_Anc_8.665 Chr8 complement(600377..601444,601446..60222...    35   0.83 
Kpol_YGOB_1055.70 s1055 complement(184555..186555) [2001 bp, 666...    35   0.85 
Kpol_1055.70 s1055 complement(184555..186561) [2007 bp, 668 aa] ...    35   0.85 
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    35   0.88 
KNAG0I02960 Chr9 complement(584077..586971) [2895 bp, 964 aa] {O...    35   0.91 
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    35   0.91 
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    35   0.93 
NDAI0G04320 Chr7 (1039571..1041022) [1452 bp, 483 aa] {ON} Anc_1...    35   1.0  
NDAI0K01600 Chr11 complement(360599..361225) [627 bp, 208 aa] {O...    34   1.1  
KAFR0H02940 Chr8 (558290..560074) [1785 bp, 594 aa] {ON} Anc_1.4...    35   1.1  
Kpol_388.9 s388 complement(27180..29159) [1980 bp, 659 aa] {ON} ...    35   1.1  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    35   1.2  
TBLA0E00340 Chr5 complement(57462..60764) [3303 bp, 1100 aa] {ON...    35   1.2  
CAGL0D06622g Chr4 complement(629323..632859) [3537 bp, 1178 aa] ...    35   1.2  
TBLA0I02510 Chr9 (581102..586096) [4995 bp, 1664 aa] {ON} Anc_7....    35   1.3  
Kpol_228.4 s228 complement(7266..8591) [1326 bp, 441 aa] {ON} co...    34   1.3  
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...    34   1.5  
NDAI0F00790 Chr6 complement(189781..190728) [948 bp, 315 aa] {ON...    34   1.5  
Skud_4.684 Chr4 (1211138..1213813) [2676 bp, 891 aa] {ON} YDR409...    34   1.5  
Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {...    34   1.6  
NDAI0G04520 Chr7 (1081291..1084044) [2754 bp, 917 aa] {ON} Anc_2...    34   1.6  
Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..6...    34   1.6  
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    34   1.6  
NDAI0A02470 Chr1 complement(548044..549105) [1062 bp, 353 aa] {O...    34   1.6  
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...    34   1.6  
Suva_1.48 Chr1 (91216..94602) [3387 bp, 1128 aa] {ON} YAL019W (R...    34   1.6  
CAGL0F05533g Chr6 complement(557208..558329) [1122 bp, 373 aa] {...    34   1.6  
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     34   1.6  
NCAS0A08130 Chr1 (1604190..1608143) [3954 bp, 1317 aa] {ON} Anc_...    34   1.6  
KLTH0D16764g Chr4 (1384207..1385466) [1260 bp, 419 aa] {ON} high...    34   1.7  
KLLA0F07799g Chr6 complement(734889..736277) [1389 bp, 462 aa] {...    34   1.8  
Smik_8.84 Chr8 complement(122164..123828) [1665 bp, 554 aa] {ON}...    34   1.8  
NCAS0D03670 Chr4 (684291..686354) [2064 bp, 687 aa] {ON} Anc_6.1...    34   1.9  
Suva_10.228 Chr10 (421809..424079) [2271 bp, 756 aa] {ON} YLR135...    34   2.0  
TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {...    33   2.0  
TBLA0C04390 Chr3 (1057279..1061097) [3819 bp, 1272 aa] {ON} Anc_...    34   2.1  
TPHA0H01040 Chr8 (223391..223765) [375 bp, 124 aa] {ON} Anc_5.99...    32   2.1  
KLLA0D02068g Chr4 (177264..178481) [1218 bp, 405 aa] {ON} conser...    33   2.2  
TBLA0H02840 Chr8 (664282..665604) [1323 bp, 440 aa] {ON}               33   2.3  
Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa]...    34   2.3  
KAFR0H00100 Chr8 complement(6753..8135) [1383 bp, 460 aa] {ON}         33   2.3  
TDEL0A05820 Chr1 complement(1024897..1026327) [1431 bp, 476 aa] ...    33   2.3  
NDAI0B01500 Chr2 (352911..354458) [1548 bp, 515 aa] {ON} Anc_2.5...    33   2.4  
NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {O...    33   2.5  
Kpol_520.16 s520 complement(36589..37230) [642 bp, 213 aa] {ON} ...    33   2.6  
Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W ...    33   2.6  
KLLA0E21517g Chr5 complement(1920040..1922616) [2577 bp, 858 aa]...    33   2.6  
CAGL0M13871g Chr13 complement(1370295..1373570) [3276 bp, 1091 a...    33   2.7  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...    33   2.7  
NDAI0H01040 Chr8 complement(230960..235222) [4263 bp, 1420 aa] {...    33   2.8  
Kpol_1036.97 s1036 complement(248945..254815) [5871 bp, 1956 aa]...    33   2.9  
TBLA0I02620 Chr9 complement(605456..614956) [9501 bp, 3166 aa] {...    33   2.9  
KLLA0F21164g Chr6 complement(1973018..1974280) [1263 bp, 420 aa]...    33   2.9  
SAKL0H06952g Chr8 complement(609523..610884) [1362 bp, 453 aa] {...    33   3.0  
Kwal_26.7819 s26 (524735..525535) [801 bp, 266 aa] {ON} YKL095W ...    33   3.1  
Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar...    33   3.1  
Kpol_1024.43 s1024 (115961..117595) [1635 bp, 544 aa] {ON} (1159...    33   3.2  
KAFR0J02690 Chr10 (514853..515728) [876 bp, 291 aa] {ON} Anc_3.5...    33   3.3  
TBLA0A06330 Chr1 complement(1555490..1557406) [1917 bp, 638 aa] ...    33   3.3  
KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {O...    33   3.4  
Kpol_1037.42 s1037 complement(101878..104220) [2343 bp, 780 aa] ...    33   3.4  
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    33   3.5  
Kpol_423.10 s423 (18069..20648) [2580 bp, 859 aa] {ON} (18069..2...    33   3.5  
NDAI0B00390 Chr2 complement(70401..73115) [2715 bp, 904 aa] {ON}       33   3.5  
NDAI0C00600 Chr3 (113989..116799) [2811 bp, 936 aa] {ON} Anc_2.590     33   3.5  
SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]...    33   3.5  
Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W ...    33   3.6  
TPHA0L02310 Chr12 complement(485671..488949) [3279 bp, 1092 aa] ...    33   3.6  
NCAS0G03690 Chr7 (684097..685146) [1050 bp, 349 aa] {ON} Anc_2.296     33   3.6  
TBLA0C02100 Chr3 (499045..502470) [3426 bp, 1141 aa] {ON} Anc_4....    33   3.6  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...    33   3.7  
Suva_14.43 Chr14 complement(68457..73385) [4929 bp, 1642 aa] {ON...    33   3.7  
NDAI0D01010 Chr4 complement(226976..228244) [1269 bp, 422 aa] {O...    33   3.9  
ZYRO0F06974g Chr6 (568852..570165) [1314 bp, 437 aa] {ON} simila...    33   3.9  
Smik_12.236 Chr12 (453255..454718) [1464 bp, 487 aa] {ON} YLR175...    33   4.1  
KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.3...    33   4.1  
NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787     33   4.1  
NCAS0G00410 Chr7 complement(69305..70990) [1686 bp, 561 aa] {ON}...    33   4.2  
YEL013W Chr5 (128825..130561) [1737 bp, 578 aa] {ON}  VAC8Phosph...    33   4.2  
ZYRO0F11308g Chr6 (927860..929680) [1821 bp, 606 aa] {ON} simila...    33   4.3  
Kpol_303.7 s303 complement(17437..19563) [2127 bp, 708 aa] {ON} ...    33   4.4  
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    33   4.5  
Suva_13.360 Chr13 (600046..602334) [2289 bp, 762 aa] {ON} YMR179...    33   4.5  
Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON} s...    33   4.5  
KNAG0J02710 Chr10 (506187..508745) [2559 bp, 852 aa] {ON} Anc_4....    33   4.6  
CAGL0K07700g Chr11 complement(766120..768867) [2748 bp, 915 aa] ...    33   4.6  
Smik_16.286 Chr16 complement(527077..530319) [3243 bp, 1080 aa] ...    33   4.7  
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    33   4.7  
NCAS0F00580 Chr6 (113589..117035) [3447 bp, 1148 aa] {ON} Anc_5....    33   4.7  
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    33   4.7  
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    33   4.8  
Suva_9.79 Chr9 complement(139114..143580) [4467 bp, 1488 aa] {ON...    33   4.8  
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    33   4.9  
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    33   4.9  
Skud_16.409 Chr16 complement(738102..739418) [1317 bp, 438 aa] {...    32   5.2  
YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON} ...    32   5.4  
Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {...    32   5.4  
YMR029C Chr13 complement(328660..330231) [1572 bp, 523 aa] {ON} ...    32   5.5  
Skud_40.1 Chr40 complement(218..1834) [1617 bp, 538 aa] {ON} YHR...    32   5.5  
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    32   5.6  
SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {...    32   5.7  
Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa] ...    32   5.7  
KAFR0A01600 Chr1 (324219..326366) [2148 bp, 715 aa] {ON} Anc_1.2...    32   5.8  
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    32   5.9  
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...    32   5.9  
Smik_6.426 Chr6 complement(688927..691308) [2382 bp, 793 aa] {ON...    32   5.9  
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    32   6.0  
KAFR0I00750 Chr9 (150956..153493) [2538 bp, 845 aa] {ON} Anc_8.5...    32   6.0  
KLLA0E19405g Chr5 complement(1725950..1728676) [2727 bp, 908 aa]...    32   6.0  
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    32   6.1  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...    32   6.1  
KNAG0C02110 Chr3 complement(409079..412210) [3132 bp, 1043 aa] {...    32   6.1  
YPR042C Chr16 complement(650435..653662) [3228 bp, 1075 aa] {ON}...    32   6.2  
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    32   6.2  
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    32   6.2  
NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]...    32   6.5  
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    32   6.5  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...    32   6.5  
KNAG0B06680 Chr2 (1318427..1319701) [1275 bp, 424 aa] {ON} Anc_4...    32   6.8  
Ecym_2008 Chr2 (10349..11782) [1434 bp, 477 aa] {ON} similar to ...    32   7.0  
TPHA0J00470 Chr10 (106019..107488) [1470 bp, 489 aa] {ON} Anc_6....    32   7.0  
KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {O...    32   7.1  
KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {O...    32   7.1  
Ecym_2276 Chr2 (541135..542649) [1515 bp, 504 aa] {ON} similar t...    32   7.1  
KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {...    32   7.1  
TPHA0C02590 Chr3 (574010..575803) [1794 bp, 597 aa] {ON} Anc_2.5...    32   7.4  
ZYRO0D11154g Chr4 complement(943550..945451) [1902 bp, 633 aa] {...    32   7.5  
TBLA0E01220 Chr5 complement(270455..272359) [1905 bp, 634 aa] {O...    32   7.5  
NCAS0F01270 Chr6 (247049..247924) [876 bp, 291 aa] {ON} Anc_5.56...    32   7.6  
YBL050W Chr2 (125125..125154,125271..126119) [879 bp, 292 aa] {O...    32   7.6  
YLR440C Chr12 complement(1015568..1017697) [2130 bp, 709 aa] {ON...    32   7.6  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...    32   7.7  
Suva_13.411 Chr13 complement(703383..705641) [2259 bp, 752 aa] {...    32   7.7  
TBLA0C00370 Chr3 complement(64323..65228) [906 bp, 301 aa] {ON} ...    32   7.7  
NDAI0H03500 Chr8 (852528..855134) [2607 bp, 868 aa] {ON} Anc_1.3...    32   7.9  
TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {O...    32   7.9  
NDAI0A02890 Chr1 (648510..651236) [2727 bp, 908 aa] {ON}               32   7.9  
TDEL0B02650 Chr2 (475009..477714) [2706 bp, 901 aa] {ON} Anc_5.6...    32   7.9  
TBLA0E02400 Chr5 complement(595914..598733) [2820 bp, 939 aa] {O...    32   8.0  
KAFR0A00770 Chr1 complement(137386..140244) [2859 bp, 952 aa] {O...    32   8.0  
Suva_5.192 Chr5 (293489..294127) [639 bp, 212 aa] {ON} YER079W (...    31   8.1  
TBLA0D03720 Chr4 complement(920546..923770) [3225 bp, 1074 aa] {...    32   8.1  
NDAI0C00790 Chr3 (151077..154331) [3255 bp, 1084 aa] {ON}              32   8.1  
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    32   8.2  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    32   8.3  
TBLA0A00680 Chr1 complement(145681..150165) [4485 bp, 1494 aa] {...    32   8.3  
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    32   8.4  
Kpol_1019.12 s1019 complement(22993..24168) [1176 bp, 391 aa] {O...    32   8.7  
TBLA0B01850 Chr2 complement(423278..424456) [1179 bp, 392 aa] {O...    32   8.7  
TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON} Anc_8...    32   8.8  
Kwal_14.2503 s14 complement(787175..788464) [1290 bp, 429 aa] {O...    32   8.9  
Kwal_47.16881 s47 complement(156308..157603) [1296 bp, 431 aa] {...    32   8.9  
TPHA0G02140 Chr7 (442673..443995) [1323 bp, 440 aa] {ON} Anc_2.3...    32   9.0  
CAGL0F02849g Chr6 (277229..277975) [747 bp, 248 aa] {ON} similar...    31   9.1  
CAGL0J11572g Chr10 complement(1124993..1126375) [1383 bp, 460 aa...    32   9.1  
Kwal_26.6745 s26 (47670..48218) [549 bp, 182 aa] {ON} YAL059W (E...    31   9.2  
NCAS0J02210 Chr10 complement(427346..428107) [762 bp, 253 aa] {O...    31   9.2  
NDAI0C03260 Chr3 (740705..742180) [1476 bp, 491 aa] {ON} Anc_5.8...    32   9.3  
AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}...    32   9.4  
ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {...    32   9.4  
KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {O...    32   9.4  
Skud_5.83 Chr5 (128050..129786) [1737 bp, 578 aa] {ON} YEL013W (...    32   9.7  
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    31   9.8  
NDAI0F00460 Chr6 complement(106641..108614) [1974 bp, 657 aa] {O...    32   9.9  

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar to
            uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score = 1409 bits (3647), Expect = 0.0
 Identities = 717/737 (97%), Positives = 717/737 (97%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI
Sbjct: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV
Sbjct: 61   DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
            AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ
Sbjct: 121  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
            QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE
Sbjct: 181  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL
Sbjct: 241  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA
Sbjct: 301  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE
Sbjct: 361  YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP
Sbjct: 421  KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPS 1620
            I         TDHVRRNSKTLAN           GEVKSINNRLPSSLDVSQDELQFLPS
Sbjct: 481  ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540

Query: 1621 HKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELK 1800
            HKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELK
Sbjct: 541  HKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELK 600

Query: 1801 DRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVL 1980
            DRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVL
Sbjct: 601  DRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVL 660

Query: 1981 KKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKA 2160
            KKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKA
Sbjct: 661  KKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKA 720

Query: 2161 AKKRRLVTKGKKISFKK 2211
            AKKRRLVTKGKKISFKK
Sbjct: 721  AKKRRLVTKGKKISFKK 737

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
            Anc_6.25 YOR001W
          Length = 755

 Score =  732 bits (1889), Expect = 0.0
 Identities = 382/754 (50%), Positives = 515/754 (68%), Gaps = 18/754 (2%)
 Frame = +1

Query: 4    SSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSID 183
            S +    +L KV+ TVRA++ALA+QDV+F++SID  +A+SLE+S   +A ++N++LLSID
Sbjct: 5    SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64

Query: 184  NNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVA 363
             N+E++DGT ENLE++ K+F N+MD LFEK+DRS+DI+ R    ++ +  MQ++D+ +  
Sbjct: 65   ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124

Query: 364  ENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQ 543
            +  P ++I KPQL F TP+DN+ESHPF PLL EKP ALK +EES Q++   E  P H+ Q
Sbjct: 125  DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184

Query: 544  PYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEH 723
            PYEYEI +QEYN+ IL+KK+PIPSTSW D   IWVD ++ LQ +M +L+ S+EIAVDLEH
Sbjct: 185  PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244

Query: 724  HDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQ 903
            HD+R+YYG+ CLMQISTR  DY++DT+ALR+DL++LN VF NP+ITKVFHGAFMDIIWLQ
Sbjct: 245  HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304

Query: 904  RDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAY 1083
            RDLGLY+V LFDTFHAS+A+GLPKHSLAYLLEK+A FKTSKKYQLADWR RPLSKAM AY
Sbjct: 305  RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364

Query: 1084 ARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVAN--IFTPV 1257
            ARADTHFLLNIFDQMRN LI   KLAGVL+ESRNVA RRFEYS ++PK+   N  +++P+
Sbjct: 365  ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424

Query: 1258 EKESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVD 1437
            EK+ PW+T+M+QYNIP  KEPL++ELY+WRD +ARRDDESPR+VMPNQLLVSLVAY P+D
Sbjct: 425  EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484

Query: 1438 PIXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDV----SQDEL 1605
                       TD+VR NSK LAN            +    NN     + V      D  
Sbjct: 485  APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLD-NNVAEEGISVVPETGHDLS 543

Query: 1606 QFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSE-ILLHPEHAVKYHNGSACSV 1782
            Q L  H+++ +   F+ + ++   + K++ +    + L + I    +  +KY        
Sbjct: 544  QKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGKIQT 603

Query: 1783 EESELKDRYLSYIKA--TLLAASKNINMVLETSNS----NAPLETEETHNKKSDQIQVIP 1944
               + K+R   +  A   L      I ++ E   +    N P  T  T+     Q+  + 
Sbjct: 604  TAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATN--AEGQVNEMI 661

Query: 1945 EKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNR----EVKKKD 2109
            EK ED+DE++VL+K   + + +    +  +   E +DY K A +L +D           +
Sbjct: 662  EKPEDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRNNNGN 721

Query: 2110 KKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
            K++ FDPYS+  EGP A KKR+ VT+GK +SFK+
Sbjct: 722  KRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
            YOR001W
          Length = 735

 Score =  725 bits (1871), Expect = 0.0
 Identities = 378/748 (50%), Positives = 511/748 (68%), Gaps = 20/748 (2%)
 Frame = +1

Query: 25   VLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLD 204
            +L  V+ TVRAS+ LA+QDV+F++S+D+ V++S+ +    +  ++N+I+LSID N E LD
Sbjct: 9    LLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLD 68

Query: 205  GTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRR 384
               E L E  K  SN++D LFEK+DRSLDIL   +         ++ ++    EN P +R
Sbjct: 69   EGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQKR 128

Query: 385  ISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEIL 564
            I+KPQL F  P+DNSESHPF PLL EKPNALK+I+EST+L+ + E++PEH+  PYEYEI 
Sbjct: 129  INKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEID 188

Query: 565  NQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYY 744
            NQ YN+ IL+ +EPIPS SW +T  +WVDN+ SL  M+ ++KK +EIA+DLEHHD+R+YY
Sbjct: 189  NQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYY 248

Query: 745  GLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGLYI 924
            G+VCLMQISTR  DY+VDTIALR+DLK+LNEVFT+P + KV HGAFMDIIWLQRDLGLYI
Sbjct: 249  GIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYI 308

Query: 925  VSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHF 1104
            VSLFDTFHAS+ALG P+HSLAYLLE++ANFKTSKKYQLADWR RPLSKAM AYARADTHF
Sbjct: 309  VSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHF 368

Query: 1105 LLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPWRTL 1284
            LLNI+DQ+RN L+ + KL GVL ESRNVA RRFEYSK++P++P  N+++ +EKE PWRTL
Sbjct: 369  LLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRTL 428

Query: 1285 MYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPIXXXXXXX 1464
            M+QYNIP ++E L++ L+EWRDM+ARRDDESPRY+MPNQL+V+LVAY P DP        
Sbjct: 429  MFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQ 488

Query: 1465 XXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPSH------- 1623
              TD+VR NSK +AN                I N L  + D ++ +LQF+  +       
Sbjct: 489  VVTDYVRSNSKIIANL---------------IKNALTRAKDQNR-QLQFVADNHTRESYR 532

Query: 1624 --------KIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEI--LLHPEHAVKYHNGSA 1773
                    +I+     F +I  +L      +Q   S    +    L      ++Y NG  
Sbjct: 533  STDKMTVSQIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEK 592

Query: 1774 CSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHN-KKSDQIQVIPEK 1950
             SV++ +L  R+ +Y K   +    N+   L        L+ ++    KK+     IP K
Sbjct: 593  HSVKQQQLVSRFNTYTKQ--VNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAK 650

Query: 1951 QE-DMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKA-NILASDNREVKKKDKKRVF 2124
             E D+DE+VVL  KK++    K K ++ + ++  +DYSK+  IL  D +  K++ KKR F
Sbjct: 651  PEIDLDEVVVL--KKVNRQPNKTKLEENEKIDF-IDYSKSEKILKGDKQRKKRESKKRQF 707

Query: 2125 DPYSSTGEGPKAAKKRRLVTKGKKISFK 2208
            DP++++ EGPKAA+KR+  T+G+ +S+K
Sbjct: 708  DPFAASNEGPKAARKRKSGTRGRNLSYK 735

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar to
            uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
            Exonuclease component of the nuclear exosome contributes
            to the quality-control system that retains and degrades
            aberrant mRNAs in the nucleus
          Length = 737

 Score =  725 bits (1871), Expect = 0.0
 Identities = 375/745 (50%), Positives = 510/745 (68%), Gaps = 9/745 (1%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            MSSD  D +L  ++ TVRA++AL++QD++F KS+D+ ++ S+E S   + +++N +LLSI
Sbjct: 1    MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            D NN+ ++   +N +E  K+  ++MD LFEK+D + D L R +S N    N+Q+LDD + 
Sbjct: 61   DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKR-NSINQGNSNVQYLDDSSR 119

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
            +  +PS+RI KPQLNFKTP+DN+ESHPFKPLL  KP+AL+ + E  +    TE+IP H+ 
Sbjct: 120  SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
             PY YEI  QEYN  IL+ ++PIPS  W DT+ +WVD   SLQ ++ EL+ + EIAVDLE
Sbjct: 180  HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD+RSYYG+VCLMQISTR +D++VDTIALR++L +LNE+FT+P + KVFHGAFMDIIWL
Sbjct: 240  HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLG+Y+VSLFDT+HAS++LGLP+HSLAYLLEK+A FKTSKKYQLADWR RPL+K M A
Sbjct: 300  QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YARADTHFLLNI+DQ+RN LI   KLA VL +SRNVA RRFEY+ ++PKI  A++F+P+E
Sbjct: 360  YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            K+ PWR LMYQYNIP+ +EPL+R+LYEWRD +ARRDDESPRYVMPNQLLVSLVA  P DP
Sbjct: 420  KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPS 1620
                      TD+VR NSK L+N           G+V S NN   S L+  +D  Q L  
Sbjct: 480  AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDV-STNNAGSSQLE-EKDLSQVLSI 537

Query: 1621 HKIELMTGAFKEIENQLTQATKSKQAMTSSVVL--SEILLHPEHAVKYHNGSACSVEESE 1794
             +I+ M   F  + +++ +A  +  +M    +L   + +   + AV Y   S   ++E++
Sbjct: 538  SQIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQ 597

Query: 1795 LKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQED----- 1959
            L++R L   +        +  + +  +      ET+E     S++  V    + D     
Sbjct: 598  LQERKLEVSEKLKEVQEPDFRLHVNVTTK----ETDEVSKDVSEKDDVNRASETDPLETN 653

Query: 1960 MDEIVVLKKKKIHS-NDQKAKHDDGDIVEEPVDYSKA-NILASDNREVKKKDKKRVFDPY 2133
             DEI+VLKKKK H   D+K   +  D+  EP+DY  A  +L +  +  K+K  KR FDPY
Sbjct: 654  KDEIIVLKKKKRHEPQDRKKVGNSTDV--EPMDYKNAEKLLGNSKKSSKQKTTKRRFDPY 711

Query: 2134 SSTGEGPKAAKKRRLVTKGKKISFK 2208
            +S   GP++AKKR+  T GK +SFK
Sbjct: 712  TSENVGPQSAKKRKKPTPGKNMSFK 736

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
            Anc_6.25 YOR001W
          Length = 790

 Score =  719 bits (1855), Expect = 0.0
 Identities = 384/766 (50%), Positives = 510/766 (66%), Gaps = 35/766 (4%)
 Frame = +1

Query: 19   DNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEK 198
            D +L +V++TVRAS ALA+QDV+F++S+D + A +L+++   +A ++N++LL++D N+E 
Sbjct: 26   DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85

Query: 199  LDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPS 378
            LDGT ENLE+  K+FSN+MD L EK+DRS+D+L R  +TN N  NMQ+LD+ +  ++  S
Sbjct: 86   LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145

Query: 379  RR--ISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYE 552
            +R  I KPQL F  PVDN+E+HPF PLL  KPNALKS++ES QL+   E++PEH+ QPYE
Sbjct: 146  KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205

Query: 553  YEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDF 732
            YEI NQ YN+ IL+  +PIPS  W++T AIWVD   SLQ M+++L   +E AVDLEHHD+
Sbjct: 206  YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265

Query: 733  RSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDL 912
            R+YYG+VCLMQISTRTQDYIVDT+ LR  L+ LNE FTNP ITKV HGAFMDIIWLQRDL
Sbjct: 266  RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325

Query: 913  GLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARA 1092
            GLYIVSLFDTFHAS+ALG PK+SLAYLLEK++NFKTSKKYQ+ADWR RPLSKAM +YAR+
Sbjct: 326  GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385

Query: 1093 DTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESP 1272
            DTHFLLNIFDQMRN L+  GKLAGVL+ESRNVA RRFEY KY+P I  + +++P+EK  P
Sbjct: 386  DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445

Query: 1273 WRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPIXXX 1452
            W+TLMYQYNIP+ KE L++ELY+WRD +ARRDDESPRY+MPNQLLVSLVAY PV+P    
Sbjct: 446  WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505

Query: 1453 XXXXXXTDHVRRNSKTLAN-XXXXXXXXXXXGEVKSI------NNRLPSSLDVSQDELQF 1611
                  TDHVR NSK LAN             +  S+      N    S+   + D  + 
Sbjct: 506  SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565

Query: 1612 LPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEES 1791
            L  H++  +   F  + +++           ++   +  LL  +H           ++ S
Sbjct: 566  LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYS 625

Query: 1792 ELKDRYLSYIKATLLAASKNINMVLETSNS---NAPLETEETHNKKSDQIQ--------- 1935
               D+        LL   +  +  +E       + P+   E    +S+Q +         
Sbjct: 626  VSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAANAE 685

Query: 1936 ----VIPEKQEDMDEIVVLKK---KKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNRE 2094
                V   K+ED+DEI+VLKK    K    ++K   DD +   E +DYSK   +  DN  
Sbjct: 686  ITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVL-DNSN 744

Query: 2095 VKKK-------DKKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
             K+        +K++ FDPY+   EGP+A KKR+ +T+GK +SFK+
Sbjct: 745  TKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
            Anc_6.25 YOR001W
          Length = 738

 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/758 (51%), Positives = 506/758 (66%), Gaps = 21/758 (2%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            M S+    +L K + TVRAS++L  QDV+F  ++D +VA+S+++    +  ++N+IL SI
Sbjct: 1    MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNK-KNMQFLDDVN 357
            D N++    + E + E  ++F+N+ D LFEK+DRS+DI+ + +  N      +Q+LDD+ 
Sbjct: 61   DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 358  VAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHF 537
              ++   +RI+KPQL+F  PVDNSES PFKPLL EKPNALK ++ES Q+V ATE+IP H+
Sbjct: 121  GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 538  QQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDL 717
              PY+YEI NQEYNNDILE + PIPST W ++  +WVD+   LQ ++++LKK  E+A+DL
Sbjct: 181  PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 718  EHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIW 897
            EHHD+RSYYG+VCLMQISTR  DY+VDTIALRD+L +LN+VFT+P++TKVFHGAFMDIIW
Sbjct: 241  EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 898  LQRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMM 1077
            LQRDLGLYIVSLFDTFHASKALG PKHSLAYLLE  ANFKTSKKYQLADWR RPLSK M 
Sbjct: 301  LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 1078 AYARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPV 1257
             YARADTHFLLNIFDQMRN LI   KLAGVL ESR VA RRFEYSK++PK+   ++FTP+
Sbjct: 361  VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 1258 EKESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVD 1437
            EKESPWRTLM+QYN+  +KE L++ LYEWRD +ARRDDESPRY+MPNQLL+SL AY P D
Sbjct: 421  EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 1438 PIXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSI-----NNRLPSSLDVSQDE 1602
            P+         TD VR NSK LAN           G   S      N   P  L +SQ  
Sbjct: 481  PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPFVLTLSQ-- 538

Query: 1603 LQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEI--------LLHPEHAVKY 1758
                            K+I  + T+ T++ Q+ +S   +S +        L   +  V Y
Sbjct: 539  ---------------IKDIGMRFTKLTENFQS-SSCQKISPLQRSSFFGDLSKGKVTVSY 582

Query: 1759 HNGSACSVEESELKDR---YLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQ 1929
            ++     V +S L+ R   +  Y+KA      K  ++V    +   P  T  T +  S  
Sbjct: 583  NDAKTTPVSQSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKT 642

Query: 1930 IQVIPEK-QEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKAN-ILASDNREVKK 2103
            ++  P+  +EDMDEIVVLKK K      K K +D D   E VDYSK + +L     + KK
Sbjct: 643  VEKPPKNIKEDMDEIVVLKKVK--RELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKK 700

Query: 2104 K--DKKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
            K  + K+ FDP+S+  EGPKA KKR+ VTKGK  SFK+
Sbjct: 701  KNNNNKKRFDPFSAISEGPKAPKKRKAVTKGKNASFKR 738

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
            (REAL)
          Length = 745

 Score =  715 bits (1845), Expect = 0.0
 Identities = 368/744 (49%), Positives = 512/744 (68%), Gaps = 7/744 (0%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            M+S++ D +L KV+  +RA+++LA+QDV+F++++D   +  L+     +  ++N I+LSI
Sbjct: 19   MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            D +++ L+   E + ++ K+F N+MD L EK+D SLD LNR S++N++  ++Q+L D + 
Sbjct: 79   DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
             ++ P++R+ KPQL FKTP+DNSESHPF PLL EKPNALK + +S +++   E+ P H+ 
Sbjct: 139  KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
             PYEYEI +QEYN +IL+ K  IPS  W  +  IW+++  +L+ M+++LK + EIAVDLE
Sbjct: 199  HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD+RSYYG+VCLMQ+STR +DY+VDT+ LR+DL +LNEVFTNP I KVFHGAFMDIIWL
Sbjct: 259  HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M A
Sbjct: 319  QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSKY+P  P + +++P E
Sbjct: 379  YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            KE+PWR LMYQYNI  ++E L+++LYEWRD++ARRDDESPR++MPNQLL +LVAY P+D 
Sbjct: 439  KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDE-----L 1605
            I         TDHVR+N+K LAN             ++S+ +    S ++   +     L
Sbjct: 499  IGVVSLSNGVTDHVRQNAKILAN--------LIKSALRSMKDTHKESAEIVSSKFKSASL 550

Query: 1606 QFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYH-NGSACSV 1782
            + +   +I  +   F    +      +S  +  SS++  +IL + E  + Y  +G    V
Sbjct: 551  EAITVSQIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKV 610

Query: 1783 EESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDM 1962
            +  +++DR   +  A  L   ++I   +E      P+  E++   K +     P K ED 
Sbjct: 611  KVEDMRDRAQRFNSA--LVGLEDIKFEVE-----KPVNVEKSEMVKIETTPEPPTKIEDP 663

Query: 1963 DEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYSS 2139
            DE+VVLKKK+IH   Q AK  D    EE VDYSK  N+L+S   +  K+ +KR FDP  +
Sbjct: 664  DEVVVLKKKRIHKK-QVAKRSD-VAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFN 721

Query: 2140 TGEGPKAAKKRRLVTKGKKISFKK 2211
              EGP+A KK+R  T+GK +SFK+
Sbjct: 722  DSEGPRAPKKKRPTTRGKNVSFKR 745

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar to
            uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
            Exonuclease component of the nuclear exosome contributes
            to the quality-control system that retains and degrades
            aberrant mRNAs in the nucleus
          Length = 741

 Score =  713 bits (1841), Expect = 0.0
 Identities = 384/760 (50%), Positives = 506/760 (66%), Gaps = 23/760 (3%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            M+ +S + +L KV+ TVRA+ ALA+QDV+F++S+D  VA SL+K+   + S++N+ LL I
Sbjct: 1    MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            D N+  L+G  E LE+  K+FSN+MD LFEK+DRSLDIL  ++        M +LDD   
Sbjct: 61   DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALM-YLDDAAR 119

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
            ++  P++RI KPQ+ F+ P+DN+E+HPFKPLL  KP+AL+ + +  +LV A EDIPEH+ 
Sbjct: 120  SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
            QPYEYEI NQEYN  IL+  EPIPS  W  +  +WVDN  SL  M+Q+LKKS+EIAVDLE
Sbjct: 180  QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD+RSYYG+VCLMQ+STR  DY+VDT+ALRDDL +LNEVF NPLI KVFHGAFMDIIWL
Sbjct: 240  HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLYIVSLFDT+HAS+ALG P+HSLAYLLE +A+FKTSKKYQLADWR RPLSKAM A
Sbjct: 300  QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YARADTHFLLNI+DQ+RN LI   KLAGVL ESRNVA R F+YSKY+PK+P +++++PV+
Sbjct: 360  YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            +   W+ LM QYNIP++KE L++ LYEWRD +ARRDDESPRYVMPNQLL  LV Y P+DP
Sbjct: 420  RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPS 1620
                      TDHVR N+K LAN             VKS+     +  D+  + +Q    
Sbjct: 480  TGVISVSPTVTDHVRTNAKALANLI-----------VKSLQQIADAGSDIKVESVQHKDQ 528

Query: 1621 H---------KIELMTGAFKEIENQ---LTQATKSKQAMTSSVVLSEILLHPEHAVKYHN 1764
            H         +IE     F ++      L+Q T S  + +SS++   IL  P   V Y  
Sbjct: 529  HDLSQVLTVGQIESQVSQFHDLSKAFKGLSQGTNSSNS-SSSIIFGNILHAPCGFVGYGR 587

Query: 1765 GSACSVEESELKDRYLSYIKATLLAASKNINMVLETSN----SNAPLE----TEETHNKK 1920
                 V + +++ R L   +A     ++    + E       ++ P +    +E   +KK
Sbjct: 588  SLKKPVTDKQIEKRKLELSEALEFIDAETATTIQEEDRGSELTHEPADDKKVSENDESKK 647

Query: 1921 SDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVK 2100
             +  +  PE  ED +EI+ LKK K     +K+K  +    EEP+DY K+  +    ++  
Sbjct: 648  EEAKETEPE--EDKNEIITLKKVK--DRGKKSKRSNESEPEEPIDYKKSKKILETEKK-S 702

Query: 2101 KKDKKRVFDPYSST---GEGPKAAKKRRLVTKGKKISFKK 2211
            K  KKR FDPY+++   G  PK  KKRR+  +GK  SFK+
Sbjct: 703  KSTKKRAFDPYAASNDAGNAPKPKKKRRM-ARGKSASFKR 741

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
            complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  701 bits (1810), Expect = 0.0
 Identities = 374/763 (49%), Positives = 506/763 (66%), Gaps = 26/763 (3%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            MS D    +L  V+ TVRA+++LA+QDV+F++++D  ++ SL +S K + +++N +LLSI
Sbjct: 1    MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            + NNE+L+   E LE+  K+FSNVMD LFEK+DRSLDI+ R  ++NDNK   Q+L D   
Sbjct: 61   NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ 120

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
            ++++PS+R++KPQL F  PVDNSES PF PLL +KP+++KS  +S  ++  +E++P H+ 
Sbjct: 121  SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA 180

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
             PYE EI  QEYN  +L+  EP+ S  W ++ + WVD   +LQ M+ +LK+ +EIAVDLE
Sbjct: 181  HPYEVEIDKQEYNASVLQVAEPLKSQPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLE 239

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD+RSYYG+VCLMQISTR +D++VDT+ALRD+L +LNEVF +P I KV HGAFMDIIWL
Sbjct: 240  HHDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWL 299

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLY+VSLFDT+HAS+ALG P+HSLAYLLEKYANFKTSKKYQLADWR RPLSK M A
Sbjct: 300  QRDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHA 359

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YARADTHFLLNI+DQ+RN LI   KLA VL ESRNVA RRFEYS+++PK+P   +FTP+E
Sbjct: 360  YARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIE 419

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            KE PWRTL+YQYN+P  K  L++ ++EWRDM+ARRDDESPRY+MPNQL++SLV Y P+DP
Sbjct: 420  KEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDP 479

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSI-NNRLPSSLDVSQDELQFLP 1617
                      TDHVR NSK +AN            ++KS+    L +  ++     Q   
Sbjct: 480  AGVISVSNVMTDHVRSNSKVIANLIKKSLE-----DMKSVPAGALTAFQNIDYKIGQKFA 534

Query: 1618 SHK-----IELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSV 1782
            S K     I+ MT  FKEI +  +   K        ++ S I L     V Y +     V
Sbjct: 535  SDKLTISQIQNMTALFKEIASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVV 594

Query: 1783 EESELKDR------YLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIP 1944
               +L  R      +++    T LA    IN+      S+A +  EE   K+ + +   P
Sbjct: 595  TNEQLAGRAEEVEGFMNEANNTTLA----INI-----ESSAEMHVEEPEAKEKNALFSPP 645

Query: 1945 ------------EKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDN 2088
                        +  EDM++I+VLK  K  +N +  K   G   +E +DYSK + + S  
Sbjct: 646  ISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILS-- 703

Query: 2089 REVKKKDKKRVFDPYSSTG--EGPKAAKKRRLVTKGKKISFKK 2211
            +E ++  KKR  DP+      EGPKAAKKR+ + +GK +SFK+
Sbjct: 704  KEKRENSKKRKGDPFGEENGLEGPKAAKKRKQINRGKNVSFKR 746

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
            (REAL)
          Length = 734

 Score =  701 bits (1808), Expect = 0.0
 Identities = 373/745 (50%), Positives = 507/745 (68%), Gaps = 8/745 (1%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            M S++ D +  K+++ VRA+++LASQDV+F+K+++   +N L+     +  ++N I+LSI
Sbjct: 1    MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            D ++E  +   + +  + K+F N+MD L E +D SLD LN  +++  +   +Q+L D + 
Sbjct: 61   DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
             ++  ++R+ KPQL FK  +DNSESHPF PLL EKPNALK + ES +L  A E+ P H+ 
Sbjct: 121  KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
             PY YEI +QEY++D+L+ K+ IPS SW D+  IW+D    L  M+++LK +SEIAVDLE
Sbjct: 181  HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD+RSYYG+VCLMQ+STR +DY+VDTI LRD L +LNEVFT+PLI KVFHGAFMDIIWL
Sbjct: 241  HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M A
Sbjct: 301  QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSK++P+ P + +++P+E
Sbjct: 361  YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            KE+PWR LMYQYNI  +KE L+++LY WRD +ARRDDESPR+VMPNQLL +LVAY P+D 
Sbjct: 421  KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPS--SLDVSQD--ELQ 1608
            I         T+HVR+N+K LAN           G +K  N +  S  S +   D   L+
Sbjct: 481  IGVVSLTNGVTEHVRQNAKVLAN-----LIENALGNIKDTNKKTTSITSSESKPDGISLE 535

Query: 1609 FLPSHKIELMTGAFKEIENQ--LTQATKSKQAMTSSVVLSEILLHPEHAVKY-HNGSACS 1779
             +   +I  +   F  + N   +   TK+  + TSS++L + L   E  + Y   G+   
Sbjct: 536  VITISQIRDIMERFSLLSNSGVINNRTKTGDS-TSSILLGKTLPFEECGISYGKKGTPNK 594

Query: 1780 VEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQED 1959
            V+  ++K R   +  A  LA  +NI   LE      P   E+    + +    +P K E 
Sbjct: 595  VKVEDIKARAQKFNSA--LAGLENIMFELE-KPVTVPASVEKGEAVEIESAPELPSKAES 651

Query: 1960 MDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYS 2136
             D+I+VLKKKK+H   Q AK  D   V+E VDYSK  ++L+S   + +K+ +KR FDP S
Sbjct: 652  FDDIIVLKKKKMHKK-QPAKGKD-MTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSS 709

Query: 2137 STGEGPKAAKKRRLVTKGKKISFKK 2211
            +  EGP+AAKK+R   +GK +SFK+
Sbjct: 710  NDSEGPRAAKKKRPAPRGKNMSFKR 734

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
            exosome exonuclease component; has 3'-5' exonuclease
            activity; involved in RNA processing, maturation,
            surveillance, degradation, tethering, and export; has
            similarity to E. coli RNase D and to human PM-Sc1 100
            (EXOSC10); mutant displays reduced transcription
            elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  698 bits (1801), Expect = 0.0
 Identities = 374/744 (50%), Positives = 506/744 (68%), Gaps = 7/744 (0%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            M+S++ D +L +V+  VRA+++LASQDV+F+K++D   +  L+     +A + N I+LSI
Sbjct: 1    MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            D ++E  +   E++ ++   F N+MD L E +D SLD LN   ++     ++Q+L + + 
Sbjct: 61   DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
                P++R+ KPQL FK+P+DNSESHPF PLL EKPNALK + ES +LV   E+ P H+ 
Sbjct: 121  KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
             PYEYEI +QEY+ +IL+ +E IPS SW D+  IWVD    L+ M+++LK + EIAVDLE
Sbjct: 181  HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD+RSYYG+VCLMQISTR +DY+VDT+ LR++L +LNEVFTNP I KVFHGAFMDIIWL
Sbjct: 241  HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M A
Sbjct: 301  QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSKY+P  P + +++P+E
Sbjct: 361  YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            KESPW+ LMYQYNIP ++E L+RELY+WRD++ARRDDESPR+VMPNQLL +LVAY P D 
Sbjct: 421  KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNR---LPSSLDVSQDE--L 1605
            I         T+HVR+N+K LAN             +K+ N     +PSS +   D   L
Sbjct: 481  IGVVSLTNGVTEHVRQNAKLLANLIRDALR-----NIKNTNEEATPIPSS-ETKADGILL 534

Query: 1606 QFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKY-HNGSACSV 1782
            + +   +I  +   F  + N     +++K    SS++L +IL   EH + Y  +G    V
Sbjct: 535  ETISVPQIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKV 594

Query: 1783 EESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDM 1962
            +  +++ R  ++  A  LA  ++I   +E      P++ EE              + +++
Sbjct: 595  KTEDIRIRAQNFKSA--LANLEDIIFEIE-KPLVVPVKLEEIKTVDPASAPNHSPEIDNL 651

Query: 1963 DEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYSS 2139
            D++VVLKKK I    Q AK + G   ++ VDYSK  NIL++   +  ++ KKR FDP SS
Sbjct: 652  DDLVVLKKKNIQKK-QPAK-EKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSS 709

Query: 2140 TGEGPKAAKKRRLVTKGKKISFKK 2211
               GP+AAKKRR   KGK +SFK+
Sbjct: 710  DSNGPRAAKKRRPAAKGKNLSFKR 733

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
            (REAL)
          Length = 773

 Score =  696 bits (1795), Expect = 0.0
 Identities = 360/741 (48%), Positives = 501/741 (67%), Gaps = 4/741 (0%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            M+S + D +L KV+  +RA+++LA QDV+F+K++D      L+     +A + N I+LSI
Sbjct: 41   MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            D ++E  +  +E++  +  +F N+MD L E +D SLD LNR  ++  N  ++Q+L D + 
Sbjct: 101  DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
                P++R+ KPQL FKTP+DNSESHPF PLL EKPNALK + +S +L+   ++ P H+ 
Sbjct: 161  KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
             PYEYEI +QEY ++IL+ ++ IPS SW D+  IW+D +  L+ M++ELK   EIAVDLE
Sbjct: 221  HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD+RSYYG+VCLMQISTR +DY+VDT+ LR+ L +LNEVFT+P I KVFHGAFMDIIWL
Sbjct: 281  HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M+A
Sbjct: 341  QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSKY+P+IP + +++P+E
Sbjct: 401  YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            KE+PWR LMYQYNI  +KE L+++LY+WRD++ARRDDESPR+VMPNQLL +LVAY P+D 
Sbjct: 461  KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPS 1620
            I         T+HVR+N+K L N              +        S+  ++  L+ +  
Sbjct: 521  IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESM-TNEVSLEAITI 579

Query: 1621 HKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKY-HNGSACSVEESEL 1797
             +I  +   F  + N      ++K   T S++L  IL   E+ + Y +NG    V+  ++
Sbjct: 580  PQIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDI 639

Query: 1798 KDRYLSYIKATLLAASKNINMVLETSNSN-APLETEETHNKKSDQIQVIPEKQEDMDEIV 1974
            + R  S+      A S   + +LE    +  P   ++     ++ +       E+ D+IV
Sbjct: 640  RARAQSFNS----ALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSATIENPDDIV 695

Query: 1975 VLKKKKIH-SNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYSSTGE 2148
            VLKKK IH +    AK   G   E+ +DYSK  N+L+S + + +++ KKR  DP  +  +
Sbjct: 696  VLKKKNIHRTQSMNAKDTMG---EKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLFNDSD 752

Query: 2149 GPKAAKKRRLVTKGKKISFKK 2211
            GP+AAKK+R  T+G+ +SFK+
Sbjct: 753  GPRAAKKKRPATRGRNVSFKR 773

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
            YOR001W
          Length = 735

 Score =  679 bits (1752), Expect = 0.0
 Identities = 361/744 (48%), Positives = 486/744 (65%), Gaps = 13/744 (1%)
 Frame = +1

Query: 19   DNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEK 198
            D +L+KV++T+RAS+ALA+QDV+FH+S+   +  SL+++   M S++N++L SID N+E 
Sbjct: 7    DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEP 66

Query: 199  LDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPS 378
            L    E L E  K+FSN+MD LFE +D S DIL R   +  + + ++FLD+ +  ++ PS
Sbjct: 67   LVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPS 126

Query: 379  RRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYE 558
            +RISKPQLNFK PV+N+E  PF PLL EKP AL+ +   + +V   + +PEH+ QPYEYE
Sbjct: 127  KRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYEYE 184

Query: 559  ILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRS 738
            I +QEY   ++ K EPIPS  W  T A+WVDNI  L+ M+ +LK  +EIAVDLEHHD+RS
Sbjct: 185  IEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRS 244

Query: 739  YYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGL 918
            YYG+VCLMQISTR +DY++DTIALRDDL++LNEVF NP I KVFHGAFMDIIWLQRDLGL
Sbjct: 245  YYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGL 304

Query: 919  YIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADT 1098
            Y+VSLFDTFHAS+A+GLP+HSLAYLLEK+ANFKTSKKYQLADWR RPLSKAM AYARADT
Sbjct: 305  YVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADT 364

Query: 1099 HFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPWR 1278
            HFLLNI+DQ+RN LI   KLAGVL ESRNVA RRFEYSK++P  P   ++ P++K  PW+
Sbjct: 365  HFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWK 424

Query: 1279 TLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPIXXXXX 1458
             LM+QY+I  ++E L+++LY+WRD +ARRDDESPRYVMPNQLLV L    P +PI     
Sbjct: 425  VLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISV 484

Query: 1459 XXXXTDHVRRNSKTLA----NXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPSHK 1626
                TDHVR NS  LA    N           G  ++ NN        S D    L   +
Sbjct: 485  NSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNN--------STDAASLLTVPQ 536

Query: 1627 IELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELKDR 1806
            I+ +   F  +    T      +   SS + ++IL   + AV Y   +   + + EL  R
Sbjct: 537  IQKLAACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKR 596

Query: 1807 YLSYIKA-----TLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPE-KQEDMDE 1968
                +++        +    I  + + SN+      EE      ++++  P   +EDMDE
Sbjct: 597  AAKALQSMEQFDEATSYYMPIPEIAKESNT-----MEEIRPPAPEEVKESPSPPKEDMDE 651

Query: 1969 IVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSS--- 2139
            I+ LKK K   +    +    +     VDY+K   + + N++  K  KKR FDPY++   
Sbjct: 652  IITLKKIKKQKSQSPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKFDPYAASNH 711

Query: 2140 TGEGPKAAKKRRLVTKGKKISFKK 2211
            + + P+A KKR+ V + + +SFK+
Sbjct: 712  SSDAPRAPKKRKPVNRERNVSFKR 735

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
            Anc_6.25 YOR001W
          Length = 743

 Score =  675 bits (1742), Expect = 0.0
 Identities = 361/747 (48%), Positives = 492/747 (65%), Gaps = 14/747 (1%)
 Frame = +1

Query: 13   SGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNN 192
            + D +L  V+ +VRA++ALA+QDV+F++S+D  +A+SL  + + +  ++N+I+ S+D N+
Sbjct: 2    NADELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENS 61

Query: 193  EKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAEND 372
            E L    ENL+E  K+  N++D LFE AD S+D L++ S  + N   M++L+D    E+D
Sbjct: 62   EGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESD 121

Query: 373  PSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYE 552
               R+SKPQLNF  PVDNSE+HPF+PLL +KPNA+  ++E  ++V  TED P+H+ QPYE
Sbjct: 122  NVTRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYE 181

Query: 553  YEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDF 732
             EI  QEYN  +L+  +PIPS  W +T AIWVDN  SL  M+ ELK ++E+AVDLEHHDF
Sbjct: 182  TEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDF 241

Query: 733  RSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDL 912
            RSYYG+ CLMQISTR  DY+VDTIALRD L++LN VFT+P ITK+ HGAFMDIIWLQRDL
Sbjct: 242  RSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDL 301

Query: 913  GLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARA 1092
            GLYIVSLFDT+HAS+ALG P+HSLAYLLE++A+FKTSK+YQLADWR RPLSKAM AYARA
Sbjct: 302  GLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARA 361

Query: 1093 DTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESP 1272
            DTHFLLNIFDQ+RN LI   KLA +L ESR VA RRFEYSKYKP +P + +F+P E + P
Sbjct: 362  DTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMP 421

Query: 1273 WRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPIXXX 1452
            WR+++YQYNIP  K  L++ L+EWRD +ARRDDESPRY+MPNQL+ SLV Y P +P    
Sbjct: 422  WRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVI 481

Query: 1453 XXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVK------SINNRLPSSLDVSQDELQFL 1614
                  TD VR N+K +AN             +       +  ++  SS D+S  +++F+
Sbjct: 482  SVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKFI 541

Query: 1615 PSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESE 1794
             S + E +   +    + L   T SK+    S+V S+I    +  + Y  G+   + E +
Sbjct: 542  VS-QFENILEKYSSNNSNLNDVT-SKEG-KDSLVFSKIFNSRDDIITYDKGTKHLITEQQ 598

Query: 1795 LKDRY----LSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDM 1962
            L DR      +  +A  +A S  +    + S      E EE  ++         E+QED+
Sbjct: 599  LSDRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDL 658

Query: 1963 DEIVVLKKKKIHSNDQ-KAKHDDGDIVEEPVDYSKAN-ILASDNREVKKKDKKRVFDPYS 2136
            DEI+VLK  K   N Q + +    D     +DYSK + IL+ DNR  ++   KR +DP+S
Sbjct: 659  DEIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILSQDNR--RRTPNKRKYDPFS 716

Query: 2137 STG--EGPKAAKKRRLVTKGKKISFKK 2211
            +       + AK+RR   K + +SFK+
Sbjct: 717  ADNNENALQGAKRRRPTAKNRNVSFKR 743

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar to
            uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
            Exonuclease component of the nuclear exosome contributes
            to the quality-control system that retains and degrades
            aberrant mRNAs in the nucleus
          Length = 744

 Score =  674 bits (1739), Expect = 0.0
 Identities = 356/748 (47%), Positives = 496/748 (66%), Gaps = 11/748 (1%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            MSS+  D +L  +++TVR+S+ALA+QD++F+KS+D+++  SLE +  ++ S++N++LLSI
Sbjct: 1    MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            D NN+ +    ++  +  K  SN+MD LFEK+D +LD +   +  N    ++++L+D + 
Sbjct: 61   DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
            + N PS+RI KPQL+FKTPVDN+E HPFKPLL  KP++L+  E S ++V   E IP H+ 
Sbjct: 121  SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
             PYEYEI +Q+YN+ IL   EPIPS  W +T AIWVD +  L  M  EL K++E+A+DLE
Sbjct: 181  HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD+RSYYG+VCLMQIS R  D+IVDTIALR++L +LN++FT+P +TKV HGAFMDIIWL
Sbjct: 241  HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLYIV LFDT+HAS+ LG PKHSLAYLLE++ANFKTSKKYQLADWR RPL+K M+A
Sbjct: 301  QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YARADTHFLLNIFD++RN L+   K++ VL ESR VA RRFEYS ++PK+P + +F+P+E
Sbjct: 361  YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            K+ PW+ +M+QYNIP  KE L+R LYEWRD +ARRDDESPRYVMPNQLLVSLVA  P +P
Sbjct: 421  KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPS 1620
            I         ++H+R NSK +AN               S    L S+     D    + +
Sbjct: 481  INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 1621 HKIELMTGAFKEIENQL-TQATKSKQAMTSSVVLSEIL-LHPEHAVKYHNGSACSVEESE 1794
             +I+ +   F  + +++ +Q   ++Q    SV+ + I  L    AV+Y   +   + + E
Sbjct: 541  SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE 600

Query: 1795 LKDRYLSYIKATL---LAASKNINMVLETSNSNAPLETEETHNKK----SDQIQVIPEKQ 1953
            L  R    I  TL       +  ++VL ++   AP +     N+     SD  Q   E +
Sbjct: 601  LLKRQ-HEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQ--EEIE 657

Query: 1954 EDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANIL--ASDNREVKKKDKKRVFD 2127
            E+ DE++ L+K++  SN+ K K        E +DY+  + L  ++ N    +K KKR FD
Sbjct: 658  ENKDEVITLRKRQSQSNN-KRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFD 716

Query: 2128 PYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
            PYS    GP+  KK+    KGK +SFK+
Sbjct: 717  PYSVEHVGPQPIKKKSKPAKGKNVSFKR 744

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
            YOR001W
          Length = 771

 Score =  670 bits (1728), Expect = 0.0
 Identities = 367/755 (48%), Positives = 492/755 (65%), Gaps = 18/755 (2%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            MS D+ + +L+ ++  VRAS ALA+QDV+F+KS+D  V++SL K+      + N++LLSI
Sbjct: 26   MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            D N   L+   + + +    FSN+MD L EK+D  +D L++ ++ N       FLD+ + 
Sbjct: 86   DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
              ++PS+RI KPQL F  PVDN++S PFKPLL+EKPNALK +++S  LV  +  +P H+ 
Sbjct: 146  TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
            QPYEYEI NQEYN +++E ++P P   W  T+AIW+D   SL D++ +L+K SEIAVDLE
Sbjct: 206  QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD RSYYG+ CLMQISTR QDYIVDTI+LRDDL +LNE+FTNP ITKVFHGA MDIIWL
Sbjct: 266  HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLYIVSLFDTFHASKALGL +HSLAYLLE YA+FKTSKKYQLADWRRRPL+  M+A
Sbjct: 326  QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YAR+DTHFLLNIFDQ+RN LI   KLAGVL ESRNVA RRFEY K++P +P+ N++T +E
Sbjct: 386  YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
            KE+PW++L+ QYNI  +KE L+++L+EWRDM+ARRDDESPRY+MP Q+L+SL++Y P D 
Sbjct: 446  KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSS--LDVSQDELQFL 1614
                      T+HVR NS TLAN              KSI N   SS   ++S+ +    
Sbjct: 506  SGVISVSNMVTEHVRSNSTTLANLIKKALE-----STKSIPNSSDSSSTFNMSRTDTNVA 560

Query: 1615 PSHKIELMTGAFKEIENQLTQATKSKQAMT-----SSVVLSEILLHPEHAVKYHNGSACS 1779
                I  +     +  N L++   + + +T     SS++ S I+        Y      S
Sbjct: 561  SLISITEINNICLKF-NSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTS 619

Query: 1780 VEESELKDRYLSYIKATLLAASKNINMVLE---TSNSNAPLETEE---THNKKSDQIQVI 1941
             +  ++  R++  +   L   S N + + +       +  + TE    T   KS Q +  
Sbjct: 620  FKSEDMIARHIR-LSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTT 678

Query: 1942 PEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKA-NILASDNREVKKKDKKR 2118
             E  ED +EI+VL  KK++   QK K D        VDYSKA  I    +  +    KKR
Sbjct: 679  KEINEDNEEIIVL--KKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKR 736

Query: 2119 -VFDPYSSTGEG---PKAAKKRRLVTKGKKISFKK 2211
              FDPY++ G+    P+A KKR+  T+GK IS+K+
Sbjct: 737  KSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR001W
            (RRP6)
          Length = 745

 Score =  657 bits (1696), Expect = 0.0
 Identities = 353/753 (46%), Positives = 479/753 (63%), Gaps = 17/753 (2%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            M+S   D + K+++ T+RA+ AL++QD++F++S+  SV   L+ +  ++ S++N +LLS+
Sbjct: 1    MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
            D NN +L    +N E+  KE SNVMD +FEK+D + D +   SS+ +   NMQ+L D + 
Sbjct: 61   DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 361  AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 540
             ++ PS+RI KPQL FKTPVDN+E HPFKPLL EKP+ALK +EES  L    E++P H+ 
Sbjct: 121  DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 541  QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
             PYEYEI  Q YN+ +LE +E I    W  T  IWVDN+ SL  M+ ELK+  E+AVDLE
Sbjct: 181  HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 721  HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 900
            HHD+RSYYG+VCLMQIS+R++D++VDTIALRDDL +LN +  +P + KVFHGAFMD+IWL
Sbjct: 241  HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 901  QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 1080
            QRDLGLY+VSLFDT+HAS+ALG PKHSLAYLLE +A FKTSKKYQLADWR RPL K +  
Sbjct: 301  QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 1081 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 1260
            YAR+DTHFLL+I+D +RN L+ +GKLA VL  SRNVA RRFEY+ ++P+IP +N+++P+E
Sbjct: 361  YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 1261 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 1440
               PWR LMYQYN+P  KEPL+++LYEWRD +ARRDDES RYVMPNQLLVSLV+  P + 
Sbjct: 421  STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 1441 IXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPS 1620
                      TD+VR N++TLAN           G          SS     +    L  
Sbjct: 481  AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVA--EFSSSERALSNPAATLSL 538

Query: 1621 HKIELMTGAFKEIENQLTQATKSKQAM----TSSVVLSEILLHPEHAVKYHNGSACSVEE 1788
            H I+ +   F+ +   L +A K   ++    +SS++ +  L     AV+Y NG    + +
Sbjct: 539  HMIQNLDDHFRSL---LMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGD 595

Query: 1789 SELKDR---YLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQE- 1956
            + L+ R    L    +  +    +I      S+S  P  +E+    +  + Q   +K E 
Sbjct: 596  NVLQTRKHALLQKFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEP 655

Query: 1957 --DMDEIVVL-KKKKIHSNDQKAKHDDGDIVEEPVDYSKANIL------ASDNREVKKKD 2109
              +  EIVVL KKKK H+   K          E VDYS A  +      ++  R  K + 
Sbjct: 656  DFEKSEIVVLRKKKKAHAQKPKGTSSS---PTETVDYSNAKEVLGKGTSSTAKRGDKDRP 712

Query: 2110 KKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFK 2208
            +KR FDPY      P   KK+   +KGK ISFK
Sbjct: 713  RKRKFDPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
            Ashbya gossypii ACL001C
          Length = 747

 Score =  655 bits (1691), Expect = 0.0
 Identities = 361/754 (47%), Positives = 481/754 (63%), Gaps = 17/754 (2%)
 Frame = +1

Query: 1    MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 180
            MSSD+ D +L K++ TVRA+++LA+QD++F + +D SV   L+++ + + S++N ++LS 
Sbjct: 1    MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNR--KSSTNDNKKNMQFLDDV 354
               N  L+   +NLE   K+ SN++D LFEK+D SLD+L +   SS++    NMQ+L+  
Sbjct: 61   SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 355  NVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEH 534
            +  +   S+RI KPQL FK PVDNSE HPFKPLL  KP+ALK +EE + L + TE +P H
Sbjct: 121  SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 535  FQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVD 714
            +  PYEYEI NQ Y++ +L  KEPI  ++W +   IWVDNI +L DM+  LK   EIAVD
Sbjct: 181  YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 715  LEHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDII 894
            LEHHD+RSYYGLVCLMQISTR  D++VDTIALR DL++LNE+FT+P I KVFHGAFMDII
Sbjct: 241  LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 895  WLQRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAM 1074
            WLQRDLGLY+VSLFDT+HAS+ALG PKHSLAYLLE +ANFKTSKKYQLADWR RPLSK M
Sbjct: 301  WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 1075 MAYARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTP 1254
              YARADTHFLLNI+D++RN LI   KL+GVL  SRNVA RRFEY+ ++PK+    +F+P
Sbjct: 361  KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 1255 VEKESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPV 1434
            +EK+ PWRTLM QYN+P  KEPL+R+LY+WRDM+AR+DDES RYVMPNQLLVSLV   P 
Sbjct: 421  IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 1435 DPIXXXXXXXXXTDHVRRNSKTLANXXXXXXXXXXXG--EVKSINNRLPSSLDVSQDELQ 1608
            DP           DHVR N++ L N           G  E +SI N   + +     E+ 
Sbjct: 481  DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540

Query: 1609 FLPSHKIELMTGAFKEIENQL-TQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVE 1785
                  I+ M   FK + +++ + A +       S++    L     AV Y++     V 
Sbjct: 541  V---SLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVN 597

Query: 1786 ESELKDR---YLSYIKATLLAASKNINMVLETSNSNAPLETEETHN----KKSDQIQVIP 1944
            + EL DR             AA   I   +E  +SN+ L  + T N     K +      
Sbjct: 598  DRELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTSNVESPSKEESKNNSD 657

Query: 1945 EKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDK---- 2112
            + +ED  EI+VLK+K+ + ++ K+        +E VDY+  N +  +  +  K +     
Sbjct: 658  DLKEDKHEIIVLKRKRDYGSNTKSTSKQPK--KEHVDYNNVNSILDNTSQQDKPNSGRHV 715

Query: 2113 -KRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
             KR F        G  A KK R  +KGK +S+KK
Sbjct: 716  DKRKFHSDLQGSIGAAAIKKPR--SKGKTVSYKK 747

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
            (RRP6) - involved in 5.8S rRNA processing [contig 185]
            FULL
          Length = 735

 Score =  645 bits (1663), Expect = 0.0
 Identities = 339/748 (45%), Positives = 483/748 (64%), Gaps = 15/748 (2%)
 Frame = +1

Query: 10   DSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNN 189
            D   ++L +V+ T+RAS+A+++QDV+F+KS+D++++ SL+++   + S++N++++SID+N
Sbjct: 7    DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDN 66

Query: 190  NEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAEN 369
            N+ ++     LE        VMD+LFEK++ +L  + +K S N    N+Q+LDD     +
Sbjct: 67   NDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGS-NIIGNNLQYLDDSQPLTD 125

Query: 370  DPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPY 549
                +I+KPQ +F  PVDN+ESHPFKPLL++KPNAL+ +++  QL +  E IP H+  PY
Sbjct: 126  TTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPY 185

Query: 550  EYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHD 729
            EYEI +QEY+  +LE + PIPS  W +T+A WVDN+ +L DM++EL K+ E+A+DLEHHD
Sbjct: 186  EYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHD 245

Query: 730  FRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRD 909
            +R+YYG+ CLMQISTR  D++VDTIALRD L +LNE+FTNP + KVFHGAFMD+IWLQRD
Sbjct: 246  YRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRD 305

Query: 910  LGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYAR 1089
            LGLY+VSLFDTFHAS+ LG PKHSLAYLLE+YA+FKTSKKYQLADWR RPLSK + AYAR
Sbjct: 306  LGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYAR 365

Query: 1090 ADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKES 1269
            ADTHFLLNI+DQMRN LI  GKLA  L  SR VA RRFEY+K++P +  + +++PVE+E 
Sbjct: 366  ADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERED 425

Query: 1270 PWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPIXX 1449
            PWR+L++ YNIP  K  L++ LYEWRD +ARRDDESPRYVMPNQLLV+LV   P D    
Sbjct: 426  PWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGL 485

Query: 1450 XXXXXXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPSHK- 1626
                   T+HVR N+K+L+               + I   L S  D+  D++  + S+K 
Sbjct: 486  LSVTSFVTEHVRSNAKSLS---------------QLIKKTLASPQDLFTDQINHMDSNKS 530

Query: 1627 ---IELMTGAFKEIENQLTQATKSKQAMT--SSVVLSEILLHP------EHAVKYHNGSA 1773
                +L  G  K       Q T+  + +      V+    L P      E  V Y     
Sbjct: 531  MVDSKLSPGDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQV 590

Query: 1774 CSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQI--QVIPE 1947
              +E + L DR     +     A+    + +    + AP  ++E    ++ ++    + +
Sbjct: 591  HHIEPTVLDDRRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQ 650

Query: 1948 KQEDMDEIVVLKKKK-IHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVF 2124
             +ED DEIVVLK++K +  +    K+ +G+  +E +D+     + +    V +K  KR F
Sbjct: 651  LKEDKDEIVVLKRRKALPQSSSPPKNAEGN-PKEILDFKNNKKIMTATASVPRKSTKR-F 708

Query: 2125 DPYSSTGEGPKAAKKRRLVTKGKKISFK 2208
            DPY+    GP   K+R+  T+G + SFK
Sbjct: 709  DPYAIQASGPDGVKRRK-KTRGIQKSFK 735

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
            similar to uniprot|Q12149 Saccharomyces cerevisiae
            YOR001W RRP6 Exonuclease component of the nuclear exosome
            contributes to the quality-control system that retains
            and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  645 bits (1663), Expect = 0.0
 Identities = 343/734 (46%), Positives = 477/734 (64%), Gaps = 5/734 (0%)
 Frame = +1

Query: 22   NVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKL 201
            +VL +V+ T+RAS+A+ +QDV F+K++D S+A S+      +  ++N+ILLS+D NN+ +
Sbjct: 11   SVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDII 70

Query: 202  DGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSR 381
            +  +E LE        VMD+LFEK++ +L     K    +  K +Q+LDD     +   +
Sbjct: 71   EQGSEGLESAWSNVGEVMDLLFEKSEHAL-AAGEKRDNGELSKTVQYLDDSPSLHDGAPK 129

Query: 382  RISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEI 561
            +I KPQL FK P+DNSESHPFKPLL +KP+AL+S++ES +L    ED+P H+ QPYEYEI
Sbjct: 130  KILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEYEI 189

Query: 562  LNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSY 741
             +QEYN  +L+  EP+PS  W +T A WVDN ++L+ M+ EL  ++EIA+DLEHHD+R+Y
Sbjct: 190  DHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYRTY 249

Query: 742  YGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGLY 921
            YG+ CLMQISTR +D+++DTIALRDDL +LNEVFT+P ITKV HGAFMDIIWLQRDLGLY
Sbjct: 250  YGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLY 309

Query: 922  IVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTH 1101
            IVSLFDT+HAS+ LG PKHSLAYLLE+YA+FKTSKKYQL+DWR RPL KA+ AYARADTH
Sbjct: 310  IVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTH 369

Query: 1102 FLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPWRT 1281
            FLLNI+D MRN LI   KL+ VL +SRNVA RRFE++ ++PKI  +++F+P+E+E PWRT
Sbjct: 370  FLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRT 429

Query: 1282 LMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPIXXXXXX 1461
            LM+QYNIP  K  L+R LYEWRDM+ARRDDESPRYV+PNQLLVSL    P  P       
Sbjct: 430  LMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATS 489

Query: 1462 XXXTDHVRRNSKTLANXXXXXXXXXXXGEVKSINNRLPSSLDVSQDELQFLPSHKIELMT 1641
               T+H+R+N+K+LA                     L S+  V       + S  IE  +
Sbjct: 490  TFVTEHIRQNAKSLA----LLIKKSLESSSNEFGQLLNSANTVQNSSPTKMSSEDIEKNS 545

Query: 1642 GAF-KEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELKDRYLSY 1818
              F K +E+   +          S +  +  +  E  V Y    A  V+ + L++R    
Sbjct: 546  RMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENRRHQV 605

Query: 1819 IKATLLAASKNI---NMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKK 1989
             K     A ++I    + +  ++S+A  + E          +    ++E+MDE++VLK++
Sbjct: 606  SKK--YEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIVLKQR 663

Query: 1990 KIHSNDQKAKHDDGDIVEEPVDYSKA-NILASDNREVKKKDKKRVFDPYSSTGEGPKAAK 2166
            K  ++ ++   D      EP+D   A  IL + +  V++  K+  FDPY++   GP + K
Sbjct: 664  KTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKKR--FDPYATLAAGPPSVK 721

Query: 2167 KRRLVTKGKKISFK 2208
            KR+  TKG + SF+
Sbjct: 722  KRK-KTKGLQKSFR 734

>TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2.16
            YNL225C
          Length = 1081

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 48/200 (24%), Positives = 85/200 (42%), Gaps = 2/200 (1%)
 Frame = +1

Query: 4    SSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSID 183
            S+D  D  +     TV    +L  + +EF K+  T     +     ++A  M    L   
Sbjct: 483  STDLNDIEVNDDDMTVLEMQSLFKRTLEFIKNHQTEYRYQISTLSTTIAQNMEKKDLEQK 542

Query: 184  NNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNK--KNMQFLDDVN 357
              NEKL   +  LEE     SN M  L E   R LD +N+K S   NK    +   +D+N
Sbjct: 543  ILNEKLIDKDNTLEEFKSRLSNYMSKLAELEAR-LDEINKKESITTNKLIDELNIKNDLN 601

Query: 358  VAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHF 537
            +   +  + +++ Q    +   + ++      ++EK   +K++E    L  +T +     
Sbjct: 602  IKIKELEKYVTEKQDQIDSL--SKDAKELNEKIVEKVARIKALE--ANLDTSTNNYENMQ 657

Query: 538  QQPYEYEILNQEYNNDILEK 597
            Q+  E E   ++YN ++  K
Sbjct: 658  QRVNELED-EEKYNIELSSK 676

>Suva_4.430 Chr4 complement(756076..758643) [2568 bp, 855 aa] {ON}
            YBR179C (REAL)
          Length = 855

 Score = 40.8 bits (94), Expect = 0.015
 Identities = 63/293 (21%), Positives = 117/293 (39%), Gaps = 16/293 (5%)
 Frame = +1

Query: 40   METVRASNALASQDVEFHKSIDTSVANSLEKSMK---SMASVMNNILLSIDNNNEKLDGT 210
            M++++ +  ++ Q+         +  N L  S K   S+AS    ++  +    +K+   
Sbjct: 319  MDSLQTAEVMSRQEEIDLVIFVVNAENQLTLSAKEFISLASREKKLMFFVVKKFDKIRDK 378

Query: 211  NENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRIS 390
                E + K+   + D+  E   R+ D ++  S   D   +    DD    +ND     +
Sbjct: 379  QRCKELILKQ---IRDLSPETHKRAADFVHFVSKNGDEIADYHGGDDSG--DNDDGEPGN 433

Query: 391  KPQLNFKTPVD-NSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILN 567
             P  N     D +S     +  +++K +  K +   T L     DI    +         
Sbjct: 434  DPYSNSDPDPDFDSLEDSLRNFVLKKRSLSKLLPAKTYLSKLLSDITSISKSNITIYTEE 493

Query: 568  QEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQEL--------KKSSEIAVDLEH 723
            +E  N+ LE   P   T     N    D  NS+  M +E         K++   A+D+  
Sbjct: 494  KEKINEELETLRPEILTVQTKCN----DLTNSVDKMAEETIALAYNNTKETLLSALDVPL 549

Query: 724  HDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVF----TNPLITKVF 870
            H++  Y GL  +      T+D+IV+ I   D+   L+E+F    T+ L+ K++
Sbjct: 550  HEYPKYQGLAQIYDFIFTTEDFIVNQI---DEAINLSELFAKQRTDLLVKKIY 599

>TBLA0B08000 Chr2 (1900021..1905114) [5094 bp, 1697 aa] {ON} Anc_5.75
            YHR164C
          Length = 1697

 Score = 40.0 bits (92), Expect = 0.028
 Identities = 39/179 (21%), Positives = 81/179 (45%), Gaps = 7/179 (3%)
 Frame = +1

Query: 91   HKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEF-SNVMDVLF 267
            H+ I   + + ++ +  +   + NN+   ++NN   +   N +++EV KE  +N +  ++
Sbjct: 627  HELIQEGIKHKIQNNSITTKYLQNNLTSLLENNKFSILICNSSIDEVRKEIETNHLKNVY 686

Query: 268  EKADRSLDILNRKS----STNDNKKNMQFLDDVNVAEN--DPSRRISKPQLNFKTPVDNS 429
            E  D+ +D +N+      S +   + M   + +++ EN   P   I K  L+    + N+
Sbjct: 687  EFLDKCIDTINKGEPIPVSGSSKTERMAISNIIDIEENIWSPMYGI-KGFLDATVEIRNA 745

Query: 430  ESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEP 606
                  P  I K   L++I    Q  + T  + + ++ P E+ +L   Y+ D    K P
Sbjct: 746  AGKTIAPFEI-KTGKLRNISHEAQGFVYTMLLNDRYELPIEFCLL--YYSRDSHMTKYP 801

>NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177
           YAR019C
          Length = 897

 Score = 39.7 bits (91), Expect = 0.034
 Identities = 49/217 (22%), Positives = 83/217 (38%), Gaps = 28/217 (12%)
 Frame = +1

Query: 55  ASNALASQDVEFHKSIDTSVANSLEKSMKSM------ASVMNNILLS------IDNNNEK 198
           A +   SQ      S  TS ++S   S+K+M      +++ NN  L+       D +N  
Sbjct: 251 AQSQSQSQSQSQSHSHTTSQSSSSLSSIKAMTPTNTISNINNNFTLNGFQKFHKDLSNIS 310

Query: 199 LDGTNENLEEV-----------CKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFL 345
           LD   EN E              + FSN  ++     D S++I      T +N + ++  
Sbjct: 311 LDEIKENEESTQFFQSHETLATAQTFSNTNNIT---NDNSININTSIYLTPENSQTLESF 367

Query: 346 DDVN-----VAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVL 510
           D+ N       +  P    SK ++   T +DN+E+ P+    +  PN L     ++ +  
Sbjct: 368 DNNNNKSQQQQQQQPLPNFSKTKMRSNTLMDNNETKPYFKRTLSVPNELTVTNPTSPIPQ 427

Query: 511 ATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPSTS 621
           +       F          +E NND    + P P  S
Sbjct: 428 SAIPSSSAFFNDINSSTTKRENNNDYKFTQPPRPRIS 464

>NCAS0E03950 Chr5 complement(773762..776764) [3003 bp, 1000 aa] {ON}
           Anc_5.51
          Length = 1000

 Score = 39.7 bits (91), Expect = 0.035
 Identities = 53/208 (25%), Positives = 87/208 (41%), Gaps = 23/208 (11%)
 Frame = +1

Query: 85  EFHKSIDTSVANS-LEKSMKSMASVMNNILLSID--NNNEKLDGTNENLEEVCKEFSNVM 255
           +  K I T    S L+K     +    N   SI   N NE  D  +E+ +E  ++   + 
Sbjct: 368 QLEKKIQTVGGQSFLDKRPTQESPAKKNTSSSIQYVNVNEDEDQGSED-DEYLQQLQEIE 426

Query: 256 DVLFEKADRSLDILNRKSSTNDNKKNMQF-LDDVNV-----AENDPSRRISK-------- 393
             + E   RS++  N+K+ T   +KN     DD+N+     A+ +  ++I+K        
Sbjct: 427 --MMEAYQRSMNDSNKKTQTTLTEKNNSLEQDDLNIEQLSKAKANDLKKITKKLEFQKDV 484

Query: 394 ---PQLNFKTP--VDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYE 558
              P+ N      VD ++  P KP+L E    L  I      V    D   +    ++ E
Sbjct: 485 TILPEENVMNSNNVDVNDKLPPKPILTENEQNLNYIVSKIPAV----DFSNNSSLLFQNE 540

Query: 559 ILNQEYNNDILEKKEPIPST-SWVDTNA 639
              ++ N+D   KK P+P T SW   N+
Sbjct: 541 TTEKKVNDDTNMKKAPLPETPSWFHGNS 568

>NDAI0G04790 Chr7 (1151205..1154699) [3495 bp, 1164 aa] {ON} 
          Length = 1164

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 62/272 (22%), Positives = 115/272 (42%), Gaps = 5/272 (1%)
 Frame = +1

Query: 67   LASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNE--KLDGTNENLEEVCKE 240
            + S+   F  S D      +  ++ +  S + N+  + D+  E  KL    +NLE +   
Sbjct: 534  VTSKFKSFLNSSDPVATRLILHALFTNWSSLVNVAFTTDDIEELVKLLVFKDNLELLNHL 593

Query: 241  FSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRIS-KPQLNFKTP 417
             +N  D LFE+ +    I+++ SST D +  + +L  + +   D   RI    Q++ +  
Sbjct: 594  LTN--DDLFEEENIMRAIIDQLSSTPDIETTIPYLSKIPIQCFDKKTRIKLLDQISMQRR 651

Query: 418  VDNSESHPFKPLLIEKPNALKSIEESTQLV--LATEDIPEHFQQPYEYEILNQEYNNDIL 591
            +  ++ H    LL E P    +IE     +  L ++DI    +  +  ++  + +NN IL
Sbjct: 652  ITENDMHMLFHLL-ESPTFRSTIESDVTSLYSLMSQDIN---RLTFTNKVFERIWNNHIL 707

Query: 592  EKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQIS 771
            + KE        DT+  ++ N+  L  + + LK S         +DF   Y  +  + +S
Sbjct: 708  QLKE--------DTSVSFIQNM--LATVSENLKSS---------NDFDMVYFQMAFLILS 748

Query: 772  TRTQDYIVDTIALRDDLKMLNEVFTNPLITKV 867
                +          DLK L +VF      K+
Sbjct: 749  NNKNNI---------DLKNLYDVFFLSAFNKI 771

>TPHA0A04870 Chr1 complement(1102393..1103298) [906 bp, 301 aa] {ON}
           Anc_5.131 YJR021C
          Length = 301

 Score = 38.5 bits (88), Expect = 0.050
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 8/99 (8%)
 Frame = +1

Query: 73  SQDVEFHKSIDTSVANSLEKSMKSMASVMNN----ILLSIDNNNEKLDGTNENLEEVCKE 240
           S D E H +ID+ V NS+EK  KS+   + +    I  S++  N  +   N  LE V K 
Sbjct: 138 SDDFELHNNIDSIVKNSIEKYSKSIVKPVRDNQTKITESLNFMNGMIFNFNNQLESVNKI 197

Query: 241 FSNVMDVLFEKADRSLDILN----RKSSTNDNKKNMQFL 345
             N+   L    DR + + N    +K + +D   ++Q L
Sbjct: 198 LGNMSSNLKSINDRQVHLENMFSQQKIANDDTNASIQQL 236

>KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some
           similarities with uniprot|Q06704 Saccharomyces
           cerevisiae YLR309C IMH1 Protein involved in vesicular
           transport mediates transport between an endosomal
           compartment and the Golgi contains a Golgi-localization
           (GRIP) domain that interacts with activated Arl1p-GTP to
           localize Imh1p to the Golgi
          Length = 768

 Score = 37.7 bits (86), Expect = 0.13
 Identities = 31/98 (31%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +1

Query: 28  LKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMN-NILLSIDNN--NEK 198
           LK   E ++ SN ++ +D     SI  S+  +L KS K    +MN N+ L   NN  N+K
Sbjct: 608 LKSTFERMKRSNNVSQEDTSELDSIVKSLKEALVKSEKKQREIMNTNVELKELNNDLNKK 667

Query: 199 LDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSS 312
            D  ++N + +  + S   D L  K+ RS    +R  S
Sbjct: 668 FDRLSKNYKNLSLQISKTKD-LEPKSARSSPHPSRSGS 704

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
           YDR356W
          Length = 989

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 51/223 (22%), Positives = 85/223 (38%), Gaps = 25/223 (11%)
 Frame = +1

Query: 16  GDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNE 195
           G N++ ++ E    SN L  Q  +    I  +   +L+  + S+   +N ++     N  
Sbjct: 102 GRNLVNELKENASTSNPLKEQQEQIQSLIKENY--NLKAKVTSLLKYLNTVM-----NKG 154

Query: 196 KLDGTNENLEEVCKEFSNVMDVLFEKADRSL--------------DILNRKS-------- 309
           +L  T   L+E+     N + VL  K DR +              +IL RKS        
Sbjct: 155 ELQKTLPLLDEI-----NELKVLSGKKDRKIQEIKIKCDDLVTQNNILIRKSRELEALVA 209

Query: 310 STNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSES---HPFKPLLIEKPNALK 480
           S N++  N + +D +N         +     N K  V N  +        L I      K
Sbjct: 210 SKNESATNSKEIDIINGKNQKIIEELETKLSNAKEDVANELNMTISELNDLKIRYNKFEK 269

Query: 481 SIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPI 609
           +I E  +L+ A +D+    +   E      E   D+L KKE +
Sbjct: 270 TIMEKDKLINAKDDLISSLEGNLEEITTEVENLQDLLRKKEEV 312

 Score = 33.1 bits (74), Expect = 3.5
 Identities = 54/251 (21%), Positives = 106/251 (42%), Gaps = 34/251 (13%)
 Frame = +1

Query: 31  KKVMETVRASNALASQDVEFHKSIDTSVANSL-------EKSMKSMASVMN---NILLSI 180
           +K++E +    + A +DV    ++  S  N L       EK++     ++N   +++ S+
Sbjct: 229 QKIIEELETKLSNAKEDVANELNMTISELNDLKIRYNKFEKTIMEKDKLINAKDDLISSL 288

Query: 181 DNNNEKLDGTNENL-------EEVCKEFSNVMDVLFEKADRS---------LDILNRKSS 312
           + N E++    ENL       EEV KE+ +  + + EK              D LN K S
Sbjct: 289 EGNLEEITTEVENLQDLLRKKEEVIKEYKDKCNTMLEKNHDDDNNEQFMLVQDELNMKLS 348

Query: 313 TNDN-KKNMQFLDDVNV----AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNAL 477
             +N +  +  L D+N     + ND    ++     ++    ++E+H    + I K +  
Sbjct: 349 EIENLELELNDLKDLNTKLKESLNDKENELTNVSSEYEKYKLDAEAH----MGIMKDSDD 404

Query: 478 KSIEESTQLVLATEDIPEHFQQPYEY-EILNQEYNN--DILEKKEPIPSTSWVDTNAIWV 648
           K   +  ++     ++     Q  E  E LN E  +  DI+EK E        +  ++  
Sbjct: 405 KLKNQVIEIRKKNIELNSKLLQMNEVNENLNDELMSLKDIIEKLEQDKKAKLQELKSLKS 464

Query: 649 DNINSLQDMMQ 681
            +I+ ++D+ Q
Sbjct: 465 SDISQIEDLKQ 475

>NDAI0A05900 Chr1 (1338449..1342144) [3696 bp, 1231 aa] {ON}
           Anc_3.240 YDR017C
          Length = 1231

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 51/222 (22%), Positives = 87/222 (39%), Gaps = 11/222 (4%)
 Frame = +1

Query: 94  KSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEK 273
           K+I     N     +   A     I++  +N N K+D T +               + ++
Sbjct: 192 KNIRDHKVNDRSNKINEKARNAVKIIIKEENGNRKIDDTQDGR-------------ILQE 238

Query: 274 ADRSLDILNR-----KSSTNDNKKNMQ---FLDDVNVAENDPSRRISKPQLNFKTPVDNS 429
            DR     +R     K  T+DN KN      L+ V+ A   P +  SK     K  VD  
Sbjct: 239 QDRKSSTPSRLSGHLKIKTSDNSKNPSDDLALEPVSSATYYPHKSKSKS----KKKVDKI 294

Query: 430 ESHPFKPLLIEKPNALK---SIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKK 600
           E    KP  I++ ++L    S +E   L  +   +P++ Q+    +IL     N I+E  
Sbjct: 295 EDKDEKPSNIKESSSLSVLLSNQEQENLDFSISKVPKN-QEENSKQILPSSQLNSIVESH 353

Query: 601 EPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHH 726
           +         TN      I +  D++ E + ++EI  +  H+
Sbjct: 354 QLHDYNDRTFTN-----EIRNKNDIINEKENNNEIRDEEAHN 390

>KAFR0D03320 Chr4 (653123..654805) [1683 bp, 560 aa] {ON} Anc_2.506
            YKL005C
          Length = 560

 Score = 37.4 bits (85), Expect = 0.16
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 12/131 (9%)
 Frame = +1

Query: 1783 EESELKDRYLSYIKATL--LAASKNINMVLETSNSNAPLET---EETHNKKSDQIQVIPE 1947
            EES+L + Y   +++    L   KN+N+     N + P E           +  +Q   E
Sbjct: 248  EESKLSNYYAEKVRSIFSNLKDPKNLNLQAHVVNKDIPFEKLVRMSATELANPDLQQFKE 307

Query: 1948 K--QEDMDEIVVLKKKK-----IHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKK 2106
            K   E + ++++ K  K      H  D+  +  DG+  +E V YS+ N L S N E   +
Sbjct: 308  KVNTESLSQLIIEKPDKPKYVKTHKGDELIEEFDGNENQEDVIYSRDN-LQSHNTEELSQ 366

Query: 2107 DKKRVFDPYSS 2139
            +K+   D  +S
Sbjct: 367  EKQMSTDSSAS 377

>Skud_1.13 Chr1 complement(30899..32809) [1911 bp, 636 aa] {ON}
           YAL047C (REAL)
          Length = 636

 Score = 37.4 bits (85), Expect = 0.16
 Identities = 40/168 (23%), Positives = 72/168 (42%)
 Frame = +1

Query: 301 RKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALK 480
           R+  +NDN  +    DD +   N     +S P         +S + P KP+++  PN +K
Sbjct: 24  RRLHSNDNNDDD---DDDSEFTNSMDSGMSIPSFRDSVTTRSSHNDPLKPVMVNDPNRVK 80

Query: 481 SIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNIN 660
           S+E+     L +  I       Y  ++ N++ N+       P  +T     N++    I 
Sbjct: 81  SLEKE----LTSAKIKIQVLYEYIRKVSNKDSNS-------PSMTTDTEFKNSL----IE 125

Query: 661 SLQDMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQISTRTQDYIVDTI 804
            L   + ELK++ E A ++E+ D   +      +Q +    + IV TI
Sbjct: 126 DLNAQINELKQALE-AREVEYQDTLQF------VQENLENSESIVSTI 166

>KAFR0G03310 Chr7 (682336..684366) [2031 bp, 676 aa] {ON} Anc_4.268
           YDL074C
          Length = 676

 Score = 37.4 bits (85), Expect = 0.17
 Identities = 40/221 (18%), Positives = 103/221 (46%), Gaps = 27/221 (12%)
 Frame = +1

Query: 139 KSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTN 318
           +++  ++N+   +++  NE+ + TN+   E+  +FSN++ ++   A +SL+I+       
Sbjct: 32  EALFRLLNDKRNNLNVINEQYEITNKKFLEISSKFSNLLSLVLTLA-KSLEIV-----VK 85

Query: 319 DNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVD------NSESHPF-------KPLLI 459
           DN  +M+ +D+V  ++ D    ++   L+  T         N+E++ F       K L  
Sbjct: 86  DNDDDMKIIDEVLNSDEDKVVELTDKLLSIFTKYSSNSGNVNAENNSFNNFSSNLKSLQK 145

Query: 460 EKPNALKSIEESTQLVLATEDIPEHFQQPYEYE---ILNQEYNNDI-----------LEK 597
           +K + LK  E+    + + +   ++  + Y+ E    + + +  D+            + 
Sbjct: 146 DKLHLLKQNEKLIDELNSIKSYYQNLVKKYDREDSQTIKRVFKKDLETEQDAKEETTSDT 205

Query: 598 KEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
           +EP+ +   +DT    V+  N + ++ ++  ++ ++ +  E
Sbjct: 206 QEPVKTEEQIDT----VEKSNGVNEVEEDSSQNDDVIMGYE 242

>TBLA0J00170 Chr10 complement(20249..22786) [2538 bp, 845 aa] {ON}
            Anc_7.527 YPR171W
          Length = 845

 Score = 37.4 bits (85), Expect = 0.17
 Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 6/66 (9%)
 Frame = +1

Query: 1846 KNINMVLETSNSNAPLETEETHNKKS--DQIQVIPEKQEDMDEIV----VLKKKKIHSND 2007
            K++N ++E+ +S    E EET NK+S      ++PE++  M E +    +LK+KK  +N+
Sbjct: 671  KSVNSLVESKDSYTSKELEETINKRSALKSPPIVPERKISMPEALKKAQLLKEKKKIANE 730

Query: 2008 QKAKHD 2025
             +A+ D
Sbjct: 731  SQARDD 736

>NDAI0K01010 Chr11 complement(230318..235336) [5019 bp, 1672 aa]
           {ON} Anc_8.736 YMR219W
          Length = 1672

 Score = 37.4 bits (85), Expect = 0.19
 Identities = 21/95 (22%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = +1

Query: 70  ASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENL--EEVCKEF 243
           + +D   +K +D ++ N         AS+ N ++    +N+  ++   + L  E+V  E+
Sbjct: 316 SEEDSSRYKMVDETIDNEGRLQNYEPASITNKLMTQTQSNHRSVNEVPQGLSEEDVTSEY 375

Query: 244 SNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLD 348
           S+  +   E  + SLD  + ++  +D   N+Q +D
Sbjct: 376 SDEYNEYSENEEESLDASDLRTRFHDENGNLQEVD 410

>NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8.331
           YDR150W
          Length = 2447

 Score = 37.4 bits (85), Expect = 0.19
 Identities = 23/98 (23%), Positives = 48/98 (48%), Gaps = 1/98 (1%)
 Frame = +1

Query: 112 VANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLD 291
           ++ +L K  + + ++      ++++  ++ +  NE L +  KE+ N  D  +E  ++ +D
Sbjct: 75  LSENLLKECRKLQAINQEKSKALEDKTKENEKINEKLNKALKEYRNSKDTNWELENKLMD 134

Query: 292 ILNR-KSSTNDNKKNMQFLDDVNVAENDPSRRISKPQL 402
           I N+ K   ND K     L+ +N + ND    + K  L
Sbjct: 135 ISNQFKQVKNDLKIKDLELEKINKSLNDKMAEVEKINL 172

>TBLA0A01860 Chr1 (452220..454826) [2607 bp, 868 aa] {ON} Anc_6.175
           YPL180W
          Length = 868

 Score = 37.0 bits (84), Expect = 0.23
 Identities = 30/115 (26%), Positives = 56/115 (48%)
 Frame = +1

Query: 70  ASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSN 249
           +S D ++  S+  S +  +E+  ++  S+ N    S++ N   LD T   ++E+  + +N
Sbjct: 475 SSNDEKYIPSMILSQSTGVERRFENPPSITN----SLNKNFNNLDDTRSIVKEISNKDNN 530

Query: 250 VMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKT 414
            +D                S+TN N +N     ++ ++EN+  + ISK Q NFKT
Sbjct: 531 KLDT--------------DSNTNRNMQNQ----NITISENNKFKTISK-QDNFKT 566

>TBLA0I02110 Chr9 (479430..482180) [2751 bp, 916 aa] {ON} Anc_3.306
            YDR057W
          Length = 916

 Score = 37.0 bits (84), Expect = 0.23
 Identities = 42/207 (20%), Positives = 91/207 (43%), Gaps = 7/207 (3%)
 Frame = +1

Query: 22   NVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKL 201
            N+ K++ E       LAS + E ++  D S  +S E  +   +          DN N K 
Sbjct: 702  NINKQISE-------LASNNEEEYQHNDQSFESSTETYLNGPS----------DNTNIKP 744

Query: 202  DGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSR 381
            + TN++LE   + +    ++  ++ + +++ +   S  +D         +++   N    
Sbjct: 745  ENTNDSLEAENERYEQSNEMYTDEINENIENIVEDSRKDDENTYDGITPEISSLGN---- 800

Query: 382  RISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEI 561
                 Q+N +   D+ +SH  +    ++  + K+ +E T    A ++ P+ + +  E E 
Sbjct: 801  -----QVNDEQHDDSKQSHAHQ----QEEQSDKNKQE-THSQYAEQEEPDAYMEYVEQEK 850

Query: 562  LN-------QEYNNDILEKKEPIPSTS 621
            +N       Q+Y N  ++++E I ST+
Sbjct: 851  INFQDQVDMQQYRNSEIQQEEHIASTT 877

>NCAS0E02480 Chr5 (490695..493682) [2988 bp, 995 aa] {ON} Anc_7.413
            YBL085W
          Length = 995

 Score = 37.0 bits (84), Expect = 0.23
 Identities = 42/223 (18%), Positives = 87/223 (39%), Gaps = 9/223 (4%)
 Frame = +1

Query: 1561 NNRLPSSLDVSQDELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHP 1740
            N  + +  + ++    F P H+  +  G+F ++ N+++  + SK      +   E    P
Sbjct: 473  NKAITTGANGNRRNSSFYPQHQKNISAGSFVDLFNRVSMLSPSKAKTDPEISHFEQPRRP 532

Query: 1741 EHAVKYHNGSACSVEESELKDRYL--------SYIKATLLAASKNINMVLETSNSNAPLE 1896
            + A+  +  S      S +   Y+        S  +++ +   KN N++    N N P  
Sbjct: 533  KSAMFINRSSPKHTRSSSVATGYVFPNSPRKASNARSSSIVTDKNTNVI----NLNEP-H 587

Query: 1897 TEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANIL 2076
                H+++S Q Q+   +    +   V + +K  S     +  DG   +     S + + 
Sbjct: 588  HHSHHSRRSSQ-QIAHARSSSSNVATVTRHRKTPSLQNSPRETDGATPKAQHKRSSSFLA 646

Query: 2077 ASDNREVKKKDKKRVFDPYS-STGEGPKAAKKRRLVTKGKKIS 2202
               + +  +    +  +P S S    P  ++K  LVT   K S
Sbjct: 647  FFSSSKPSQDSTTQKPEPESKSKSRTPLHSRKSSLVTSPTKHS 689

>Kpol_1048.24 s1048 complement(75760..78900) [3141 bp, 1046 aa] {ON}
           complement(75760..78900) [3141 nt, 1047 aa]
          Length = 1046

 Score = 37.0 bits (84), Expect = 0.24
 Identities = 40/163 (24%), Positives = 67/163 (41%), Gaps = 2/163 (1%)
 Frame = +1

Query: 34  KVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTN 213
           K M++  AS+       +  + +  S    L K++      M+   +S    N   D  +
Sbjct: 146 KKMDSPTASSISGHLQDDEIELMPKSPLRKLSKNISDDNGSMDFSPISKQKLNNFADLVD 205

Query: 214 ENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKK-NMQFLDDVNVAENDPSRRIS 390
              +E     +N +DV  +  D   +  N   + NDN   N    D+ N  +ND     S
Sbjct: 206 STFDESINNSTNKIDVSIKNKDDENNNDNDNENDNDNDNGNDNDNDNDNDNDNDVESNYS 265

Query: 391 KPQLNFKTPVDNSESHPFKPLLIEKPN-ALKSIEESTQLVLAT 516
              ++  TPV  S      PLLI K +  L ++++S Q V A+
Sbjct: 266 DRNIDLSTPVSESLG---SPLLINKSSEKLFAVQDSNQSVTAS 305

>TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa] {ON}
            Anc_4.46 YLR309C
          Length = 1065

 Score = 37.0 bits (84), Expect = 0.24
 Identities = 31/138 (22%), Positives = 65/138 (47%), Gaps = 3/138 (2%)
 Frame = +1

Query: 28   LKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDG 207
            LK V E++R  + +  +D +  +  ++S+  +L K+   +  +  NI   +  NN+    
Sbjct: 890  LKSVNESIRKKSTVNGEDTDELEKSNSSLKEALSKADTKVRDLQENIENLMKANND---- 945

Query: 208  TNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRI 387
            TN+ LE + K +  V + L    D+     +R S +N        L D +  ++D +  I
Sbjct: 946  TNKKLERITKSYRTVSNQLSTLRDQRGFASSRSSRSNSVTST---LHDSSKGDSDGNGFI 1002

Query: 388  ---SKPQLNFKTPVDNSE 432
               S+P ++ ++  + +E
Sbjct: 1003 MGQSRPSMSTESQAEMNE 1020

>Kpol_1028.62 s1028 (140309..141172) [864 bp, 287 aa] {ON}
            (140309..141172) [864 nt, 288 aa]
          Length = 287

 Score = 36.2 bits (82), Expect = 0.26
 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 4/76 (5%)
 Frame = +1

Query: 1981 KKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVK----KKDKKRVFDPYSSTGE 2148
            KK K +SND+K   DD D  E+    +K+     D ++ K    KKDKK   D    T +
Sbjct: 141  KKLKSYSNDKKRSRDDDD--EKLSSKNKSKKQKKDKKDKKDKKDKKDKKDKKDKKDKTEK 198

Query: 2149 GPKAAKKRRLVTKGKK 2196
              K  KK +   K KK
Sbjct: 199  KEKKEKKEKKEKKEKK 214

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 36.6 bits (83), Expect = 0.28
 Identities = 54/246 (21%), Positives = 109/246 (44%), Gaps = 22/246 (8%)
 Frame = +1

Query: 49  VRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGT-NENLE 225
           V A   + S+D   H  +   + N +   +  + S ++  L  I+  NE++    N+  +
Sbjct: 92  VLAQTEMISKD---HNKLSIDLDNEVANQLSGLYSKLDMTLTQINGFNEEVTNKRNQIYQ 148

Query: 226 EVCKEFSNVMDVLFEKADRSLDILN---RKSSTNDNKKNMQFLD-DVNVAENDPSRRIS- 390
           ++ +   N     ++ A +S+++      K+ST+ NKK +   + D+NVA+ND   ++S 
Sbjct: 149 DMERAKKN-----YDDACQSMEVARGKYTKTSTDKNKKKLDSKETDMNVAKNDYLIKVSL 203

Query: 391 ----KPQLNFK---TPVDN-SESHPFKPLLIEKP-NALKSIEE--STQLVLATEDIPEHF 537
               K +  F+     VD   + +  K L +    N   S+E+  + +     E + E  
Sbjct: 204 ANRVKDKYYFQDVPEVVDQLQDLNEAKTLFLNDVWNKATSVEKAFNDRCTKRLETVDEVV 263

Query: 538 QQPYEYEILNQEYNNDILEKKEPI-----PSTSWVDTNAIWVDNINSLQDMMQELKKSSE 702
           +Q   +        +++ + KEP      PS  W D     V++   LQD+  +L K+ +
Sbjct: 264 KQNKPHLSTAMFIKHNLKQWKEPSDFQYKPSPVWHDDEKFIVNSPVELQDLKVKLAKNEQ 323

Query: 703 IAVDLE 720
             + L+
Sbjct: 324 AYLKLD 329

>Kwal_33.14683 s33 (770893..771954) [1062 bp, 353 aa] {ON} YNL136W -
            Hypothetical ORF [contig 388] FULL
          Length = 353

 Score = 36.2 bits (82), Expect = 0.30
 Identities = 27/105 (25%), Positives = 46/105 (43%)
 Frame = +1

Query: 1834 LAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQK 2013
            LAA +++N   ET  S +P + +E H +  ++ +  PE++E+ DE           N ++
Sbjct: 207  LAAPQHVNA--ETRESKSPQQEQEEHAQAQEEQKAEPEEKEEGDESA--------GNSEE 256

Query: 2014 AKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGE 2148
                +   V E  +   AN       EV++   KR     SS  E
Sbjct: 257  VDESENRAVNEEEEQEGANKNKITEEEVEQPPSKRTRTTRSSAQE 301

>NCAS0C02460 Chr3 complement(457257..459920) [2664 bp, 887 aa] {ON}
           Anc_8.484 YDR251W
          Length = 887

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 38/146 (26%), Positives = 65/146 (44%), Gaps = 11/146 (7%)
 Frame = +1

Query: 139 KSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNV---MDVLFEKADRSLDILNRKS 309
           K   S  ++ L+S++N N +L  T    EE+ K   N         E +   L  LN + 
Sbjct: 361 KQDTSKSDSKLISLENENSRLMDTLHEKEEIVKSLQNKEYNYKGTIENSQNQLTNLNEQL 420

Query: 310 STND--NKKNMQFLD------DVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEK 465
           STND  +++ ++ L+       +NV+ N PSR++        + V   +   +K  +   
Sbjct: 421 STNDRQHQEEVRRLEAKLQNTSLNVSNNSPSRQMQ----TASSAVQQLKQDEYK--VTGT 474

Query: 466 PNALKSIEESTQLVLATEDIPEHFQQ 543
           PN LK +E+     +   + P H QQ
Sbjct: 475 PN-LKDLEDFAVHNVNYGESPSHQQQ 499

>Suva_16.309 Chr16
            complement(539454..540172,540248..540493,540908..543068)
            [3126 bp, 1042 aa] {ON} YPL009C (REAL)
          Length = 1042

 Score = 36.6 bits (83), Expect = 0.31
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 2/99 (2%)
 Frame = +1

Query: 1894 ETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANI 2073
            E EE  N   + I+ +  + E  D+I   K  K+ ++D   ++DD   V + +  + A++
Sbjct: 774  EEEEEENSDGEIIESLENEDEKGDDITSDKSSKLKNSDTSNRNDDVQSVSDELSVT-ASV 832

Query: 2074 LASDNREV--KKKDKKRVFDPYSSTGEGPKAAKKRRLVT 2184
            + S NR+V  KK   K++   Y+   E  +  +   L T
Sbjct: 833  VDSMNRKVRGKKGKLKKIQRKYADQDEHERLLRLEALGT 871

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 36.6 bits (83), Expect = 0.33
 Identities = 60/248 (24%), Positives = 107/248 (43%), Gaps = 28/248 (11%)
 Frame = +1

Query: 76   QDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDN----------NNEKLDGTNENLE 225
            +D+E  + I     NSL+  ++  A  MN +    DN           N+KL   N+  E
Sbjct: 1364 KDLEDTQHIFKDSENSLKSELEKTALEMNELRSDNDNIIKLKNELQRTNDKLIEENKRTE 1423

Query: 226  EVCK-EFSNVMDVLFEKAD---RSLDILNRKSST---NDNKKNMQFLDDVNVAENDPSRR 384
            E  + E + + D L  K+D   +   ++N  SST     ++K     + V   +++  + 
Sbjct: 1424 EKLRSEVAKLKDELKTKSDTFEKERKLMNEDSSTIIKEYSEKISSLEEKVETIKSEYDKE 1483

Query: 385  ISKPQLNFKTPVDNSESHPFKPLLIE-----KPNALKSIEESTQLVLATEDIPEHFQQPY 549
            I+   L  K  V  SE    K  +I+     K    K+ E+  ++ +A   +    ++  
Sbjct: 1484 IN--ILEDKKEVLESELSDKKQEIIDYNQKIKEQETKATEKEKEIQVAKNALKNAEKKKK 1541

Query: 550  EYE------ILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAV 711
            + E      I   E  N  L+++  + S S +D +    +NI+ LQ   +EL K  E+A 
Sbjct: 1542 DIENDLRTTIATVEKENTTLKRENQLKSES-IDKHQ---NNIHLLQ---EELSKQKELA- 1593

Query: 712  DLEHHDFR 735
            D +H + R
Sbjct: 1594 DKKHDEIR 1601

>TBLA0A07430 Chr1 complement(1839818..1840723) [906 bp, 301 aa] {ON}
           
          Length = 301

 Score = 35.8 bits (81), Expect = 0.36
 Identities = 23/107 (21%), Positives = 54/107 (50%), Gaps = 3/107 (2%)
 Frame = +1

Query: 4   SSDSGDNVLKKVMETVRASNALA--SQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLS 177
           +S   D  L  + E  + SN +A  S+++E ++++   +  S  K ++   +++N +   
Sbjct: 110 NSKLNDAYLNAIQELSKNSNEIANISEEIEKNEAVINEIYLSDMKMIEECENMINQLSEI 169

Query: 178 IDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKAD-RSLDILNRKSST 315
           +++N +++DG     + + +EF  + D +    D  + D  + K ST
Sbjct: 170 VNDNTKQMDGDKNQEDTIIEEFFQLQDEINVNEDVLNFDTTDTKVST 216

>TDEL0E00510 Chr5 complement(114384..117194) [2811 bp, 936 aa] {ON}
           Anc_2.16 YNL225C
          Length = 936

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 49/214 (22%), Positives = 93/214 (43%), Gaps = 14/214 (6%)
 Frame = +1

Query: 118 NSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDIL 297
           N+LEK++K ++  +++   ++    EK   TN+ LE  C     + D+  +      D+ 
Sbjct: 340 NALEKTIKDLSKELDDQFQAL----EKAKRTNDELESQCNVTKKLQDMEEQNQQLKRDLQ 395

Query: 298 NRKSSTND-NKKNMQFLDDVNVAENDPSRRISKP---QLNFKTPVDNSESHPFK------ 447
           + KSS N+   +N   +  + VA ND  R + K      + +T + N      K      
Sbjct: 396 SSKSSRNELQTENTGIMTKLQVA-NDHIRELEKSLELAKSSQTTLRNDYELTMKQVEEAS 454

Query: 448 PLLIEKPNALKSIEESTQLV-LATEDIPEHFQQPYEYEILNQEYNNDILE---KKEPIPS 615
            L  ++ + L +++ES +   +   D+ E      E    N E   D+L+   +KE    
Sbjct: 455 KLNEQRKSELGALKESNERTRVENNDLKEKLN---EASKTNDELKKDVLKVQMEKEKAAH 511

Query: 616 TSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDL 717
            S     AI  + ++  +   + L+KS E + +L
Sbjct: 512 NSEKLQTAIQQEQLDH-EKTTKNLRKSEEYSSNL 544

>KAFR0D03740 Chr4 complement(722559..724853) [2295 bp, 764 aa] {ON}
            Anc_1.115 YNL247W
          Length = 764

 Score = 35.8 bits (81), Expect = 0.51
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 7/112 (6%)
 Frame = +1

Query: 1798 KDRYLSYIKATLLAASK---NINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQ--EDM 1962
            K+ Y  ++KAT         N+N+ L+  N  A L    T  +K++ I +  EK+  E+ 
Sbjct: 624  KENYSEFLKATDYIRDHDLLNLNVSLDDRNGQAALIKFLTDEEKNEIISINQEKEAREEA 683

Query: 1963 DEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILAS--DNREVKKKDK 2112
             ++  L+++K+  N+QK +         P++  K   L S  DN  +  KDK
Sbjct: 684  KKLKKLQQQKL--NEQKERERKEKAKVSPLEMFKNGDLYSEWDNEGIPTKDK 733

>YOL007C Chr15 complement(311342..312367) [1026 bp, 341 aa] {ON}
           CSI2Protein of unknown function; green fluorescent
           protein (GFP)- fusion protein localizes to the mother
           side of the bud neck and the vacuole; YOL007C is not an
           essential gene
          Length = 341

 Score = 35.4 bits (80), Expect = 0.51
 Identities = 20/76 (26%), Positives = 37/76 (48%)
 Frame = +1

Query: 223 EEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQL 402
           E+V K  S+ M +    +   L++LN K+  NDN ++  F+    + ++D +   +  Q 
Sbjct: 206 EKVLKNNSSRMSLYTLGSTSVLNLLNNKTDANDNFRSSMFISPTEILQSDANNSNTWSQS 265

Query: 403 NFKTPVDNSESHPFKP 450
           N     D+  S P +P
Sbjct: 266 NESAIYDSLSSTPREP 281

>TPHA0J01440 Chr10 (334822..337212) [2391 bp, 796 aa] {ON} Anc_5.677
           YOR073W
          Length = 796

 Score = 35.8 bits (81), Expect = 0.51
 Identities = 38/187 (20%), Positives = 75/187 (40%), Gaps = 9/187 (4%)
 Frame = +1

Query: 106 TSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRS 285
           T++ ++ + S+  +     +  L I    +K    N+N  +   + SN+   +  +   +
Sbjct: 218 TNIESNQDDSLTKINKYKRDNELFITEEEKKNKKNNDNNNDNSNDDSNINKFINNENTAT 277

Query: 286 LDILNRKSSTNDN---KKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLL 456
           L    RKSS  ++       +FLD  +   N  +  I +  +     ++   +   K  +
Sbjct: 278 LPKKRRKSSRRESFVFTDEQEFLDAADHNNNLENNNIIEDSIKEIRQIEFENNKSLKGCV 337

Query: 457 IEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQ------EYNNDILEKKEPIPST 618
           IEK N    +  +T     T D+     +  E EI N        + N I+E   P  +T
Sbjct: 338 IEKINEEPELTNTT----ITHDLISSESESIEQEIDNNPPENSFTFTNSIIEYSIPEEAT 393

Query: 619 SWVDTNA 639
           S  ++N+
Sbjct: 394 SGQESNS 400

>CAGL0G09174g Chr7 (875195..877957) [2763 bp, 920 aa] {ON} similar to
            uniprot|Q08951 Saccharomyces cerevisiae YPL195w YKS4
          Length = 920

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 39/180 (21%), Positives = 76/180 (42%), Gaps = 13/180 (7%)
 Frame = +1

Query: 1597 DELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSAC 1776
            D+L     H I +  G   E E+++ +A K K+ +T  ++  E++  P++A+        
Sbjct: 750  DDLDTSSGH-IPIAVGITMESESKMKKAKKKKKKVT--ILSDEVVGQPQNAIPIKVKRPM 806

Query: 1777 SVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQE 1956
            ++E S+ K       K  L    K       T  S+  L   E  + +  Q ++   +++
Sbjct: 807  NIETSKSKINLKKQTKLDLFDFDKG------TEESHMELNPNEYGDDEVGQEELEKLREK 860

Query: 1957 -------------DMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREV 2097
                         + DE+V +KKKK      + K D+ D  ++  + S   I++ D+  V
Sbjct: 861  FGSHSIENSAAIGNDDEVVTIKKKKKKKKKTRQKDDNLDKKKDKKE-SSTQIISEDSENV 919

>Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250W
           (REAL)
          Length = 1316

 Score = 35.8 bits (81), Expect = 0.55
 Identities = 21/76 (27%), Positives = 40/76 (52%)
 Frame = +1

Query: 79  DVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMD 258
           D  F KS+  +V N  EK       +++  ++S+ + NEK++ + E+LE+  +E  +   
Sbjct: 716 DANFEKSLKDTVQN--EKEYLDSLRLLDKHIISLSSINEKINNSREHLEKANEETKSSKL 773

Query: 259 VLFEKADRSLDILNRK 306
            L+E   +S  + N K
Sbjct: 774 KLYELETKSTTLRNDK 789

>SAKL0E01782g Chr5 (136231..137469) [1239 bp, 412 aa] {ON} similar to
            uniprot|P50105 Saccharomyces cerevisiae YMR005W TAF4
            TFIID subunit (48 kDa) involved in RNA polymerase II
            transcription initiation potential Cdc28p substrate
          Length = 412

 Score = 35.4 bits (80), Expect = 0.56
 Identities = 26/79 (32%), Positives = 40/79 (50%)
 Frame = +1

Query: 1690 KQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLE 1869
            K  +T+S+V+S    H   AVK + G    V  + L+D  L   +       K I+M LE
Sbjct: 252  KDIVTNSLVISR---HRRRAVKLNAGRRSEVSRA-LRDLALQQKQQEERRVKKRISMGLE 307

Query: 1870 TSNSNAPLETEETHNKKSD 1926
               + A L+TEET ++ S+
Sbjct: 308  KETAEAKLDTEETLHRASN 326

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 35.8 bits (81), Expect = 0.56
 Identities = 44/238 (18%), Positives = 96/238 (40%), Gaps = 12/238 (5%)
 Frame = +1

Query: 43   ETVRASNALASQDVEFHKSIDTS-VANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNEN 219
            +TV A+NA  + + E  +  D S   + L +  + + +   ++   + +  +++    ++
Sbjct: 1049 QTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKH 1108

Query: 220  LEEVCKEFSNVMDVLFEKAD----------RSLDILNRKSSTNDNKKNMQFLDDVNVAEN 369
            L+    E+   +D+  ++ D            +D+LNR  S N+N  +    D+ N +  
Sbjct: 1109 LKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSD----DEANGSTA 1164

Query: 370  -DPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQP 546
               S R  +  L+ K  V  +E +  +  L +  N L++ + S  L+    +  EH    
Sbjct: 1165 LVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALL--ESEYSEHSDLI 1222

Query: 547  YEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
              Y+ +  +                    N +   N+    ++ Q L +  +IA DL+
Sbjct: 1223 NNYQTIRGDLE----------------QLNLLRESNVTLRNELKQALDEKDKIAKDLQ 1264

>TBLA0B04530 Chr2 (1042985..1050010) [7026 bp, 2341 aa] {ON} Anc_8.562
            YPL085W
          Length = 2341

 Score = 35.8 bits (81), Expect = 0.57
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 3/92 (3%)
 Frame = +1

Query: 109  SVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSL 288
            S A S   +  +M +  NN+ LSI   N++    + NL E      NV  +  E+   +L
Sbjct: 1710 STATSSTTTTTTMTNNNNNVTLSIPEQNKEYTVEDSNLSEAV----NVAKIASEEEHPAL 1765

Query: 289  DILNRKSSTNDNKKNM---QFLDDVNVAENDP 375
            +   R S+T+ N++ +     LDD N   +DP
Sbjct: 1766 NNEKRYSTTSLNEEKLLKELTLDDYNTRTSDP 1797

>TBLA0A05960 Chr1 (1469108..1470688) [1581 bp, 526 aa] {ON} 
          Length = 526

 Score = 35.4 bits (80), Expect = 0.61
 Identities = 44/203 (21%), Positives = 87/203 (42%), Gaps = 18/203 (8%)
 Frame = +1

Query: 55  ASNALAS--QDVEFHKSIDTSVA-NSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLE 225
           +SN++ S  ++  +  SI    + N ++KS+ S   +  NI+ + ++N+  L   +  + 
Sbjct: 319 SSNSIISSNKNQSYRNSISPVTSPNKIKKSLNSNVKI-TNIITNSNSNSNILPNKSNYIS 377

Query: 226 EVCKEFSNVMDVLFEKADR-----SLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRIS 390
           +   +F+NV  +  +K +      + +I N  +ST  N  N    +++N+  N+ +    
Sbjct: 378 KNTSKFTNVFQIDMDKNNNIHKNLTNNIANSVTSTTTNNNNNNNNNNININNNNNNNN-- 435

Query: 391 KPQLNFKTPVDNSE------SHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHF-QQPY 549
               NF + + NS       ++      I+  N   SI  S      +   P  F   PY
Sbjct: 436 ----NFYSKIINSNTSYKNFNYKNSSTFIKHVNPSSSISNSN-----SNSTPSPFISPPY 486

Query: 550 EYEILNQE---YNNDILEKKEPI 609
             +  +Q     NN    KK+P+
Sbjct: 487 RTDQQDQPTAIQNNTNNNKKKPV 509

>KLLA0E08471g Chr5 (761242..762957) [1716 bp, 571 aa] {ON} similar to
            uniprot|P46678 Saccharomyces cerevisiae YNL039W BDP1
            Essential subunit of RNA polymerase III transcription
            factor (TFIIIB) which is involved in transcription of
            genes encoding tRNAs 5S rRNA U6 snRNA and other small
            RNAs
          Length = 571

 Score = 35.4 bits (80), Expect = 0.62
 Identities = 31/106 (29%), Positives = 48/106 (45%)
 Frame = +1

Query: 1789 SELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDE 1968
            S+L   +  Y K T     KNI  V E +     L+ E  H +   QI+V  E+Q   ++
Sbjct: 465  SKLPPNFEQYCKET----RKNIGTVTEFNKRLDQLQVE--HEEHLKQIEV--ERQNAREQ 516

Query: 1969 IVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKK 2106
             +  +  K H   QK KH  G   ++   Y K+ I+     ++KKK
Sbjct: 517  DIKQQTVKEHERSQKGKH--GGRYDQLKGYRKSEIVLGSIDDLKKK 560

>Suva_2.586 Chr2 (1040961..1043645) [2685 bp, 894 aa] {ON} YDR409W
           (REAL)
          Length = 894

 Score = 35.4 bits (80), Expect = 0.68
 Identities = 36/154 (23%), Positives = 63/154 (40%), Gaps = 2/154 (1%)
 Frame = +1

Query: 100 IDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKAD 279
           I+T V N+   + K  +++ NN   + +NNN   +  N N        +NV +      D
Sbjct: 494 INTHVNNTNNDNNKDCSNINNN---NNNNNNNDNNNNNNNNNNNNNNINNVDN------D 544

Query: 280 RSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPL-- 453
              +  N  ++ N+N  N +  DD  +  +  S  +     N  TP D S +   K L  
Sbjct: 545 NDNNSNNNNNNNNNNNNNNEDDDDDQLIADIASNHVESGNTN--TPADKSTAAMSKTLDP 602

Query: 454 LIEKPNALKSIEESTQLVLATEDIPEHFQQPYEY 555
            +  PN L++   +T        +PE+ +    Y
Sbjct: 603 KMYNPNVLETTTPTTD-----RCVPEYAESSSNY 631

>TBLA0E03230 Chr5 complement(810836..813559) [2724 bp, 907 aa] {ON}
            Anc_6.56 YOR165W
          Length = 907

 Score = 35.4 bits (80), Expect = 0.68
 Identities = 49/227 (21%), Positives = 86/227 (37%), Gaps = 18/227 (7%)
 Frame = +1

Query: 118  NSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDIL 297
            N L+ SMK+  S  NN    ++  N  +  TN   E+  KEF    D L ++      ++
Sbjct: 419  NQLKTSMKNYNSANNNNSPFVEKLNANIKDTNLAFEKDVKEFQK--DQLIDEKTFDELLI 476

Query: 298  NRKSSTNDNKKNMQFLDDVNVAENDPSRRISKP-QLNFKTPVDNSESHP----------- 441
            N      DN+K+++         N    RI+K   + FK    N  SHP           
Sbjct: 477  NFSKLIKDNEKSLR-----EAHLNSIINRINKTLSIKFKDSSINLLSHPEIDVWDKVLNM 531

Query: 442  -----FKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEI-LNQEYNNDILEKKE 603
                  + L+  K    +   E        E   E  +  Y++ +  N+E N++I ++  
Sbjct: 532  FNITLTRILVNYKVETTREFNEKDGFEYNNEKYSEAVEDEYDFHLGFNKEKNSNIYKQ-- 589

Query: 604  PIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYY 744
             I   +W   + I  D +     ++  LK   E     + +D   ++
Sbjct: 590  -IRGNAWKTLDNIIHDYLKE-DSILSILKDKFETKFRYDENDTPKFW 634

>KAFR0K00380 Chr11 (82200..85001) [2802 bp, 933 aa] {ON} Anc_6.201
            YPL195W
          Length = 933

 Score = 35.4 bits (80), Expect = 0.69
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 5/101 (4%)
 Frame = +1

Query: 1906 THNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASD 2085
            +HN  ++     P K ED  E+  L++K  +   +K    D D  EE +   +    AS 
Sbjct: 833  SHNALANVSDRDPNKIEDQAELEKLREKFANQTLEKQNDVDDDDAEEVIVIKRKKKKASG 892

Query: 2086 NREVKK-KDKKRVFDPYSSTGEGPKA----AKKRRLVTKGK 2193
            +++++K K   +  +  SST EG  A    A K ++ T+ K
Sbjct: 893  DKKMRKGKKPSKTSETLSSTEEGTAANDSKAVKEQVPTQAK 933

>TDEL0A01290 Chr1 (222024..225701) [3678 bp, 1225 aa] {ON} Anc_8.235
            YDR097C
          Length = 1225

 Score = 35.4 bits (80), Expect = 0.71
 Identities = 25/92 (27%), Positives = 40/92 (43%)
 Frame = +1

Query: 1900 EETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILA 2079
            + TH+ KSD +Q     ++D D+   L      + D+K +  DGD      D  + N L+
Sbjct: 91   QNTHSSKSDSVQTPTVAEDDGDK--TLSNVSAVNLDRKQQEIDGD------DDEEGNTLS 142

Query: 2080 SDNREVKKKDKKRVFDPYSSTGEGPKAAKKRR 2175
            S  R +KK          S     P  ++K+R
Sbjct: 143  SSGRRLKKNLSYAEDSDNSDNESTPSVSRKKR 174

>KNAG0A05130 Chr1 complement(748935..755969) [7035 bp, 2344 aa] {ON}
            Anc_8.331 YDR150W
          Length = 2344

 Score = 35.4 bits (80), Expect = 0.75
 Identities = 59/226 (26%), Positives = 98/226 (43%), Gaps = 25/226 (11%)
 Frame = +1

Query: 37   VMETVRASNALASQDVEF------HKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEK 198
            V E  R S++L S  +E+       +++        E     +A+  +  LLS  N N+K
Sbjct: 691  VDELTRLSDSLRSPTIEYLTQHALDRNLTLVSTREYEDLKTQIANPTDEYLLSNANKNDK 750

Query: 199  LDGTNENLEEVCKEFSN-VMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDP 375
               +N+   E+ +  SN  +D L  K    L+ L  K+ TND   +M    D   A +  
Sbjct: 751  TLISNDKFNELNENLSNPSIDFLITK----LNTLEYKAITNDEYNSMICYRD---APSLL 803

Query: 376  SRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQL----VLATEDIPEHFQQ 543
                S  +LN KT +DN+ +H     + E+P+ L+ +EE  +L    V+ T D   ++  
Sbjct: 804  FLEESAAKLN-KTVIDNN-AHANLINVSERPD-LEFLEEKAKLFNKTVIDTSDY-RYYTD 859

Query: 544  PYE---YEILNQEYNN-----------DILEKKEPIPSTSWVDTNA 639
              E    E L ++  N           D L + E  PS  +++ NA
Sbjct: 860  TIEAPTLEFLEEKATNFDKILADKKHYDNLTELEKAPSLEFLEENA 905

>TBLA0E02230 Chr5 (552207..553631) [1425 bp, 474 aa] {ON} Anc_7.94
           YAL013W
          Length = 474

 Score = 35.0 bits (79), Expect = 0.77
 Identities = 51/200 (25%), Positives = 91/200 (45%), Gaps = 13/200 (6%)
 Frame = +1

Query: 61  NALASQDVEFHKSIDTSV-ANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCK 237
           NA  ++D E   SI ++V +N++++ +K +   M N+  S D   EKL+ + + +    K
Sbjct: 8   NATFNEDEE---SILSAVDSNAIKQDIKLLD--MENV--SSDAETEKLEESKDGVTSKEK 60

Query: 238 EFSNVMDVLFEKADRSLDILNR---KSSTNDNKKNMQFL------DDVNVAENDPSRRIS 390
           +     DV      R  D+L     KSSTN     ++ +      D +  +  +P     
Sbjct: 61  KEGGGGDV-----PRITDLLKESHVKSSTNVVASALEGINEQVNSDPLKESSREPEHLEQ 115

Query: 391 KPQLNFKTPVDNSESHPF---KPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEI 561
           KP L  +  +   +   F   K   IEK    K +EE  +   + + I E  ++P   E 
Sbjct: 116 KPVLTEQNELAAEKKEDFTEKKEDFIEK----KEVEEHPKENSSDKPIDESPKEPSNDEE 171

Query: 562 LNQEYNNDILEKKEPIPSTS 621
           +N + +  ++EK E +PST+
Sbjct: 172 INSKLSESVIEKNE-VPSTN 190

>YHR019C Chr8 complement(141894..143558) [1665 bp, 554 aa] {ON}
            DED81Cytosolic asparaginyl-tRNA synthetase, required for
            protein synthesis, catalyzes the specific attachment of
            asparagine to its cognate tRNA
          Length = 554

 Score = 35.0 bits (79), Expect = 0.81
 Identities = 19/76 (25%), Positives = 32/76 (42%)
 Frame = +1

Query: 1978 LKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPK 2157
            LKKK +   +Q+ K    +        S  NI   ++  +    K R++D YS  G+  K
Sbjct: 74   LKKKAVKQKEQELKKQQKEAENAAKQLSALNITIKEDESLPAAIKTRIYDSYSKVGQRVK 133

Query: 2158 AAKKRRLVTKGKKISF 2205
             +     +   KK+ F
Sbjct: 134  VSGWIHRLRSNKKVIF 149

>Sklu_YGOB_Anc_8.665 Chr8 complement(600377..601444,601446..602225)
            [1848 bp, 615 aa] {ON} ANNOTATED BY YGOB -
          Length = 615

 Score = 35.0 bits (79), Expect = 0.83
 Identities = 25/114 (21%), Positives = 48/114 (42%)
 Frame = +1

Query: 1870 TSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEP 2049
            T  SN  +  E    K +D++  +P+ +   +    L +K +   +++ K +     E+ 
Sbjct: 127  TEVSNDSVGVEAVEEKDTDKVTEVPDDEITEEPPRQLDEKSVEKEEEEEKEE-----EKT 181

Query: 2050 VDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
             + S+  +    N+       +R+ D    T  GP   KK++   K KK   KK
Sbjct: 182  TEESQEELSEGPNKTNDHTSAERIEDSSDETAAGPSKNKKKK--NKKKKNKKKK 233

>Kpol_YGOB_1055.70 s1055 complement(184555..186555) [2001 bp, 666
           aa] {ON} ANNOTATED BY YGOB -
          Length = 666

 Score = 35.0 bits (79), Expect = 0.85
 Identities = 37/164 (22%), Positives = 65/164 (39%), Gaps = 2/164 (1%)
 Frame = +1

Query: 214 ENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISK 393
           EN E+   E S+       K  + L+   ++ S   NKK  ++L++ +V       +   
Sbjct: 395 ENFEKKSTEGSHTSQDALMKELQDLESAFKELSNLTNKKYSEYLNNESVISKLTVEKTKA 454

Query: 394 PQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYE--YEILN 567
            Q  F              +LIE  N  KS+ +S +L+L  ++  + FQQ  E   + L 
Sbjct: 455 DQKYFAAMRSKDS------ILIENKNLSKSLSKSNELILQLKESEKLFQQKIENLTKQLE 508

Query: 568 QEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSS 699
              NN++            +++N      I  L   +   KKS+
Sbjct: 509 LSQNNEL----------RLINSNKTETMKIIELNSQLSNFKKSA 542

>Kpol_1055.70 s1055 complement(184555..186561) [2007 bp, 668 aa]
           {OFF} complement(184555..186561) [2007 nt, 669 aa]
          Length = 668

 Score = 35.0 bits (79), Expect = 0.85
 Identities = 37/164 (22%), Positives = 65/164 (39%), Gaps = 2/164 (1%)
 Frame = +1

Query: 214 ENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISK 393
           EN E+   E S+       K  + L+   ++ S   NKK  ++L++ +V       +   
Sbjct: 397 ENFEKKSTEGSHTSQDALMKELQDLESAFKELSNLTNKKYSEYLNNESVISKLTVEKTKA 456

Query: 394 PQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYE--YEILN 567
            Q  F              +LIE  N  KS+ +S +L+L  ++  + FQQ  E   + L 
Sbjct: 457 DQKYFAAMRSKDS------ILIENKNLSKSLSKSNELILQLKESEKLFQQKIENLTKQLE 510

Query: 568 QEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSS 699
              NN++            +++N      I  L   +   KKS+
Sbjct: 511 LSQNNEL----------RLINSNKTETMKIIELNSQLSNFKKSA 544

>TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {ON}
            Anc_8.604 YOR195W
          Length = 818

 Score = 35.0 bits (79), Expect = 0.88
 Identities = 41/192 (21%), Positives = 82/192 (42%), Gaps = 4/192 (2%)
 Frame = +1

Query: 1546 EVKSINNRLPSSLDVSQDELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSE 1725
            +VK +N  + S      +E   L S+K+E +T  +K ++ +L Q T S+Q+ T++ +  +
Sbjct: 456  QVKDLNENIHSL-----EEKDKLNSNKLETITEEYKTLQQKL-QDTLSQQSGTTNDLNKQ 509

Query: 1726 ILLHPEHAVKYHNGSACSVEESELK----DRYLSYIKATLLAASKNINMVLETSNSNAPL 1893
            +                  EE+ L     +  L  +K + ++  + + + L+ +      
Sbjct: 510  L------------------EETRLAKIEVESQLDELKTSSISEKETLEIKLKETEQQLEN 551

Query: 1894 ETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANI 2073
             T+      + +  +  E  E ++ I +LKK+   SN      DD +I +  V   K  I
Sbjct: 552  NTKLVDELLAKKTSLETELHEKINSIELLKKQNTESN------DDSEINKAQVGQLKIEI 605

Query: 2074 LASDNREVKKKD 2109
             A   +E+   D
Sbjct: 606  QALKEKEMVLND 617

>KNAG0I02960 Chr9 complement(584077..586971) [2895 bp, 964 aa] {ON}
            Anc_4.46 YLR309C
          Length = 964

 Score = 35.0 bits (79), Expect = 0.91
 Identities = 25/103 (24%), Positives = 52/103 (50%), Gaps = 3/103 (2%)
 Frame = +1

Query: 28   LKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVM--NNILLSIDNN-NEK 198
            L  + E ++  N + S+D    + I +++  SL ++ K +  +   N  LL ++N+ N+K
Sbjct: 776  LTSLNEAIKRKNEVNSEDSSGLEKIASNLKESLSRADKRVQELQKSNEELLDLNNDINKK 835

Query: 199  LDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNK 327
             D   +N + +  +F+   DV  + + RS    +  S  +D+K
Sbjct: 836  FDRLTKNYKSLSNQFNAFKDVRQDTSRRSSRSGSVNSQASDHK 878

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
            Anc_5.88 YGR238C
          Length = 986

 Score = 35.0 bits (79), Expect = 0.91
 Identities = 64/270 (23%), Positives = 115/270 (42%), Gaps = 23/270 (8%)
 Frame = +1

Query: 13   SGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLS----- 177
            S + V KK+ ET+R    L  QD+   + I T  A+     +KS+      +L       
Sbjct: 681  SSEMVDKKLFETLR----LELQDL---RRIATEKADEASVQIKSLEMENEKLLAQSKEAV 733

Query: 178  ----IDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSST------NDNK 327
                + N  + L+  N  L++   E   +++  F   +   DI+ ++S        ++N+
Sbjct: 734  DTTEVQNRCKILETDNNALKDQILELEMLVNDKFLNVNVLNDIIKQQSKEIQILRLDENE 793

Query: 328  KNMQFLDDVNVAE-NDPSRRISKPQLNFK---TPVDNSESHPFKPLLIEKPNALKSIEES 495
            K      + NV E ND ++R+ K   + +   T   N+ S     LL    N  K+   S
Sbjct: 794  KERLSELERNVTELNDENQRLKKELQDHRLDSTSNINNYSTRLDDLLARWRNNPKNNNFS 853

Query: 496  TQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDM 675
                              E EI NQ   N+ L +++ +P++S    +   VD+++S  D 
Sbjct: 854  ------------------EKEI-NQPPTNNQLHEEQHLPNSS--PRHKTVVDDLSSQLDQ 892

Query: 676  M----QELKKSSEIAVDLEHHDFRSYYGLV 753
            +    + L +S E  +D E+HDFR  + ++
Sbjct: 893  LLIKSESLSESKE-RLDSEYHDFRKKHSIL 921

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 35.0 bits (79), Expect = 0.93
 Identities = 45/194 (23%), Positives = 83/194 (42%), Gaps = 2/194 (1%)
 Frame = +1

Query: 43  ETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENL 222
           ET R  NA     ++  K +     +S E  +K + S ++ +        E+L+  NE+ 
Sbjct: 229 ETDRVVNAYDYHRLKSQKELFKETLSSKENKIKDLNSQISKLA-------EELESLNEDF 281

Query: 223 EEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQL 402
           EE+ K                     +K++  D   N+  L++    EN+     SK  +
Sbjct: 282 EEIRK---------------------KKNAEMDKNSNLSKLEE---EENEIINETSKLNV 317

Query: 403 NFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYN- 579
             K   DN + +  K + I K    K IE+S+  +    D+ +  ++  +Y+ LN + + 
Sbjct: 318 LLKICSDNYKENVNK-IQIHK----KIIEDSSMELAKKADVYKKSKE--DYKTLNDQLDT 370

Query: 580 -NDILEKKEPIPST 618
             D+ +KKE + ST
Sbjct: 371 LKDLHKKKEDLLST 384

>NDAI0G04320 Chr7 (1039571..1041022) [1452 bp, 483 aa] {ON} Anc_1.397
            YLR175W
          Length = 483

 Score = 34.7 bits (78), Expect = 1.0
 Identities = 31/101 (30%), Positives = 48/101 (47%)
 Frame = +1

Query: 1870 TSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEP 2049
            T++ +APL  E    ++  Q +   EK+ + +E  V KK+K    D+K K D  +  E+ 
Sbjct: 397  TTSESAPLIKEVESKEEKKQEEESKEKESNDEETKVEKKEK---KDKKEKKDKKEKKEK- 452

Query: 2050 VDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKAAKKR 2172
                       D +E  KK+KKR  D     GEG +  KK+
Sbjct: 453  ----------KDKKE--KKEKKRKADE-DGEGEGEEKKKKK 480

>NDAI0K01600 Chr11 complement(360599..361225) [627 bp, 208 aa] {ON} 
          Length = 208

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 8/88 (9%)
 Frame = +1

Query: 1873 SNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGD------ 2034
            +  NAP+        K ++ Q +  K  D +E  V KK+K ++ND++ + ++ D      
Sbjct: 121  TKGNAPILGRLNFGIKREEQQKLYTKVSDGEEETVSKKRKQNNNDEEEEEEEDDDDDYEL 180

Query: 2035 --IVEEPVDYSKANILASDNREVKKKDK 2112
              + +E + +  +N  +  N + KK+ +
Sbjct: 181  DTMFKESIKHKMSNKKSGKNNKTKKQKR 208

>KAFR0H02940 Chr8 (558290..560074) [1785 bp, 594 aa] {ON} Anc_1.441
           YEL013W
          Length = 594

 Score = 34.7 bits (78), Expect = 1.1
 Identities = 17/71 (23%), Positives = 42/71 (59%)
 Frame = +1

Query: 166 ILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFL 345
           IL  ++++N ++ G  +N  E+ ++   + +  FE+  RS   +NR+S++++N ++   L
Sbjct: 502 ILQLLESHNNEILGFFKNDNELIEDVKKMSETTFERLQRSGIDVNRQSTSDENNESSNHL 561

Query: 346 DDVNVAENDPS 378
           D+  ++ +  S
Sbjct: 562 DNDEMSNSRSS 572

>Kpol_388.9 s388 complement(27180..29159) [1980 bp, 659 aa] {ON}
           complement(27180..29159) [1980 nt, 660 aa]
          Length = 659

 Score = 34.7 bits (78), Expect = 1.1
 Identities = 45/225 (20%), Positives = 89/225 (39%), Gaps = 24/225 (10%)
 Frame = +1

Query: 10  DSGDNVLKKVM-ETVRASNALAS--QDVEFHKSIDTSVANSLEKSMKSMASVMNNILL-- 174
           D G N L K++ + + A+  + S   D +     D+S ++    S+      + N+ +  
Sbjct: 157 DDGLNDLSKIINKAISAAEKVGSLFSDDDDDDDDDSSSSSKNIASVNLTIKALRNLYIPS 216

Query: 175 SIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDV 354
           SI++  EK+  +    +EV     N++ + FEK  + +  +N  +   D   ++ ++  +
Sbjct: 217 SINDKLEKISDSTPTFDEVKNSTKNLIGIPFEKIRKEIKSINTTNIVGD--PDVLYVPPI 274

Query: 355 NVAENDPSRRISKPQLNFKTPVDNSESHPFK-------------------PLLIEKPNAL 477
           N  +N   + I     N  T    S  H  K                   P  +E+    
Sbjct: 275 N--DNSNYQGICSANKNHITSFFYSMDHLLKVATIVCIVLLLIGAVVVLFPEFLEEFKLW 332

Query: 478 KSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIP 612
           K + +  +     +D+   +    E E +NQE  +   +KK  IP
Sbjct: 333 KRLTQLREFYWYNKDL---YPSSSELETINQEVKDPFNDKKNIIP 374

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
            {ON} YDR507C (REAL)
          Length = 1024

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 43/211 (20%), Positives = 76/211 (36%), Gaps = 33/211 (15%)
 Frame = +1

Query: 85   EFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENL---EEVCKEFSNVM 255
            E  K  D  V +   KS     +     +LS+ ++     G +  L   +     +S++ 
Sbjct: 692  EVCKISDIQVPHFTRKSKCFTPTNNRRSVLSLYSSRHSFKGLSRILNSKDPSANPYSHIN 751

Query: 256  DVLFEKADRSLDILNRKSSTNDNKKNMQFLD---------------DVNVAENDPSRRIS 390
              L E+ D + DI N K+  N+N  N +  D               D +  END   +  
Sbjct: 752  GPLSEEIDLTEDIANMKNIENNNNNNNRLYDVSESAILLQGNDDDDDDDDNENDDGSQSI 811

Query: 391  KPQLNFKTPVDNSESHPFKPLLIEK---------------PNALKSIEESTQLVLATEDI 525
            +  ++  T        P      EK               P+   SIE    + +A ED+
Sbjct: 812  QSSVSNNTEPTTFVKLPSLSSFQEKNASGLGIYQREPSIEPSIESSIEPLPNVTIAIEDV 871

Query: 526  PEHFQQPYEYEILNQEYNNDILEKKEPIPST 618
             E  +   ++E +    +ND ++K +    T
Sbjct: 872  DEDGENEIQHENITTSLSNDNIKKNDDTKDT 902

>TBLA0E00340 Chr5 complement(57462..60764) [3303 bp, 1100 aa] {ON}
           Anc_3.547 YGL229C
          Length = 1100

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 36/147 (24%), Positives = 57/147 (38%), Gaps = 5/147 (3%)
 Frame = +1

Query: 85  EFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVL 264
           E   S   S+  S EK   +   V N     I+NN E +D TN N         NV D  
Sbjct: 72  EISNSSSDSLIISKEKDNIASQGVTNETNTVINNNREIIDNTNNN-----NNRDNVADNG 126

Query: 265 FEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAEN---DPSRRISKPQLNFKTPVDNSE- 432
               D S +  N  ++ N+N       +D N  +N   + +  IS  ++     + N + 
Sbjct: 127 NISNDNSNNNNNSNNAFNENNDTTTTTNDNNDNDNNDTNDTNDISTIEITHIDSIVNLQQ 186

Query: 433 -SHPFKPLLIEKPNALKSIEESTQLVL 510
             H F   ++ +P  L  +     L+L
Sbjct: 187 LDHSFIDNVLNEPELLNELNRQNNLLL 213

>CAGL0D06622g Chr4 complement(629323..632859) [3537 bp, 1178 aa]
           {ON} weakly similar to uniprot|P23201 Saccharomyces
           cerevisiae YLL021w SPA2 involved in cell polarity
          Length = 1178

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 38/201 (18%), Positives = 87/201 (43%), Gaps = 17/201 (8%)
 Frame = +1

Query: 4   SSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSM------KSMASVMNN 165
           + +   N+   + +T   + A+  ++ E H  + T   ++ + ++      K+     NN
Sbjct: 234 TKNESTNLSDLIEKTFNNAEAVQEEEEEAHNKMSTRSTDNDDFNLNDTPVTKNSNEEKNN 293

Query: 166 I---LLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTN--DNKK 330
           +   L   D   +    TN+    + +   ++ DV  ++ D+SL++ N   S+N  +++ 
Sbjct: 294 LASKLFEFDQPQDVYSSTND-FSSLYRSAEDISDV--KEGDQSLELGNGDDSSNHIEHRY 350

Query: 331 NMQFLD------DVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEE 492
              F+       D+++      +RIS+ +L  K+P  + +   + P  ++    LK++ E
Sbjct: 351 QKDFIQLNSQIRDLSIENEQLKQRISELELEMKSPTKSVKRETYLP-PVDTKKTLKNLME 409

Query: 493 STQLVLATEDIPEHFQQPYEY 555
               +L   D  + F  P  Y
Sbjct: 410 DN--LLNDSDNLQKFFDPNGY 428

>TBLA0I02510 Chr9 (581102..586096) [4995 bp, 1664 aa] {ON} Anc_7.463
           YJR092W
          Length = 1664

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 24/123 (19%), Positives = 62/123 (50%), Gaps = 9/123 (7%)
 Frame = +1

Query: 112 VANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLE--EVCKEFSNVM---DVLFEKA 276
           +++ + K+  ++  ++NN   SID N+     + +N +  E+  + S  +   + + E+ 
Sbjct: 623 ISSPMTKASTTIVPIINNKSSSIDMNSSLTTNSIDNFQNFEIASQDSTNIANNNNMAEQV 682

Query: 277 DRSLDILNRKSSTNDNKKNM----QFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPF 444
            ++ DI++++S+ + N  N+    +  D++   E + S + S+ + N      N+  H  
Sbjct: 683 SQNEDIISKESNLSGNSLNLINSTETFDNIQDTETEESDQSSETESNDIESKTNTLEHSL 742

Query: 445 KPL 453
           +P+
Sbjct: 743 QPM 745

>Kpol_228.4 s228 complement(7266..8591) [1326 bp, 441 aa] {ON}
            complement(7266..8591) [1326 nt, 442 aa]
          Length = 441

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 33/144 (22%), Positives = 62/144 (43%)
 Frame = +1

Query: 1720 SEILLHPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLET 1899
            S IL+  + A K  N       + ++    + ++       +KN  +V+ TS  +    T
Sbjct: 286  SRILVTSDCAYKNVNNKNIRSLDLQIVKTIMDFVSGDSKFKNKNSAIVMATSGDDRTNRT 345

Query: 1900 EETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILA 2079
                  K+   + IP KQ D +   +LKK K+    Q  K    ++ E    Y +++I+ 
Sbjct: 346  LPIALGKAQHDEYIPRKQYDPEFAEILKKGKV-EEFQVPKLTKEEVKELMSFYLESDIVL 404

Query: 2080 SDNREVKKKDKKRVFDPYSSTGEG 2151
              +++ K  D + V + Y  +G G
Sbjct: 405  KKDKDSKSLD-QLVDEKYFLSGNG 427

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score = 34.3 bits (77), Expect = 1.5
 Identities = 56/279 (20%), Positives = 109/279 (39%), Gaps = 16/279 (5%)
 Frame = +1

Query: 4   SSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSID 183
           S+ S  ++     E ++  N L  Q+  FHK    +  + L+  M       N++ L ++
Sbjct: 68  STSSSSHMTSFYRENIKELNQL--QERMFHKK---ARLDELKDEMADYKERFNSLELKLE 122

Query: 184 NNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVA 363
              E+    ++ ++    E   ++  L  K          K  +  ++  +Q L   N A
Sbjct: 123 ALKEEKHVKSQQIKLKQNELDRLIQELRTK---------EKFMSQGHELQLQQLKVKNAA 173

Query: 364 ENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEH--- 534
           E      I+  +  +KT +D  +    K + I++   LK +EE    +LA + I      
Sbjct: 174 E------INSLEGKYKTKIDTLKYEKIKKVEIKRDELLKEVEEINAQILANDRILSQLLD 227

Query: 535 ---FQQPYEYEILNQEYNN---DILEKKEPIP-----STSWVDTN--AIWVDNINSLQDM 675
               +   + EI  +EY +   D L++ E +        + +D N      +N+ SL  +
Sbjct: 228 DCKLKHSNDKEIWLREYQHIWTDTLKENEALSLELSNLETTIDQNLRPELDENLESLDKL 287

Query: 676 MQELKKSSEIAVDLEHHDFRSYYGLVCLMQISTRTQDYI 792
            +E  +      D + H+   Y       QI+T   D +
Sbjct: 288 KEEFAELQRHLKDTQDHNSHLY------SQINTTKADIV 320

>NDAI0F00790 Chr6 complement(189781..190728) [948 bp, 315 aa] {ON}
           Anc_5.630
          Length = 315

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 47/226 (20%), Positives = 95/226 (42%), Gaps = 5/226 (2%)
 Frame = +1

Query: 61  NALASQDVEFHKSIDT--SVANSLEKSM---KSMASVMNNILLSIDNNNEKLDGTNENLE 225
           +++A+Q  E +  I T    + SL+KS+   K    ++ N++   + N  K+      L 
Sbjct: 51  DSIAAQLFEINGQISTLQQFSQSLQKSLDDNKVRTKIVENVIKKANLNIHKIG----ELV 106

Query: 226 EVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLN 405
           + C E    +D L       L +++R+    D K ++Q    +   +++ ++ I   Q+N
Sbjct: 107 KACNEDVTKIDSLEVTTLNKLQLISREKLLRDFKSSLQEFQSI---QSNYTKLIK--QIN 161

Query: 406 FKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNND 585
            KT              ++    L S    T L+   E   EH Q     + L  +  N 
Sbjct: 162 EKTK-------------LQLYGNLHSDANETALLQEQE---EHTQPQIHEQQLLPKQKNR 205

Query: 586 ILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEH 723
           I+ ++EPI +  +     +       + ++ Q++ + +EI  DL +
Sbjct: 206 IVIEREPINNEEFTYQQNLIEQRNREITNIEQDITELNEIFKDLSN 251

>Skud_4.684 Chr4 (1211138..1213813) [2676 bp, 891 aa] {ON} YDR409W
           (REAL)
          Length = 891

 Score = 34.3 bits (77), Expect = 1.5
 Identities = 43/151 (28%), Positives = 59/151 (39%), Gaps = 7/151 (4%)
 Frame = +1

Query: 67  LASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFS 246
           L S D E ++S +T V N+ E S        N+   + DNN  K    N N   +    S
Sbjct: 486 LDSDDDELNES-NTYVTNNHETS--------NSCSNNNDNNKNKNKNKNINNNSIKNNNS 536

Query: 247 NVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRI-------SKPQLN 405
           N         D S    N   +TN+N       DD N ++ND   R+            N
Sbjct: 537 N--------NDESNANNNHNKNTNNNN------DDKNDSDNDDDDRLIAEIANNRAKNDN 582

Query: 406 FKTPVDNSESHPFKPLLIEKPNALKSIEEST 498
             TP D S S P K L    P +  ++ E+T
Sbjct: 583 TNTPADKSASIPSKTL---DPKSYTNVSETT 610

>Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {ON}
           YLR309C (REAL)
          Length = 916

 Score = 34.3 bits (77), Expect = 1.6
 Identities = 35/147 (23%), Positives = 62/147 (42%), Gaps = 4/147 (2%)
 Frame = +1

Query: 94  KSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEK 273
           KSI T    SL+ S K     +  +   +   NE+ D   ++ E++ KE S        K
Sbjct: 503 KSIITKELTSLKISYKQKEKTVGYLEEQVKQFNEQKDAAEKSTEQLKKENS--------K 554

Query: 274 ADRSLDILNRKSST--NDNKKNMQFLDDVNVAENDPSRRISKPQLNFKT--PVDNSESHP 441
               LD+L +++ T  ND KKN    +         S R++  Q  + T   V ++ +  
Sbjct: 555 ISNRLDLLKKENETLHNDIKKNGNSYETYLKENGKLSERLNILQEKYNTLQNVKSNSNEH 614

Query: 442 FKPLLIEKPNALKSIEESTQLVLATED 522
              +  +       ++ES + +L+ ED
Sbjct: 615 MDSIKRQCEELNVKLKESNKKILSLED 641

>NDAI0G04520 Chr7 (1081291..1084044) [2754 bp, 917 aa] {ON}
           Anc_2.637 YMR066W
          Length = 917

 Score = 34.3 bits (77), Expect = 1.6
 Identities = 45/215 (20%), Positives = 89/215 (41%), Gaps = 5/215 (2%)
 Frame = +1

Query: 94  KSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNEN-LEEVCKEFSNVMDVLFE 270
           K +DT++   L   +K +    N I+ ++   +   D  + + +EE   ++   ++  F+
Sbjct: 42  KKLDTNIDTKLPHDLKPLQDP-NEIIKTLKQTHGFSDINDASPIEETFLQYLTFLNKGFQ 100

Query: 271 KADRSLDIL--NRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPF 444
           K+D++L +L  N KS+ N+N +    +    + E+                    E   F
Sbjct: 101 KSDQNLRLLKENLKSTGNNNNEKFNLIFSYLLTES------------------TLELQRF 142

Query: 445 KPLLIEKPNALKSIEESTQLVLATEDIPE--HFQQPYEYEILNQEYNNDILEKKEPIPST 618
           K L    P  LKSI++  Q     ED       ++  E  I+N+ ++    + KE     
Sbjct: 143 KQL---GPEGLKSIKQQQQQQSNDEDENSVVKNEKDLELRIMNEIFSTLTEKNKE----- 194

Query: 619 SWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEH 723
                N +++ N++ L  ++ EL  +       EH
Sbjct: 195 -----NEVYLHNVDFLFKILTELNSTITEDKGFEH 224

>Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..61998)
            [2874 nt, 958 aa]
          Length = 957

 Score = 34.3 bits (77), Expect = 1.6
 Identities = 68/320 (21%), Positives = 130/320 (40%), Gaps = 47/320 (14%)
 Frame = +1

Query: 19   DNVLKKVMETVRASNALASQDVEFHKSIDTSVANS-----LEKSMKSMASVMNNILLSID 183
            D +  K  E  R  +   S+D E  +  DT ++ +     L  S++S  S +  I + +D
Sbjct: 275  DALRLKDQEIKRLDDIFLSKDQEIKRLNDTFISKNEEIKRLNDSLRSKDSDIQTINILVD 334

Query: 184  NNNEKLDGTNENLEEVCKEFSNV---MDVLFEKADRSL---------------------- 288
            N  E      EN     K +SN+   +++ FEK + ++                      
Sbjct: 335  NLKEFKSLQQENDSNNTKNYSNLISEINLKFEKLNENIKLKDIEINKLNETISELKNKDL 394

Query: 289  ------DILNRK-----SSTNDNKKNMQFLD----DVNVAENDPSRRISKPQLNFKTPVD 423
                  D+LN K        N ++ +++ L+    +     N+    IS+ Q NF     
Sbjct: 395  QGKYDKDLLNEKLRLQVEQNNKDEDDLKILNGKIKEYEEIINNSKCTISELQANF----- 449

Query: 424  NSESHPFKPLLIEKPNALKSIEE-STQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKK 600
            N  ++  K L  +  + +K++EE +++L    ++I E   +  + ++  + +N  ++   
Sbjct: 450  NEANNTIKNLNAKLDSFVKNLEEANSELSNKDKEINELTLKSTQQKLSIETFNEKLVTNT 509

Query: 601  EPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQISTRT 780
              I   S  +      D ++SL D++Q    +SE +V  +     S    +  +  S +T
Sbjct: 510  SQISVMS--ENLKEERDKLSSLNDLLQ----TSEASVKSKELMVSSLESKLVNLNDSIKT 563

Query: 781  -QDYIVDTIALRDDLKMLNE 837
              D IV   A   +LK  NE
Sbjct: 564  LDDKIVTMEAENAELKKDNE 583

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 34.3 bits (77), Expect = 1.6
 Identities = 42/197 (21%), Positives = 73/197 (37%)
 Frame = +1

Query: 1579 SLDVSQDELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKY 1758
            S D S  E++    H+      +F   ++Q    + SKQ  T             H+   
Sbjct: 578  SRDASLSEIK---KHRRNSSILSFFSSKSQSNPTSPSKQTFTIDPSKMS-----SHSRSQ 629

Query: 1759 HNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQV 1938
             N  + +  +S    R  S + + L  +   IN     S SN  L   +THN  +   + 
Sbjct: 630  SNSYSHARSQSYSHSRKHSLVTSPLKTSLSPIN-----SKSNIALVPSDTHNSNNSNKEE 684

Query: 1939 IPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKR 2118
            IP+ +E        K K  + +  K KH+ G                S +   ++K +K+
Sbjct: 685  IPQPREG-------KHKHKYKHKSKHKHNSG----------------SKDSPSEEKSRKK 721

Query: 2119 VFDPYSSTGEGPKAAKK 2169
            +F     +  G K +K+
Sbjct: 722  IFSGTKDSSSGNKDSKR 738

>NDAI0A02470 Chr1 complement(548044..549105) [1062 bp, 353 aa] {ON}
            Anc_7.253 YIL063C
          Length = 353

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 25/104 (24%), Positives = 46/104 (44%)
 Frame = +1

Query: 1846 KNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHD 2025
            KN N  L+ S  ++  +T   + KK   +++  EK+ D+ +    +  +I  +    K  
Sbjct: 17   KNENETLKRSRDDSKADTINNNTKK---VKLDQEKKADVSDKEEAQPTEIDEDQSLTKKT 73

Query: 2026 DGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPK 2157
            D D  E     ++    +S  +E  KKD++   +    TG  PK
Sbjct: 74   DEDSKENNEKQTEKEEDSSIPKEDVKKDQEEKVEEKEKTGSSPK 117

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
           complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score = 34.3 bits (77), Expect = 1.6
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 10/115 (8%)
 Frame = +1

Query: 79  DVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGT-NENLEEVCKEFSNVM 255
           D+EF K  DTS  +S         S+ N+   S  ++ +KLD   ++ +E+   +FS  +
Sbjct: 468 DMEFKKHDDTSFTDS---------SITNSY--SYTSSVQKLDTEPSDEIEDQNNDFSYEI 516

Query: 256 DVL-------FEKADRSLDILNRKSSTNDNKKNMQFL--DDVNVAENDPSRRISK 393
           D         F+  D + + LN KSST+ NK++++     ++   EN+P +  S+
Sbjct: 517 DSYEVPDSDKFDNLDGTENSLNNKSSTSINKEHIETSKPSELLAKENEPEKHHSR 571

>Suva_1.48 Chr1 (91216..94602) [3387 bp, 1128 aa] {ON} YAL019W
           (REAL)
          Length = 1128

 Score = 34.3 bits (77), Expect = 1.6
 Identities = 50/222 (22%), Positives = 92/222 (41%), Gaps = 29/222 (13%)
 Frame = +1

Query: 7   SDSGDNVLKKVMETVR-----ASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNIL 171
           SD  D  + K    V      + NA A+   EF+   D   A S ++  +S A+   +  
Sbjct: 300 SDLSDTTMHKAQLIVSHRPYASLNAFAN--TEFNDK-DAEEAVSGKRKRRSAATANESER 356

Query: 172 LSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADR---------SLDILNRKSSTNDN 324
           L +D   + + G N  +E V K+ S+  D++  +  +          LD++N     +D+
Sbjct: 357 L-LDKITQSIRGYNA-IESVIKKCSSYGDLVTSQMKKWGLQVGDNSELDVMNLDEGDDDD 414

Query: 325 KKNMQFLDDVNVAENDPSRRISKPQLNFKTPV-------DNSESHPFKPLLIEKPNA--- 474
             +    D+ N  +N  S   +  Q N K          D + + P  P L E+      
Sbjct: 415 DDDDDDDDEDNNGDNGASTAGAHDQRNGKEAARAVVEGFDETSAEP-TPALEERETRTRN 473

Query: 475 -----LKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNND 585
                +KS EE   L    +++P+   +  +YE  +++YN++
Sbjct: 474 TSEPLVKSDEEGVDLEAIDDELPQSEHEEDDYEEEDEDYNDE 515

>CAGL0F05533g Chr6 complement(557208..558329) [1122 bp, 373 aa] {ON}
           weakly similar to uniprot|P14905 Saccharomyces
           cerevisiae YDR197w CBS2 cytochrome B translational
           activator protein
          Length = 373

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 23/103 (22%), Positives = 46/103 (44%), Gaps = 8/103 (7%)
 Frame = +1

Query: 556 EILNQEY-----NNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELK---KSSEIAV 711
           EI N+E+     NNDI  K   +P T W + N    ++ NS+  +M ++     ++ + +
Sbjct: 157 EIGNEEFDVRVNNNDIKIKYSHLPETLWANENDSIENSQNSINSLMNQINLHYPTATVGI 216

Query: 712 DLEHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEV 840
             E   F+  +   C  ++   T    ++ + L  D   + E+
Sbjct: 217 QTEQVSFQEMFTNYCERELVDNT----IEALCLLFDCSFIKEL 255

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +1

Query: 967  LPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHFLLNIF 1119
            L K  L  L  +  NF  + +YQ+A W+ R  ++    +   D HF  NIF
Sbjct: 112  LVKGDLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSCFGLNDIHFCRNIF 162

>NCAS0A08130 Chr1 (1604190..1608143) [3954 bp, 1317 aa] {ON} Anc_5.587
            YDR464W
          Length = 1317

 Score = 34.3 bits (77), Expect = 1.6
 Identities = 30/94 (31%), Positives = 42/94 (44%), Gaps = 2/94 (2%)
 Frame = +1

Query: 1873 SNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPV 2052
            SNS+ P     T +++ DQ   + EK++   +    KKKK      K KH D D   + V
Sbjct: 122  SNSHEP-----TVDQQEDQSLAVEEKEKKSSK----KKKKKEKEKSKHKHKDSD---KHV 169

Query: 2053 DYSKANILASDNREVKKKDKKRVFDPY--SSTGE 2148
               K     SD  E K K+K +   P    +TGE
Sbjct: 170  KKKKKKKSTSDKHEKKSKNKDKNVVPIIGDNTGE 203

>KLTH0D16764g Chr4 (1384207..1385466) [1260 bp, 419 aa] {ON} highly
            similar to uniprot|Q06205 Saccharomyces cerevisiae and to
            YML074c uniprot|P38911 Saccharomyces cerevisiae
          Length = 419

 Score = 33.9 bits (76), Expect = 1.7
 Identities = 40/186 (21%), Positives = 68/186 (36%), Gaps = 49/186 (26%)
 Frame = +1

Query: 1783 EESELKDRYLSYIKATL-------------LAASKNINMVLETSN--------------- 1878
            EE+EL D +  Y+  TL             +A  + +  VL  S                
Sbjct: 124  EEAELDDEFQEYVVLTLSPKVQFQQTLDLVIAPEEEVQFVLTGSYPIHLTGNYVKHPFDQ 183

Query: 1879 ---SNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVL---------------KKKKIHSN 2004
                +   E E++    S++  + P++ E +D++  +               +K K  + 
Sbjct: 184  PQYGDDDSEEEDSEEYDSEEYDLTPDEDELLDDLEDVSDVESRIEELVQQDEQKNKNKNK 243

Query: 2005 DQKAKHD---DGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKAAKKRR 2175
            ++K K D   DGD  + P    +      +  +  KK+KK  F      G   KAAK+  
Sbjct: 244  NKKRKQDEKEDGDEEKAPEQPKETKKTKKEEPKKDKKEKKVEFKKNLEEGPSKKAAKEAA 303

Query: 2176 LVTKGK 2193
              TK K
Sbjct: 304  KETKPK 309

>KLLA0F07799g Chr6 complement(734889..736277) [1389 bp, 462 aa] {ON}
            similar to uniprot|Q08208 Saccharomyces cerevisiae
            YOL041C
          Length = 462

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 32/125 (25%), Positives = 49/125 (39%), Gaps = 10/125 (8%)
 Frame = +1

Query: 1843 SKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKH 2022
            SK   ++ E        E E      S   + + ++QE+ +E    KKKK   ND++  +
Sbjct: 38   SKARTVLTEPEQDKDEQEEENVQESASTVSEGVEKEQEEQEEQPKKKKKKTKKNDEENDN 97

Query: 2023 ----------DDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKAAKKR 2172
                       D    +EP D  K +   SDN     +D+    D  S TG   ++AK  
Sbjct: 98   LEVQYYSKVLGDSKSKDEPKDEPKDDSSDSDN-----EDEATAVDKSSITGTESESAKVI 152

Query: 2173 RLVTK 2187
             L  K
Sbjct: 153  NLKEK 157

>Smik_8.84 Chr8 complement(122164..123828) [1665 bp, 554 aa] {ON}
            YHR019C (REAL)
          Length = 554

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 19/76 (25%), Positives = 31/76 (40%)
 Frame = +1

Query: 1978 LKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPK 2157
            LKKK +   +Q+ K    +        S  NI   +N  +    K R+ D Y+  G+  K
Sbjct: 74   LKKKAVKQKEQELKKQQKEAENAAKQLSALNITIKENESLPAAIKTRIHDSYAKVGQRVK 133

Query: 2158 AAKKRRLVTKGKKISF 2205
             +     +   KK+ F
Sbjct: 134  ISGWIHRLRSNKKVVF 149

>NCAS0D03670 Chr4 (684291..686354) [2064 bp, 687 aa] {ON} Anc_6.188
           YGL086W
          Length = 687

 Score = 33.9 bits (76), Expect = 1.9
 Identities = 42/194 (21%), Positives = 83/194 (42%), Gaps = 6/194 (3%)
 Frame = +1

Query: 73  SQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNV 252
           + ++E  K +       L K +    + +N          +  DG NEN +++  E+ N 
Sbjct: 383 NHELEQQKLLSFEECKLLRKQLDEFDNFVNEA-----QGEKSKDGNNENYKDLVDEYKNK 437

Query: 253 MDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPV-DNS 429
            + L  +  R ++   R+ +   ++ N +   + + +    S+RI++ QL   + V D +
Sbjct: 438 TEDLTNELKR-INEEQRQQNQQQSQTNKKRKTNDSSSLTYYSQRINELQLENSSLVRDVA 496

Query: 430 ESHPFKPLLIEKPNALKSIEESTQLVLATEDIP---EHFQQPYEYEILNQEYNNDILEKK 600
           +       L  K   L  ++E    +L   D P   + F +  E E+L  E NND+L + 
Sbjct: 497 KKETVITHLEAKLKQLAELKEKKIRILQLRDGPLLKDQFIKRKELELLKAE-NNDLLSRS 555

Query: 601 --EPIPSTSWVDTN 636
             + IP + +   N
Sbjct: 556 GADMIPKSVYETLN 569

>Suva_10.228 Chr10 (421809..424079) [2271 bp, 756 aa] {ON} YLR135W
            (REAL)
          Length = 756

 Score = 33.9 bits (76), Expect = 2.0
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 2/107 (1%)
 Frame = +1

Query: 1741 EHAVKYHNGSACSVEESEL-KDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNK 1917
            + AV + + S    ++SE+ KD     I   L A+S      +E   S+A L  E+T  K
Sbjct: 324  QSAVNFLSLSQVMDDKSEIMKDEEDEIISGGLSASSPEYGNNIEGQESSAQLAAEDTELK 383

Query: 1918 KSDQI-QVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVD 2055
             + Q+ +V+P   +DM    +L +    S D    HD+  IV +  D
Sbjct: 384  VAAQVNEVVP--TDDMARKPILVEVDSSSKDGYDDHDNISIVSDSTD 428

>TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {ON}
           Anc_6.1 YPL266W
          Length = 321

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = +1

Query: 109 SVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRS 285
           ++   LEK+ K+  S+ N++ L ID+N+  +      +E+V KE +N+ D    K D++
Sbjct: 247 AILEILEKNYKAWLSMQNDMELDIDSNDSMIPIVKSKIEQVLKE-TNMSDKRAGKCDQN 304

>TBLA0C04390 Chr3 (1057279..1061097) [3819 bp, 1272 aa] {ON} Anc_4.56
            YGL049C
          Length = 1272

 Score = 33.9 bits (76), Expect = 2.1
 Identities = 50/213 (23%), Positives = 88/213 (41%), Gaps = 28/213 (13%)
 Frame = +1

Query: 1555 SINNRLPSSLDVSQDELQFLPSH--KIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEI 1728
            +I+N  PS+ + S D  +  PS   KI+    A + +E+ + +  +     T    L + 
Sbjct: 394  TISNSKPSTENESIDS-KHQPSSDAKIDTKEDATELVEDIMKENKEDIATRTRKTFLEQA 452

Query: 1729 LLHP---EHAVKYHNGSACSVEESELKDRYLSYIKATLLA-------ASKNINMVLETSN 1878
             L     E   K     + SVEE++ ++   S      +        +S   N V  TSN
Sbjct: 453  RLRKAELERKRKNDMPKSSSVEETKKENGRKSDDTTVAMTNDAPETISSSANNEVTATSN 512

Query: 1879 SNAPLETEETHNKKSDQIQVIPEKQEDMDEI----------------VVLKKKKIHSNDQ 2010
            +   +  +ET N   D+I +  E   D D+I                + LKK+K   N++
Sbjct: 513  TEGKIMQQETTN---DKIDIQEESNVDEDKIDKSKDIEKKTLSFMEKIKLKKQKEKENEE 569

Query: 2011 KAKHDDGDIVEEPVDYSKANILASDNREVKKKD 2109
            K+K        +P   +  N+  +  +EVK++D
Sbjct: 570  KSKTTQSIPTNDPTPKTVENV--NTLQEVKQED 600

>TPHA0H01040 Chr8 (223391..223765) [375 bp, 124 aa] {ON} Anc_5.99
            YGR230W
          Length = 124

 Score = 32.0 bits (71), Expect = 2.1
 Identities = 17/64 (26%), Positives = 31/64 (48%)
 Frame = +1

Query: 1735 HPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHN 1914
            HP HA+K +N  +    ++ L+D++ S     L   SK +N           + T+ T N
Sbjct: 50   HPSHAIKKYNSKSEKQNKNNLRDKFASPTDRLLSPCSKKLNDHKSKLFKVNSVPTKLTFN 109

Query: 1915 KKSD 1926
            +K++
Sbjct: 110  QKNE 113

>KLLA0D02068g Chr4 (177264..178481) [1218 bp, 405 aa] {ON} conserved
           hypothetical protein
          Length = 405

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 2/116 (1%)
 Frame = +1

Query: 4   SSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKS--MKSMASVMNNILLS 177
           SS S D     V ET   ++   S+  + H     ++   +  S  M   + V+N  ++ 
Sbjct: 143 SSSSYDGNRNDVRETSTVASTTISRKEKNHMLFTRNILPFIRDSINMYKNSHVLNEEVVP 202

Query: 178 IDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFL 345
           I+   +K    +   +E C+ FSNV+  L      ++  LNR+      ++ M +L
Sbjct: 203 IEKELDKFYDNSLKKDEKCEVFSNVLLGLLRVQRLNIAALNRELELKTVERKMDYL 258

>TBLA0H02840 Chr8 (664282..665604) [1323 bp, 440 aa] {ON} 
          Length = 440

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 10/101 (9%)
 Frame = +1

Query: 112 VANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLD 291
           +AN+ E +  S+    N +L    NNN+ +   NEN+E+      NV     E+ +  L 
Sbjct: 325 IANADEMNELSIQMHENELLKDNSNNNDMVINANENVEDTTLPVENV-----EEEEEQLI 379

Query: 292 ILNRKSSTNDN----------KKNMQFLDDVNVAENDPSRR 384
           + N +   ND+          KK+ Q   D +V + D  R+
Sbjct: 380 VDNTEQIVNDDSEYKDQKLQQKKDDQKKKDDSVKDLDSKRK 420

>Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa] {ON}
            YLR106C (REAL)
          Length = 4909

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 11/95 (11%)
 Frame = +1

Query: 181  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLD--ILNRKSSTNDNKKNM-QFLD- 348
            D +N + +  NEN +E  +E    +D L E    ++D  + + K+S N  +K+  Q LD 
Sbjct: 4122 DLSNGEDENENENSDEEEEELDEEIDDLNEDDPNAIDDKMWDEKASENSKEKDTDQNLDG 4181

Query: 349  -----DVNVAENDPSRRISKPQ--LNFKTPVDNSE 432
                 DV  AEND  ++ +K +   N  TP D  E
Sbjct: 4182 KDQKEDVQAAENDEQQQENKEEGKENSNTPDDGDE 4216

>KAFR0H00100 Chr8 complement(6753..8135) [1383 bp, 460 aa] {ON} 
          Length = 460

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 39/146 (26%), Positives = 66/146 (45%), Gaps = 5/146 (3%)
 Frame = +1

Query: 1741 EHAVKYH---NGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETH 1911
            ++A K H   N    S E+++  D+ + + +      SK      E S S+   + +   
Sbjct: 59   KNAPKNHVDFNKKETSNEQADSDDKLVEHSEPEANHKSKKGKHQDEDSTSDLKSK-KHAK 117

Query: 1912 NKKSDQIQVIPEKQEDMDEIVVLK--KKKIHSNDQKAKHDDGDIVEEPVDYSKANILASD 2085
            +K ++  +     ++D++EI   K  KK  H+N +  KH + D VEE     +A   A  
Sbjct: 118  SKDAETSEHKKHGEKDVEEIKAKKEAKKAAHANSEHKKHGEKD-VEEIKAKKEAKKAAHA 176

Query: 2086 NREVKKKDKKRVFDPYSSTGEGPKAA 2163
            N E KK  +K V +   +  E  KAA
Sbjct: 177  NSEHKKHGEKDV-EEIKAKKEAKKAA 201

>TDEL0A05820 Chr1 complement(1024897..1026327) [1431 bp, 476 aa]
           {ON} Anc_8.636 YOR216C
          Length = 476

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 54/224 (24%), Positives = 91/224 (40%), Gaps = 25/224 (11%)
 Frame = +1

Query: 19  DNVLKKV--METVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNN-------IL 171
           +N+L ++  M+TV +    + +++E  K    S   S    +KS A +++         +
Sbjct: 130 NNLLNRISSMKTVFSKMKESQEELETVKE-QLSEYESQNIRLKSKADLLSKERTEFEKTI 188

Query: 172 LSIDNNNEKLDGTNENLEEVCKEFSNVMDVLF----EKADRSLDILNRKSSTNDNKKNMQ 339
           L+++     LD   ENL+  CK++   +D L     E +D  L  LN     N   +   
Sbjct: 189 LTLNEEFSNLDEERENLQIECKKYKEELDKLTNQLEEASDNHLRELNIHREANAQLEAQ- 247

Query: 340 FLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEE-STQLVLAT 516
            L ++ V   +  + +S      K  +   ES+      IEK +  K+I E   +L  AT
Sbjct: 248 -LQELVVTLGNNKQDLSILNEEKKDLISTLESN-----AIEKDSLQKTINELEAELEKAT 301

Query: 517 EDIPEHFQQPY-----------EYEILNQEYNNDILEKKEPIPS 615
               E  QQ +           + E  N E    I + KE I S
Sbjct: 302 AQFEEEKQQKHMEINALRAQLDKSEDSNSELTKTIEQHKEEIQS 345

>NDAI0B01500 Chr2 (352911..354458) [1548 bp, 515 aa] {ON} Anc_2.573
           YMR023C
          Length = 515

 Score = 33.5 bits (75), Expect = 2.4
 Identities = 24/78 (30%), Positives = 41/78 (52%)
 Frame = +1

Query: 97  SIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKA 276
           S D      + K++KS+ S   ++L+ ID + EK     E  EE+    +N++++   + 
Sbjct: 320 STDIIEKMGIAKALKSIKSSDVSLLI-IDISEEK----EEEEEEITNAINNLIELSEAED 374

Query: 277 DRSLDILNRKSSTNDNKK 330
            RS+ ILN+K   ND  K
Sbjct: 375 KRSMIILNKKDLVNDEDK 392

>NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {ON}
           Anc_1.162 YKL179C
          Length = 684

 Score = 33.5 bits (75), Expect = 2.5
 Identities = 41/183 (22%), Positives = 77/183 (42%), Gaps = 29/183 (15%)
 Frame = +1

Query: 244 SNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVD 423
           S V++V  EK   SL+  +RK    + KK  +  DD  +A+      ++K   +++  VD
Sbjct: 27  SKVLEVK-EKETSSLE--SRKFLATETKKFKKLQDDEKLAQ------LNKIIKHYQHEVD 77

Query: 424 N-------------------SESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQP 546
           N                   SE+   KPLL    + L  IE+S  L      + +   + 
Sbjct: 78  NLTQRSKFSEDIVIEVYSRLSEAPDPKPLLQNSIDKLSKIEDSKALKEKIAHLEDSLAKY 137

Query: 547 YEYE-----ILNQEYNNDI-----LEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKS 696
            +Y+     +L+ E N+ +     +  KE   +++W +    W D  N L   +  L+ +
Sbjct: 138 ADYDTMKSRLLDLEQNSAVTLSKRITAKEQELNSTWEEKERNWKDRENELNKQLNSLQMT 197

Query: 697 SEI 705
           +++
Sbjct: 198 NKV 200

>Kpol_520.16 s520 complement(36589..37230) [642 bp, 213 aa] {ON}
           complement(36589..37230) [642 nt, 214 aa]
          Length = 213

 Score = 32.7 bits (73), Expect = 2.6
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 9/89 (10%)
 Frame = +1

Query: 19  DNVLKKVMETVRASNALASQ-----DVEFHKSIDTSVANSLEKSMKSMASVMNNILLSID 183
           DN  KK+ E +   N   S            +ID   A   ++  KS    +NN++  ++
Sbjct: 115 DNEAKKMKEEIDLKNGSGSSAGINTKKVVEATIDPYAARDFQEEEKSKYKELNNLIKWVE 174

Query: 184 NNN--EKL--DGTNENLEEVCKEFSNVMD 258
           NNN  E +  + TN  L++ C E  N ++
Sbjct: 175 NNNYIESILQNNTNSILQQNCNEDINYIE 203

>Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 33.5 bits (75), Expect = 2.6
 Identities = 52/242 (21%), Positives = 97/242 (40%), Gaps = 4/242 (1%)
 Frame = +1

Query: 31   KKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGT 210
            K++ E       L S      +  D S+ + L++        +NN       N + L+  
Sbjct: 386  KRIKELNTEIKVLNSNQKILQEKFDDSITD-LDQLKNEHEKTVNNF----QRNEKLLNEK 440

Query: 211  NENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRIS 390
            N  LE + +E S  ++ L E   +  D+ +  +  ND   ++    D    E +  +   
Sbjct: 441  NVELENMKEELSINLEKLSESQVKINDLNSCVAQLNDKIGDIHNTLDCKEDELNNLKLSL 500

Query: 391  KPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQ 570
            K  L+     D+++       LI + N L S + S Q            Q+  +   LN 
Sbjct: 501  KETLSMSKDFDDAD-------LITQLNELISTKNSLQ------------QKINDLGSLND 541

Query: 571  E----YNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRS 738
            +     N+++ E K         +T ++    INSL D + ELKK     +DL+  +F++
Sbjct: 542  DNLKSLNDELKENK---------NTLSLKDSEINSLNDEINELKKQ----IDLKDEEFKT 588

Query: 739  YY 744
            ++
Sbjct: 589  WH 590

>KLLA0E21517g Chr5 complement(1920040..1922616) [2577 bp, 858 aa] {ON}
            similar to uniprot|Q756L3 Ashbya gossypii AER241W
            AER241Wp and weakly similar to YDR356W uniprot|P32380
            Saccharomyces cerevisiae YDR356W SPC110 Inner plaque
            spindle pole body (SPB) component ortholog of human
            kendrin involved in connecting nuclear microtubules to
            SPB interacts with Tub4p-complex and calmodulin
            phosphorylated by Mps1p in cell cycle-dependent manner
          Length = 858

 Score = 33.5 bits (75), Expect = 2.6
 Identities = 41/202 (20%), Positives = 78/202 (38%), Gaps = 16/202 (7%)
 Frame = +1

Query: 31   KKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI---------- 180
            ++  ET+R SN    Q+ +      +++ N  +K +  + S  N++L             
Sbjct: 582  RRKYETIRRSNEELLQEGKDQSGQLSNILNEKDKEILQLQSRFNSLLTEKNSLLNELSKV 641

Query: 181  ----DNNNEKLDGTNENLEEVCKEFSNVMDV--LFEKADRSLDILNRKSSTNDNKKNMQF 342
                D+  E+L      LE + KEF  + D     E ++ + DILN K  +       +F
Sbjct: 642  RSHKDDYKEELKKNQSRLEFITKEFVKLKDASKQAENSEDAKDILNNKWYSKYQSMKDKF 701

Query: 343  LDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATED 522
            L ++   + D +  + K  L  K                  PN+   +   T      +D
Sbjct: 702  LGELKSLQ-DENLELQKSLLKQKA----------------NPNSTAEVFSKTTEKGTLKD 744

Query: 523  IPEHFQQPYEYEILNQEYNNDI 588
              ++++  Y  E+   + NND+
Sbjct: 745  EIDYYRLKYANEV---KQNNDL 763

>CAGL0M13871g Chr13 complement(1370295..1373570) [3276 bp, 1091 aa]
            {ON} highly similar to uniprot|P32337 Saccharomyces
            cerevisiae YMR308c PSE1 beta karyopherin
          Length = 1091

 Score = 33.5 bits (75), Expect = 2.7
 Identities = 54/299 (18%), Positives = 127/299 (42%), Gaps = 21/299 (7%)
 Frame = +1

Query: 61   NALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNIL-LSIDNNNEKLDGTNENLEEVCK 237
            N L S  +   +   T++A   E + K      + ++ L ++    + D +N  L+  C 
Sbjct: 500  NLLQSNKLYVQEQALTTIAFIAEAAEKKFIKYYDTLMPLLLNVLKVESDDSNSVLKGKCI 559

Query: 238  EFSNVMDVLFEK---ADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNF 408
            E + ++ +   K   ++ S++++   +           L    + ++DP +   +   + 
Sbjct: 560  ECATLIALAVGKQKFSEHSVELITLLAG----------LQSSTIQDDDPLKSYLEHGWSR 609

Query: 409  KTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQE----- 573
               +   E  P  P++I  P  L++ + +  + L  E+   +FQQ  E++I+  +     
Sbjct: 610  VCRILKEEFVPLLPMVI--PPLLETAKATQDVSLIEEEDAANFQQYSEWDIVQIQGKHIA 667

Query: 574  YNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYYGLV 753
             +  IL+ K        V    +  +  + ++++M E+   S   +D   HD     G  
Sbjct: 668  IHTSILDDKVTAMELLQVYCTVLRNNFASYVKEVMTEIAVPS---LDFYLHDGVRATGAG 724

Query: 754  CLMQISTRTQDYIVDTIALRDD----------LKMLNEVFTNPL--ITKVFHGAFMDII 894
             +  + +     ++ T+ L+++           K+++ + T P+  IT+++H AF+D I
Sbjct: 725  LIPNLLSA----LISTVGLQNEQVLQLWNLAATKLIHGITTEPMPEITQIYHSAFVDCI 779

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
           RNA-binding protein that associates with mRNAs encoding
           cell wall proteins in high-throughput studies; deletion
           mutants display increased sensitivity to some cell wall
           disrupting agents; expression negatively regulated by
           cAMP
          Length = 1134

 Score = 33.5 bits (75), Expect = 2.7
 Identities = 35/135 (25%), Positives = 56/135 (41%)
 Frame = +1

Query: 160 NNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQ 339
           NNIL  +      L     NL+ VC  +       F +++   +       TN +     
Sbjct: 279 NNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISA 338

Query: 340 FLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATE 519
            L   N+A  D +R I    + FK+PV+ S+    K   +++    + I ES  LV    
Sbjct: 339 SLHH-NIANKDATRSII---IEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLV--NT 392

Query: 520 DIPEHFQQPYEYEIL 564
           D+P + Q P  Y +L
Sbjct: 393 DVPSN-QFPENYAVL 406

>NDAI0H01040 Chr8 complement(230960..235222) [4263 bp, 1420 aa] {ON}
           
          Length = 1420

 Score = 33.5 bits (75), Expect = 2.8
 Identities = 45/188 (23%), Positives = 76/188 (40%), Gaps = 34/188 (18%)
 Frame = +1

Query: 160 NNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLD---------------I 294
           NN   +  +N  +LD  +ENL     +  + +D    + D ++D               I
Sbjct: 151 NNTSANQHDNPSQLDQDDENLRRAILQSLHGLDTQNNENDINMDNQDEHHHQTDNMEKII 210

Query: 295 LNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLN-FKTPVDNSESHPFKPLLIEKPN 471
           +  K S + NKK+ +     N A+ D   +  K + +  K   D  +S   +P  IE+PN
Sbjct: 211 VTDKPSKDKNKKDKK---KKNKAKKDKKHKDKKDKKHKEKKQKDKQKSKSIEP--IEEPN 265

Query: 472 ALKSIEESTQLVLATEDIP-----------------EHFQQPYEYEIL-NQEYNNDILEK 597
            L   E+  +  +  E  P                 E   + +E E+L N E N D+ E+
Sbjct: 266 DLIDFEDVIKGFMQQEQTPNGQSSSEVEDAETQALVEATLRAFENELLANPEGNADLEEE 325

Query: 598 KEPIPSTS 621
            +P  S+S
Sbjct: 326 GQPPSSSS 333

>Kpol_1036.97 s1036 complement(248945..254815) [5871 bp, 1956 aa] {ON}
            complement(248945..254815) [5871 nt, 1957 aa]
          Length = 1956

 Score = 33.5 bits (75), Expect = 2.9
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +1

Query: 1825 ATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSN 2004
            A + +A   +N   E SN    L+TEE ++ + +Q +   E++ED D+           N
Sbjct: 37   AAIKSAGSGLNDSAEESNDTNNLDTEENNDNEEEQEE--EEEEEDDDD---------EDN 85

Query: 2005 DQKAKHDDGDIVEEPVD 2055
            D+ A  DD +  +E  D
Sbjct: 86   DEDADEDDDEDEDEDED 102

>TBLA0I02620 Chr9 complement(605456..614956) [9501 bp, 3166 aa] {ON} 
          Length = 3166

 Score = 33.5 bits (75), Expect = 2.9
 Identities = 24/102 (23%), Positives = 45/102 (44%)
 Frame = +1

Query: 1765 GSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIP 1944
            G+A +   SE      S  + ++++A+ N  +     N +   +T  + N+ S +I +IP
Sbjct: 2751 GNAGNKRVSESGTSGNSNKRKSMISANNNSTLTSGPKNKD---KTNTSSNRLSKRISIIP 2807

Query: 1945 EKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKAN 2070
              +       + KK+    + QK+   DG I  +P    K N
Sbjct: 2808 NLKRKSTNDTISKKRDSRDSKQKSVQSDGTIKVQPKKKVKPN 2849

>KLLA0F21164g Chr6 complement(1973018..1974280) [1263 bp, 420 aa] {ON}
            conserved hypothetical protein
          Length = 420

 Score = 33.1 bits (74), Expect = 2.9
 Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 2/101 (1%)
 Frame = +1

Query: 1900 EETHNKKSDQIQVIP--EKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANI 2073
            +  H+ K D  +  P  EK++  DE    K +K HS D+K +  D    ++P D  K   
Sbjct: 221  DREHDDKGDDEKKQPKDEKKQPKDEKKHSKDEKKHSKDEKKQPKDEK--KQPKDEKKH-- 276

Query: 2074 LASDNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKK 2196
             + D ++  K +KK+  D    + +  K +K  +  +K +K
Sbjct: 277  -SKDEKKQPKDEKKQPKDEKKHSKDEKKHSKDEKKHSKDEK 316

 Score = 33.1 bits (74), Expect = 2.9
 Identities = 27/99 (27%), Positives = 48/99 (48%)
 Frame = +1

Query: 1900 EETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILA 2079
            +E  + K ++ Q   EK++  DE    K +K HS D+K KH   D  ++P D  K    +
Sbjct: 272  DEKKHSKDEKKQPKDEKKQPKDEKKHSKDEKKHSKDEK-KHSK-DEKKQPKDEKKH---S 326

Query: 2080 SDNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKK 2196
             D ++  K +KK   D    + +  K +K  +  +K ++
Sbjct: 327  KDEKKHSKDEKKHSKDEKKHSKDEKKHSKDEKKHSKDEE 365

 Score = 31.6 bits (70), Expect = 8.9
 Identities = 25/99 (25%), Positives = 45/99 (45%)
 Frame = +1

Query: 1900 EETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILA 2079
            +E  + K ++     EK++  DE    K +K HS D+K +  D    ++P D  K    +
Sbjct: 244  DEKKHSKDEKKHSKDEKKQPKDEKKQPKDEKKHSKDEKKQPKDEK--KQPKDEKKH---S 298

Query: 2080 SDNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKK 2196
             D ++  K +KK   D      +  K +K  +  +K +K
Sbjct: 299  KDEKKHSKDEKKHSKDEKKQPKDEKKHSKDEKKHSKDEK 337

>SAKL0H06952g Chr8 complement(609523..610884) [1362 bp, 453 aa] {ON}
            similar to uniprot|Q12080 Saccharomyces cerevisiae
            YPL146C NOP53 Nucleolar protein involved in biogenesis of
            the 60S subunit of the ribosome interacts with rRNA
            processing factors Cbf5p and Nop2p null mutant is viable
            but growth is severely impaired
          Length = 453

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 46/216 (21%), Positives = 90/216 (41%), Gaps = 29/216 (13%)
 Frame = +1

Query: 1627 IELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPE----------HAVKYHNGSAC 1776
            I L   + KE+ ++L +  KS    + + V  E + H            HA K +N SA 
Sbjct: 171  IRLNVESEKEVPHELLK--KSSTGWSIAKVAPETIKHAPVKVKEMEKIPHAGKSYNPSAS 228

Query: 1777 S---VEESELKDRYLSYIKATLLAASKN-INMVLETSNSNAPLETEETHNKKSDQIQVIP 1944
                + + E K   ++  +   +   K+ I  ++ET + N   E E+  ++ S       
Sbjct: 229  DWSKLIDKEYKTEKVNEERRIQMQQYKDKIIHLMETLDDNEEEEDEDEDDESSSSDNEAD 288

Query: 1945 EKQEDMDE------------IVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDN 2088
             K+ D+DE             V L+KK  +  +++ +H+D   +++ +   K  +   + 
Sbjct: 289  NKESDLDEENVEKISLSINQPVKLRKKTKYQRNKQKRHEDKIKLQQELKNLKEQLRGLEK 348

Query: 2089 -REVKKK--DKKRVFDPYSSTGEGPKAAKKRRLVTK 2187
              E+++K  ++          G+  K  KK +L TK
Sbjct: 349  LEEIEQKVIEEHDTKQKNKDAGKPSKVHKKHKLGTK 384

>Kwal_26.7819 s26 (524735..525535) [801 bp, 266 aa] {ON} YKL095W
            (YJU2) - Product of gene unknown [contig 55] FULL
          Length = 266

 Score = 32.7 bits (73), Expect = 3.1
 Identities = 38/156 (24%), Positives = 69/156 (44%), Gaps = 21/156 (13%)
 Frame = +1

Query: 1795 LKDRYLSYIKATLLA-----ASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQED 1959
            L +RYL  IK   L+      +  I+   +  + +  +ET    N  S+       K E 
Sbjct: 71   LAERYLDTIKQYRLSIKCPRCNNMISFRTDPKSGDYVMETGGVKNFVSEDANNDGSKTET 130

Query: 1960 MDEIVVLKKKKIHSNDQK-AKHDDGDIVE-----------EPVDYSKANILASDN-REVK 2100
            +DE +   +K+ H  ++K +K D GD +E           E  DY +   L  DN  +++
Sbjct: 131  LDETLQRLEKQQHDENKKISKGDQGDKLEQIEKRLSKMQQEQEDYEQLEALRKDNLSKMR 190

Query: 2101 KKDKKRVFDPYSSTGEG---PKAAKKRRLVTKGKKI 2199
            K ++ R  +  +S  +     K+A+K  L  + ++I
Sbjct: 191  KAEQLRKEEQQASREKALRDEKSAEKAFLQFRDQEI 226

>Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar to
            Ashbya gossypii ACL144C
          Length = 513

 Score = 33.1 bits (74), Expect = 3.1
 Identities = 23/88 (26%), Positives = 38/88 (43%)
 Frame = +1

Query: 1852 INMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDG 2031
            I   ++  N N P E  E H +   +     + +++ DE    KK+K    ++K K +  
Sbjct: 427  IQEAIDLFNKNRPQEEVEEHQESPKEKSKKRKLEDNKDEEKKRKKEKKEKKEKKDKKEQS 486

Query: 2032 DIVEEPVDYSKANILASDNREVKKKDKK 2115
            D   + V   K +    D +E K K KK
Sbjct: 487  DEKVKKVKKDKKD--KKDKKEKKDKKKK 512

>Kpol_1024.43 s1024 (115961..117595) [1635 bp, 544 aa] {ON}
           (115961..117595) [1635 nt, 545 aa]
          Length = 544

 Score = 33.1 bits (74), Expect = 3.2
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 7/103 (6%)
 Frame = +1

Query: 118 NSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENL-------EEVCKEFSNVMDVLFEKA 276
           N+ EKS+ +MAS  N     I   NEK++   ++L          CKE   + + + +++
Sbjct: 295 NNKEKSLNAMASEFNTFSNMITLENEKINTEIQDLFAKVRDMSSRCKEILQLQNQILDQS 354

Query: 277 DRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLN 405
           +      N K S  D  +N+     +++ E   S  ISK ++N
Sbjct: 355 ETKAIDSNAKESKIDQNQNL----IIHLDEKQAS-HISKERMN 392

>KAFR0J02690 Chr10 (514853..515728) [876 bp, 291 aa] {ON} Anc_3.533
            YER035W
          Length = 291

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 25/111 (22%), Positives = 50/111 (45%)
 Frame = +1

Query: 1816 YIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKI 1995
            YI ++ L    + N      N++      E  +++ ++   +P+   + +     K    
Sbjct: 7    YINSSRLLPVHSKNKPSNNLNNHKKFIRAEKQSREKNETVPLPQSLPNGE-----KPNFG 61

Query: 1996 HSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGE 2148
            HSN +K+K   G   E+ +  S  N++   ++  KK  KK++F P S+  E
Sbjct: 62   HSNGKKSKKK-GKAKEDELSASLKNLVLDKSQSTKKATKKKLFSPKSNHQE 111

>TBLA0A06330 Chr1 complement(1555490..1557406) [1917 bp, 638 aa]
           {ON} Anc_4.268 YDL074C
          Length = 638

 Score = 33.1 bits (74), Expect = 3.3
 Identities = 53/223 (23%), Positives = 92/223 (41%), Gaps = 28/223 (12%)
 Frame = +1

Query: 13  SGDNVLKKVM----ETVRASNALASQDVEF---HKSIDTSVANSLEKSMKSMASVM---N 162
           +GD+ LKK +    E  +  + L ++       H+SI T +     K+ +   + M   +
Sbjct: 377 TGDDALKKELQDLEEAFKELSNLTNKKYSHLLNHESIITKLNVEKTKADQKYFAAMRSKD 436

Query: 163 NILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDIL--NRKSSTNDNKKNM 336
           +IL+   N ++ L+ +NE + ++ K+   ++   F   ++ L+    N K     NKKN 
Sbjct: 437 SILIENKNLSKSLNKSNELIIQL-KDSDRLLQQKFSNLNQQLETSQNNEKKLMISNKKNN 495

Query: 337 QFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEEST--QLVL 510
             L D+    N  ++R+                       I K   LKSI+EST  QL L
Sbjct: 496 LKLIDLESQLNKLNKRLE----------------------ILKDENLKSIKESTHLQLEL 533

Query: 511 ATEDIP--------EHFQQPYE------YEILNQEYNNDILEK 597
            T+D+          H Q   E      Y   +   NN ++E+
Sbjct: 534 QTKDLESKKAKTKINHLQSKLERLEKSLYSTNDNSPNNQLIEE 576

>KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {ON}
           Anc_1.162 YKL179C
          Length = 690

 Score = 33.1 bits (74), Expect = 3.4
 Identities = 46/233 (19%), Positives = 92/233 (39%), Gaps = 17/233 (7%)
 Frame = +1

Query: 82  VEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDV 261
           V   K +DT+V   LE   K  +S+ +   L+ +    K   ++E L +V K        
Sbjct: 19  VSLQKELDTNV---LEVKDKEQSSLESRKALATETKRFKKLESDEKLSQVNK-------- 67

Query: 262 LFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHP 441
           + ++  + +D L ++S  ++                         Q+ F      SE+  
Sbjct: 68  IIKQYQQEIDNLTKRSKFSE-------------------------QILFSIYAKLSEAPD 102

Query: 442 FKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYE-----ILNQEYNNDI-----L 591
            KPL+    + L  I++S +L    ED+ +   +  +YE     +L+ E N  I     L
Sbjct: 103 PKPLIQNSLSRLSKIDDSKELKEKVEDLEDKLTKYADYESLKSRLLDLEQNAAITLSKRL 162

Query: 592 EKKEPIPSTSWVDTNAIW-------VDNINSLQDMMQELKKSSEIAVDLEHHD 729
             KE   ++ W +    W          ++++Q+  + L+      +D++ H+
Sbjct: 163 AAKEQEITSIWEEKQRNWKQREAELTKQVDTVQENNKMLEAKISKQLDIDSHE 215

>Kpol_1037.42 s1037 complement(101878..104220) [2343 bp, 780 aa] {ON}
            complement(101878..104220) [2343 nt, 781 aa]
          Length = 780

 Score = 33.1 bits (74), Expect = 3.4
 Identities = 42/211 (19%), Positives = 85/211 (40%), Gaps = 15/211 (7%)
 Frame = +1

Query: 1612 LPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEIL---------------LHPEH 1746
            LP+ +I +     +EI N   +  KSK       V+ + L               ++ +H
Sbjct: 293  LPTQQILVARFKTEEILNDSLEVLKSKYDSNVDPVIKDKLKLIQELSVLKTECLDMYDQH 352

Query: 1747 AVKYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSD 1926
            A KY +       +      YL +++         I + +++ + +  L+  E  N +S 
Sbjct: 353  ASKYVSAVYLEKRDELEAKIYLKFLET--------ITLFIDSVSQDIFLQLVEDVNSESS 404

Query: 1927 QIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKK 2106
            +  +                K++ ++ + AK    DI+EE   ++ A IL+    EVK++
Sbjct: 405  KEPIF--------------SKRLSNSTEVAKSKFEDIIEE---FAAAKILSE---EVKEE 444

Query: 2107 DKKRVFDPYSSTGEGPKAAKKRRLVTKGKKI 2199
              KR  +    T +  +    ++L+T+  KI
Sbjct: 445  VVKRFENDLKETSDKLRVTALQKLITRSSKI 475

>Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195W
           (REAL)
          Length = 829

 Score = 33.1 bits (74), Expect = 3.5
 Identities = 45/222 (20%), Positives = 96/222 (43%), Gaps = 1/222 (0%)
 Frame = +1

Query: 52  RASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEV 231
           R +  L  Q    ++ ++T ++ +  +S+      +N       N+ + +D +NE +E++
Sbjct: 319 RRNEELTDQIYHLNQKVNTLISQN--ESISFQYEKLNK------NHQQLIDSSNEKVEKL 370

Query: 232 CKEFSNVMDVLFEKADRSLDILNRKSST-NDNKKNMQFLDDVNVAENDPSRRISKPQLNF 408
             E  N +  + EK  + +  LN +    N N+K +Q   D ++ + +          N 
Sbjct: 371 STERENNISKV-EKFKKRIKELNTEIKVLNSNQKILQEKYDDSITDLN----------NL 419

Query: 409 KTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDI 588
           ++  +N+       L I + N     E++ +L    E++  +  +  EY+ +  E N+ I
Sbjct: 420 RSEHENT----VNTLHINEKNL---NEKNVELENVKEELRTNVDKLSEYQAMVNELNSCI 472

Query: 589 LEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVD 714
            E  + I S     TN +       L ++   LK++  I+ D
Sbjct: 473 TELNDKIES-----TNIVLKSKETELDNLKLSLKETLSISKD 509

>Kpol_423.10 s423 (18069..20648) [2580 bp, 859 aa] {ON}
           (18069..20648) [2580 nt, 860 aa]
          Length = 859

 Score = 33.1 bits (74), Expect = 3.5
 Identities = 30/115 (26%), Positives = 54/115 (46%)
 Frame = +1

Query: 16  GDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNE 195
           G+ VLK         N L       HKS+  + + SL+K   +  S+ NN++      ++
Sbjct: 574 GEYVLKDPFNIPGGKNLLNR-----HKSLKKNSSFSLKKIPSNGDSIDNNLM------DK 622

Query: 196 KLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 360
           KLD    ++ +  K+ S++ D+ F   D S DI+  K S +    ++  + D +V
Sbjct: 623 KLDKYIVDINKSIKKHSDIPDLHFVPPDNSSDIILPKRSQSLKYHDLSSILDSDV 677

>NDAI0B00390 Chr2 complement(70401..73115) [2715 bp, 904 aa] {ON} 
          Length = 904

 Score = 33.1 bits (74), Expect = 3.5
 Identities = 33/147 (22%), Positives = 62/147 (42%), Gaps = 5/147 (3%)
 Frame = +1

Query: 46  TVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLE 225
           T+   N L+ Q V+  K  D++  NS     K + S +  I  SID+ ++  + +  NL+
Sbjct: 131 TLEFKNVLSKQVVKNLK--DSTENNSSWNESKKLHSKLTQIAASIDHYSKSSNDSQNNLQ 188

Query: 226 EVCKEFSNVMDVLFEKAD----RSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRIS- 390
           +  +++   +  LFE  +      L +L     T     +   L+  N  E   ++ +  
Sbjct: 189 QANQQWDQEVPYLFELFENIDYNRLQLLKDCLLTYQTGFSDYLLNTTNQCETVMTKFLEF 248

Query: 391 KPQLNFKTPVDNSESHPFKPLLIEKPN 471
            P+         + ++ FKPLL    N
Sbjct: 249 DPEKEIDRFAQEATNYDFKPLLDHNKN 275

>NDAI0C00600 Chr3 (113989..116799) [2811 bp, 936 aa] {ON} Anc_2.590
          Length = 936

 Score = 33.1 bits (74), Expect = 3.5
 Identities = 29/124 (23%), Positives = 54/124 (43%), Gaps = 10/124 (8%)
 Frame = +1

Query: 1732 LHPEHAVKYHNGSACSVEESELKDRYLSYIKAT--LLAASKNINMVLETSNSNAPLET-- 1899
            L  +  +KY+   A   ++  +K+  L+  K     + A+ N  +  +T N    L+T  
Sbjct: 462  LERDSKIKYNTMLAQMEDQINVKNEELNTAKTVHGSILATSNQELKNQTVNGMNDLQTWF 521

Query: 1900 ------EETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYS 2061
                   E H    +Q  ++    +DM E+  L +K I   +  AK    DI+E+ +D  
Sbjct: 522  HSSDQRNEIHKMNQEQDLLLKPYYDDMKEVESLNEKLIEQCNDAAKKI--DILEKEIDVH 579

Query: 2062 KANI 2073
            + N+
Sbjct: 580  RLNL 583

>SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309C IMH1 Protein involved in vesicular transport
            mediates transport between an endosomal compartment and
            the Golgi contains a Golgi-localization (GRIP) domain
            that interacts with activated Arl1p-GTP to localize Imh1p
            to the Golgi
          Length = 963

 Score = 33.1 bits (74), Expect = 3.5
 Identities = 53/243 (21%), Positives = 112/243 (46%), Gaps = 22/243 (9%)
 Frame = +1

Query: 175  SIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNM-QFLDD 351
            S+  + +K DG+ E   +   + S  +D+L EK D    + N KS++ND   ++ +  ++
Sbjct: 619  SLKKDVKKNDGSLEQYIKENGKLSERLDILQEKYD---TLQNMKSNSNDQVDSIRRQCEE 675

Query: 352  VNVAENDPSRRI--SKPQLNFKTPV---DNSESHPFKPLLIEKPN----ALKSIEESTQL 504
            +NV   + ++RI   + +LN  T +      E++  + LL +  N     LK ++E   +
Sbjct: 676  LNVKLKESNKRILSLEDELNESTSILQERTRETNTMRRLLADSENDRGIKLKELQEKFAI 735

Query: 505  VL---------ATEDIPEHFQQPYEYEILNQEYNNDI--LEKKEPIPSTSWVDTNAIWVD 651
             L          T       ++  E   LN E  ++I  L  K        +      ++
Sbjct: 736  TLEEKSKLQSELTLQTSRKTREIQELRELNMELKSEIHTLNLK--------IKQQQSEIE 787

Query: 652  NINSL-QDMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKM 828
            +++S+ ++M ++   S+E + +L++        +  L +  +R++  I DT  + ++LK 
Sbjct: 788  HLSSVNRNMQRKSSASAESSGELDN-------VVSSLKEALSRSEKKIRDTENINEELKD 840

Query: 829  LNE 837
            LN+
Sbjct: 841  LNK 843

>Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W
            (REAL)
          Length = 1085

 Score = 33.1 bits (74), Expect = 3.6
 Identities = 29/154 (18%), Positives = 62/154 (40%), Gaps = 24/154 (15%)
 Frame = +1

Query: 1747 AVKYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLET--EETHNKK 1920
            A+ Y   S   +  SE      S +       S NIN     +++   +ET  +ETH K+
Sbjct: 626  ALYYAKNSLMGITNSEEIQLIESAMNNHRKKHSDNINSSSNDNDNEEDIETYNQETHGKR 685

Query: 1921 SDQIQ---------VIPEKQEDMDEIVV-------------LKKKKIHSNDQKAKHDDGD 2034
             +++Q         V P+ +++ D+  +             +K     +++ +   ++ D
Sbjct: 686  KEKLQSPILTSRRCVTPKIEDNDDDAGIPDLADDGLGDEYNVKNSIASNSNTRPAENEND 745

Query: 2035 IVEEPVDYSKANILASDNREVKKKDKKRVFDPYS 2136
             ++ P+D+ K   +   + E  K       +P+S
Sbjct: 746  AIQYPLDWKKRKAIVLQDEEKAKSVSPLTMEPHS 779

>TPHA0L02310 Chr12 complement(485671..488949) [3279 bp, 1092 aa] {ON}
            Anc_5.11 YMR308C
          Length = 1092

 Score = 33.1 bits (74), Expect = 3.6
 Identities = 40/168 (23%), Positives = 75/168 (44%), Gaps = 19/168 (11%)
 Frame = +1

Query: 442  FKPLL-IEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPST 618
            F PLL I  P+ L++ + +  + L  E+  E+FQQ  E+E++        ++ K     T
Sbjct: 619  FMPLLPIVLPSLLETAKATQDVSLIDEEEAENFQQYSEWEVVQ-------VQGKHIAIHT 671

Query: 619  SWVDTNAIWVDNINSLQDMMQEL------KKSSEIA---VDLEHHDFRSYYG-------L 750
            S +D     ++ I     M++ L      +  +EIA   +D   HD     G       L
Sbjct: 672  SVLDDKVTAMELIQVYSTMLKNLFAPYVKEILTEIAIPSIDFYLHDGVRATGANLIPVLL 731

Query: 751  VCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPL--ITKVFHGAFMD 888
             CL+       + ++    +  D K++  + + P+  IT+++H A +D
Sbjct: 732  SCLISAVGNENEEVLQLWKVAAD-KLIGGILSEPMPEITQIYHSALVD 778

>NCAS0G03690 Chr7 (684097..685146) [1050 bp, 349 aa] {ON} Anc_2.296
          Length = 349

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 32/112 (28%), Positives = 45/112 (40%), Gaps = 7/112 (6%)
 Frame = +1

Query: 214 ENLEEVCKEFSNVMD---VLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRR 384
           +  +EV K+F    +   VL E  D   D    +  TN+  KN+   DD+ V  N   + 
Sbjct: 123 DEFDEVLKQFRKDSEPELVLAEDEDDFYDSKEHEEKTNEIMKNLTHGDDLGVESNGSFKE 182

Query: 385 ISKPQLNFKTPVDNSESHPFKPL----LIEKPNALKSIEESTQLVLATEDIP 528
              P  NF   V       F  +     ++K   LKSI     LVL  E+ P
Sbjct: 183 EVIPPENFSHVVGQIYRSSFPRIENFDFLQKRLKLKSI-----LVLIPEEYP 229

>TBLA0C02100 Chr3 (499045..502470) [3426 bp, 1141 aa] {ON} Anc_4.276
            YLR410W
          Length = 1141

 Score = 33.1 bits (74), Expect = 3.6
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 23/173 (13%)
 Frame = +1

Query: 256  DVLFEKADRSLDILN-RKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSE 432
            + LF + + S D++N RK   +D+    + +D V        R+  KP  NF  P +  E
Sbjct: 702  NALFGEDEISSDVINIRKDLLDDSNAAKELMDKVKKRLKPLLRQHKKPSRNFSWPPEMPE 761

Query: 433  SHPFKPLLIEKPNALKSIEESTQLVLATEDI------------PEHFQQPYEYEILNQEY 576
             +     ++E  N  K +    +   A EDI            P  F++   +E L +E+
Sbjct: 762  PYTVVKRVVELMNFHKKV---LRYNFANEDIENIQARWCCGEDPALFKE--RWEKLFKEF 816

Query: 577  NNDILEKKEPIPSTSWVDTNAI----------WVDNINSLQDMMQELKKSSEI 705
             +  +EK +P   +   D+              V N N+ QD+ +E++K + +
Sbjct: 817  TS--VEKLDPSKISELYDSMKYDALHNREFLQLVFNPNNCQDVKEEIEKHASL 867

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 33.1 bits (74), Expect = 3.7
 Identities = 53/255 (20%), Positives = 104/255 (40%), Gaps = 40/255 (15%)
 Frame = +1

Query: 1552 KSINNRLPSSLDVSQD---ELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLS 1722
            K I +R+ S+    +D   E + L   ++ L     K + N++ ++ ++ +    S+  +
Sbjct: 443  KEIKDRISSNDSREKDLVLERRELEGTRVSLEERT-KNLANKIEKSERTSKCTKRSISEA 501

Query: 1723 EILLHPEHAVKYHNGSACSVEESELKD---------RYLSYIKATLLAASKNIN------ 1857
            E  L   H  +  +       ESE+KD           L  IK +L   +K+I+      
Sbjct: 502  EHTLKELHTQQTEH-------ESEIKDLNQLLEEERSVLDEIKLSLKDKTKDISTEIIQH 554

Query: 1858 --------MVLETSNSNAPLET------EETHNKKSDQIQVIPEK--------QEDMDEI 1971
                    + L+   S   L        EET +K    ++ + EK        QE  D I
Sbjct: 555  EKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKILARKAHKQELQDLI 614

Query: 1972 VVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEG 2151
            + LKKK     D++++ ++        ++S A++   + ++V    ++R  +  SS  E 
Sbjct: 615  LNLKKKLSSLRDERSQGEE--------NFSSAHLKLEEMQKVLNTHRQRAMEARSSLSEA 666

Query: 2152 PKAAKKRRLVTKGKK 2196
               +K    ++K +K
Sbjct: 667  QNKSKVLTALSKLQK 681

>Suva_14.43 Chr14 complement(68457..73385) [4929 bp, 1642 aa] {ON}
            YNL297C (REAL)
          Length = 1642

 Score = 33.1 bits (74), Expect = 3.7
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +1

Query: 1726 ILLHPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKN 1851
            I L+PEH   + N +ACS+E S L    L+++K  LL++S N
Sbjct: 1108 IKLYPEHFKDFKNNTACSMEWSIL----LNFMKKLLLSSSNN 1145

>NDAI0D01010 Chr4 complement(226976..228244) [1269 bp, 422 aa] {ON}
           Anc_2.240 YIL122W
          Length = 422

 Score = 32.7 bits (73), Expect = 3.9
 Identities = 31/143 (21%), Positives = 61/143 (42%), Gaps = 7/143 (4%)
 Frame = +1

Query: 199 LDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPS 378
           L+   +N+E++ +   N ++ + +K  +S D          N + ++ L  V    +DP 
Sbjct: 116 LEKERKNIEKIKETNLNTLNQIIDKCIQSDDF---------NARTIENL--VEFVASDPK 164

Query: 379 RRISKPQLNFKTPVDNSESHPFKPL-----LIEKPNALKSIEESTQLVLATEDIP--EHF 537
           +  + P++   TP   S +    P      + E P+ + S +++       +  P   H 
Sbjct: 165 KVKNIPKIPSLTPNKRSRTGSMSPRGHHKSISEIPSNISSQQQTASWFPPQQFQPYQPHI 224

Query: 538 QQPYEYEILNQEYNNDILEKKEP 606
            QPY Y   NQ+ N D   ++ P
Sbjct: 225 SQPYGYFDQNQQMNTDYGNQQRP 247

>ZYRO0F06974g Chr6 (568852..570165) [1314 bp, 437 aa] {ON} similar to
            uniprot|Q12080 Saccharomyces cerevisiae YPL146C NOP53
            Nucleolar protein involved in biogenesis of the 60S
            subunit of the ribosome interacts with rRNA processing
            factors Cbf5p and Nop2p null mutant is viable but growth
            is severely impaired
          Length = 437

 Score = 32.7 bits (73), Expect = 3.9
 Identities = 26/117 (22%), Positives = 56/117 (47%), Gaps = 5/117 (4%)
 Frame = +1

Query: 1852 INMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDG 2031
            I ++ ++   ++    EE  N++ ++     + +  M+E+V  KKK  +  ++  KH++ 
Sbjct: 260  IEVLGDSEEEDSDSSEEEEENEQEEEGSSNEDTRLSMNEVVKNKKKTKYQRNKAKKHEER 319

Query: 2032 DIVEEPVDYSKANI-----LASDNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVTK 2187
              ++E +   K+++     L    +EV+KK   +V        +  K  KK +L TK
Sbjct: 320  VKMQEELKRLKSHLRELEKLQDLEKEVEKKKPAKV--------QKTKKNKKHKLGTK 368

>Smik_12.236 Chr12 (453255..454718) [1464 bp, 487 aa] {ON} YLR175W
            (REAL)
          Length = 487

 Score = 32.7 bits (73), Expect = 4.1
 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 1/106 (0%)
 Frame = +1

Query: 1882 NAPLETEETHNKKSDQIQVIPEK-QEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDY 2058
            NA   T  TH  K  + +  P+K +E+ D ++    K++ +  ++AK DD    +E  D 
Sbjct: 391  NAEQSTSGTHETKKTEEE--PKKTKEEADSLI----KEVETEKEEAKEDDKKEKKEKKD- 443

Query: 2059 SKANILASDNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKK 2196
             K      D +E  KKDKK   D      +   A  + +   K KK
Sbjct: 444  KKEKKEKKDKKE--KKDKKEKKDKKEKKRKSEDAESEEKKSKKSKK 487

>KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.354
            YLR197W
          Length = 499

 Score = 32.7 bits (73), Expect = 4.1
 Identities = 37/152 (24%), Positives = 60/152 (39%), Gaps = 6/152 (3%)
 Frame = +1

Query: 1738 PEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNK 1917
            P++ + YH+G          K R   Y+      AS+  N   E SN    +  ++   +
Sbjct: 352  PKYGLIYHSGFIAKAAAKN-KGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQR 410

Query: 1918 KSDQIQVIPEKQEDM--DEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNR 2091
                    P  + ++   E + L K +   N    K +D D+ E+P   SK   L SD  
Sbjct: 411  LEFYATGKPTLKNELAIHEAMELYKSE---NPDAEKKEDADVEEKPAK-SKKRKLESDEE 466

Query: 2092 EVK----KKDKKRVFDPYSSTGEGPKAAKKRR 2175
            E +    KK+KK   D      +  +  +KRR
Sbjct: 467  EEEEEKPKKEKKEKKDKKEKKDKKERKTRKRR 498

>NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787
          Length = 523

 Score = 32.7 bits (73), Expect = 4.1
 Identities = 34/151 (22%), Positives = 66/151 (43%), Gaps = 5/151 (3%)
 Frame = +1

Query: 1738 PEHAVKYHNGSACSVEESELKDR-YLSYIKATLLAASKNINMVLETSNSNAPLETEETHN 1914
            P++ + YH   A  V ++  K++  ++ + A   A S   + + E  + +  +  E    
Sbjct: 337  PKYGLLYH---ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLE-ARA 392

Query: 1915 KKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPV----DYSKANILAS 2082
            K  +++  +  +       VV + KK+   + +A + D D V EP     +    +   S
Sbjct: 393  KVENRLSQLEGRDLRTTPKVVREAKKVEITEAQAYNADADTVAEPAASKSESGSDSDSDS 452

Query: 2083 DNREVKKKDKKRVFDPYSSTGEGPKAAKKRR 2175
            D+ E +KK+KK   D      +  K  KKR+
Sbjct: 453  DDEEEEKKEKKDKKDKKEKKDKKDKKDKKRK 483

>NCAS0G00410 Chr7 complement(69305..70990) [1686 bp, 561 aa] {ON}
           Anc_5.677 YOR073W
          Length = 561

 Score = 32.7 bits (73), Expect = 4.2
 Identities = 54/225 (24%), Positives = 86/225 (38%), Gaps = 13/225 (5%)
 Frame = +1

Query: 37  VMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNE 216
           + E V   + L+  D+++ + +   +  +LE  +   A     IL   DN       T E
Sbjct: 74  IQENVILRSKLSLTDIQYKEKLSQQI-QTLEDGV---AQRFEEILYIFDNIR-----TKE 124

Query: 217 NLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPS------ 378
           NL  V  + S+  D       R   ILN +  +  +  ++QF +     E          
Sbjct: 125 NLVGVSSDNSSTQD------SRLRSILNHRKRSRSST-SLQFNEITTTFEASTESNSDLV 177

Query: 379 ---RRISKPQLNFKTPVD----NSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHF 537
              RR S  + +   P D    N E  P     IEK N  +S+  S      T DIP   
Sbjct: 178 TKRRRKSSRRQSMFVPSDFAFPNDEDLP-----IEKRNEQESLSPSKSETYETNDIPVDE 232

Query: 538 QQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQD 672
               + + +N   NN+  + KE   +    +TN   V+  NS+ D
Sbjct: 233 VLKQQDKEMNAISNNE--DYKEDADNNHNTNTNENSVNFTNSITD 275

>YEL013W Chr5 (128825..130561) [1737 bp, 578 aa] {ON}
           VAC8Phosphorylated and palmitoylated vacuolar membrane
           protein that interacts with Atg13p, required for the
           cytoplasm-to-vacuole targeting (Cvt) pathway; interacts
           with Nvj1p to form nucleus-vacuole junctions
          Length = 578

 Score = 32.7 bits (73), Expect = 4.2
 Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 5/61 (8%)
 Frame = +1

Query: 166 ILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRS-LDILNRKS----STNDNKK 330
           IL  ++++N+K++   +N +++      + DV FE+  RS +D+ N  S    S+NDN  
Sbjct: 488 ILQLLESHNDKVEDLVKNDDDIINGVRKMADVTFERLQRSGIDVKNPGSNNNPSSNDNNS 547

Query: 331 N 333
           N
Sbjct: 548 N 548

>ZYRO0F11308g Chr6 (927860..929680) [1821 bp, 606 aa] {ON} similar to
            uniprot|Q05842 Saccharomyces cerevisiae YDL153C SAS10
            Component of the small (ribosomal) subunit (SSU)
            processosome required for pre-18S rRNa processing
            essential nucleolar protein that when overproduced
            disrupts silencing
          Length = 606

 Score = 32.7 bits (73), Expect = 4.3
 Identities = 25/91 (27%), Positives = 41/91 (45%)
 Frame = +1

Query: 1867 ETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEE 2046
            +TS +    E ++   ++ +  +   E   D+D+     K+   S   KAK +     EE
Sbjct: 332  QTSENEEEQEQDQEQGEEEEDEEEEEESDVDLDDFEEYVKQ---SRVSKAKPEKQSNTEE 388

Query: 2047 PVDYSKANILASDNREVKKKDKKRVFDPYSS 2139
            P DY +  I   D +E  KK +KR    Y+S
Sbjct: 389  PDDYMEEGIADIDAQE--KKARKRTLRFYTS 417

>Kpol_303.7 s303 complement(17437..19563) [2127 bp, 708 aa] {ON}
           complement(17437..19563) [2127 nt, 709 aa]
          Length = 708

 Score = 32.7 bits (73), Expect = 4.4
 Identities = 34/117 (29%), Positives = 57/117 (48%), Gaps = 15/117 (12%)
 Frame = +1

Query: 85  EFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVL 264
           +F +  D S+  S   S+ S  S +N      D++N+  D  NE+++   K+ +N ++++
Sbjct: 432 DFEEDGDESLLTSDLPSITSNNSKLNTSDNESDDDNDTND--NEDMDNDLKQ-NNPINII 488

Query: 265 FEKADRSLDI-------LNRKSST-----ND---NKKNMQFLDDVNVAENDPSRRIS 390
            +K +  LDI        N K ST     ND   NK+N   LDD + ++N  S   S
Sbjct: 489 NDKKNIILDIEIKSSGNKNTKKSTESKTLNDSQVNKENTTSLDDEDTSDNSKSLNTS 545

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
            to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
            Subunit (90 kDa) of TFIID and SAGA complexes involved in
            RNA polymerase II transcription initiation and in
            chromatin modification
          Length = 755

 Score = 32.7 bits (73), Expect = 4.5
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +1

Query: 1903 ETHNKKSDQIQVIPEKQEDMDEIVV-LKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILA 2079
            E+HN    ++   P  +E   E+   L++K   S+DQ  +H    +VEE   + + N ++
Sbjct: 285  ESHNSVPVKLGRFPIDEEFAKEVETELQRKDEQSDDQGGEHKQNSLVEE---FREMNKIS 341

Query: 2080 SDNREVKKKDKK 2115
             D +   + DKK
Sbjct: 342  RDEKSATEDDKK 353

>Suva_13.360 Chr13 (600046..602334) [2289 bp, 762 aa] {ON} YMR179W
            (REAL)
          Length = 762

 Score = 32.7 bits (73), Expect = 4.5
 Identities = 35/150 (23%), Positives = 65/150 (43%), Gaps = 1/150 (0%)
 Frame = +1

Query: 295  LNRKSSTNDNKKNMQFLD-DVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPN 471
            LN   S+N+   +    D  +++ ++D S+      +NF TP D   S           N
Sbjct: 606  LNAADSSNNTPCDNDTKDRKISIIDSDSSKA-QPMHMNFSTPADQLGSDN---------N 655

Query: 472  ALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVD 651
             + +I++ T L       PE  Q    +E+L +E   + L+K++ IPS+     N    +
Sbjct: 656  NIATIKKLTSL-------PEGQQIKRSHEVLEEEEEEEDLKKQKAIPSSPCGMYNYHQPE 708

Query: 652  NINSLQDMMQELKKSSEIAVDLEHHDFRSY 741
             I    DM++E    ++   D  +  F ++
Sbjct: 709  CIGLSDDMVKEQDFENDAESDKTNDLFSTF 738

>Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON}
            similar to Ashbya gossypii ADR400W
          Length = 790

 Score = 32.7 bits (73), Expect = 4.5
 Identities = 41/168 (24%), Positives = 67/168 (39%), Gaps = 17/168 (10%)
 Frame = +1

Query: 1546 EVKSINNRLPSSLDVSQDELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSE 1725
            E+KS N  L  +LD    +L  L    I         +E   T    ++    S   +S 
Sbjct: 224  ELKSANTELEEALDDKNRQLIKLKEDLISNKQDYENMLEEVNTYMEHTESVTESLNSMSN 283

Query: 1726 ILL-------HPEHAVKYHNGSACSVEESELK------DRYLSYIKATLLAASKNINMVL 1866
            +LL       H   A+K     AC +  + L        + LS +  T ++   +I +  
Sbjct: 284  LLLNKLDLADHERDALK----KACELGPNYLDIKINALSKTLSILVETYVSTKDSI-LKQ 338

Query: 1867 ETSNSNAP----LETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIH 1998
            +T  +N P     ET+++ N  S   QV PE   DMD  + +  + +H
Sbjct: 339  DTQAANQPEITSTETDDSSNNVSRNSQVHPEVSSDMDSQLEVAIENMH 386

>KNAG0J02710 Chr10 (506187..508745) [2559 bp, 852 aa] {ON} Anc_4.56
           YGL049C
          Length = 852

 Score = 32.7 bits (73), Expect = 4.6
 Identities = 31/136 (22%), Positives = 58/136 (42%), Gaps = 7/136 (5%)
 Frame = +1

Query: 301 RKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLL------IE 462
           R+S  +D + + +     N    D S R    + + + P D++ + P  P +      + 
Sbjct: 417 RRSKRDDRRDDRRS----NRPRRDRSERGGSQRGDDRRPFDDTPAEPVAPFVPTANRWVP 472

Query: 463 KPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTN-A 639
           K  A KS  E T+   A + + E F+QP     +    N   LEK +PI +      N +
Sbjct: 473 KSRAKKS--EETEKKFAPDGVTELFEQPEIERKMKSLLNKLTLEKFDPISAEILTLANLS 530

Query: 640 IWVDNINSLQDMMQEL 687
            W     +L  +++++
Sbjct: 531 KWESRCETLTTVIEQI 546

>CAGL0K07700g Chr11 complement(766120..768867) [2748 bp, 915 aa]
           {ON} similar to uniprot|P43573 Saccharomyces cerevisiae
           YFL023w
          Length = 915

 Score = 32.7 bits (73), Expect = 4.6
 Identities = 34/159 (21%), Positives = 66/159 (41%), Gaps = 5/159 (3%)
 Frame = +1

Query: 22  NVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKL 201
           ++LKK  +     N   S+D++ H+     + N  ++ + + A++ +      +   EKL
Sbjct: 424 SILKKGGKQKAKKNVGFSKDLQIHEVESFKMENKKQRHVFNPANLFDPESYGAETE-EKL 482

Query: 202 DGTNENLEEVCKEFSNVM-----DVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAE 366
           D  +   +     F+ ++     DVL EK +  +         N+N +  Q     N   
Sbjct: 483 DDPSSTADFDSDLFAELIGAKEADVLHEKYEEEI---------NENNRKQQEEKKANRVS 533

Query: 367 NDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKS 483
              + R SK + +FKT      ++  KP    K + L+S
Sbjct: 534 RFKATRQSKSKTSFKTAETGDTTNVNKPTEYTKKDLLES 572

>Smik_16.286 Chr16 complement(527077..530319) [3243 bp, 1080 aa] {ON}
            YPR042C (REAL)
          Length = 1080

 Score = 32.7 bits (73), Expect = 4.7
 Identities = 30/138 (21%), Positives = 60/138 (43%), Gaps = 6/138 (4%)
 Frame = +1

Query: 40   METVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNEN 219
            + +VR+SN+  +  ++ + +  T + N     M  + S  NN  +    N  +   +N N
Sbjct: 905  VSSVRSSNSRKNSVIQMNNAGPTPMLNFNSVPMSEINSYFNNQQMMYPGNQNQNQNSNSN 964

Query: 220  -LEEVCKEFSNVMDVLFEKADRSLDIL-----NRKSSTNDNKKNMQFLDDVNVAENDPSR 381
             ++E+  +F +    +    + SL I+     N +SS N N  N  +    ++  N  SR
Sbjct: 965  GIDELKSQFDSFK--IANGTNLSLPIINLPNTNHQSSGNSNNNNTVY----SMQSNSLSR 1018

Query: 382  RISKPQLNFKTPVDNSES 435
             +S    N     +N+ +
Sbjct: 1019 SVSHNNSNSNNNDNNNNN 1036

>Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON}
            (51386..54709) [3324 nt, 1108 aa]
          Length = 1107

 Score = 32.7 bits (73), Expect = 4.7
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +1

Query: 34   KVMETVRASNALASQDVEFHKSID-TSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGT 210
            ++ +  + +N  +S++++ HK++  +S  +  + S  S  +V NN   S +NNN K   T
Sbjct: 737  QITDEEKNNNKSSSKNMKKHKNVPISSNIHKNDNSNSSNRNVENNDNNSNNNNNNKNTNT 796

Query: 211  NENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRIS 390
            N+N  E  +E + V     +  +  LD +  +   N    + +  DD+  A    S   S
Sbjct: 797  NDNNNEEEEEENYVPPPPPKFINSKLDGVRSRLLFNPRSTSPKVDDDMGTAAAVLSNMRS 856

Query: 391  KP 396
             P
Sbjct: 857  SP 858

>NCAS0F00580 Chr6 (113589..117035) [3447 bp, 1148 aa] {ON} Anc_5.96
           YGR233C
          Length = 1148

 Score = 32.7 bits (73), Expect = 4.7
 Identities = 38/180 (21%), Positives = 73/180 (40%), Gaps = 25/180 (13%)
 Frame = +1

Query: 250 VMDVLFEKADRSLDILNRKSSTNDNKKNMQFLD--------------------DVNVAEN 369
           +M +L ++   +L+ L   SS++ +  ++++L                     D+N+   
Sbjct: 453 IMKLLLQEEQLTLESLPSSSSSSSSSSSLKYLSPLNVACQYNNFEAAELLLAADINLLNV 512

Query: 370 DPSRRISKPQLNFKTPVDNSESHPFKPLLIEK---PNALKSIEESTQLVLATEDIPEHFQ 540
             ++ ++   +  K   + + S     LLI+K   PNAL +  + T +  A +      Q
Sbjct: 513 SDTKGLTPLHIVAKNGTNETNSRKLVQLLIQKGANPNALDTFNKWTPIFYAIQ----RGQ 568

Query: 541 QPYEYEILNQEYNNDIL--EKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVD 714
           +    E+L    +  I   E + P+  T       IW  NI  L  ++  LKK S   +D
Sbjct: 569 REIVDELLKNGADLAIKDDENRSPLHLT-------IWESNIQVLNTLLPYLKKQSVPRID 621

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
            KEL1Protein required for proper cell fusion and cell
            morphology; functions in a complex with Kel2p to
            negatively regulate mitotic exit, interacts with Tem1p
            and Lte1p; localizes to regions of polarized growth;
            potential Cdc28p substrate
          Length = 1164

 Score = 32.7 bits (73), Expect = 4.7
 Identities = 41/200 (20%), Positives = 82/200 (41%), Gaps = 36/200 (18%)
 Frame = +1

Query: 118  NSLEKSMKSMASVMNNILLSIDNNNEKLDGTN-------------ENLEEVCKEFSNVM- 255
            +SLE  +  +  ++N+  L I+N NE +   N             E LEE+  E  N+  
Sbjct: 847  HSLEDKVNELEELVNSKFLDIENLNEVIQFQNEKIKSLELEPNYKEKLEELQIEHENLSR 906

Query: 256  --------------DVLFEKADRSLDILNRKSSTNDNKKNMQFLDD----VNVAENDPSR 381
                          D++   A+ S  + +  S   +N+ N  FL+     ++V++ +  +
Sbjct: 907  ENERLKNESKQHNEDIINNVANYSSQLGSLISHWKENRANSSFLESSSSLISVSDENGEK 966

Query: 382  RISKPQLNFKTPVDNSESHPFKPLLIEKPNALKS-IEESTQLVLATEDIPEHFQQPYEYE 558
             + +P           +S   + ++ +  N L   +E S +L ++ E +        EY 
Sbjct: 967  TVGEPY--------GDQSRHHRVVINKLTNRLDDLLERSQELTISKEKLSS------EYH 1012

Query: 559  ILNQEYNN---DILEKKEPI 609
             L  E+++   D+L K+  I
Sbjct: 1013 ALKMEHSSLSQDVLVKENEI 1032

>Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON}
            complement(7411..11517) [4107 nt, 1369 aa]
          Length = 1368

 Score = 32.7 bits (73), Expect = 4.8
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 1/107 (0%)
 Frame = +1

Query: 67   LASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTN-ENLEEVCKEF 243
            ++S DV+   S D    N   K +++  SV NNI+ S      + DG N EN   +    
Sbjct: 770  ISSGDVDVILSNDE---NGQIKRIENSNSVNNNIIAS---KKSETDGKNAENNNGIVNNN 823

Query: 244  SNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRR 384
             N  + +  K + ++DI+N  ++ +++K      D+ NVA +D + R
Sbjct: 824  DNNSNNI--KKNSNIDIMNPSNADSNHKAISNSTDNSNVASSDANLR 868

>Suva_9.79 Chr9 complement(139114..143580) [4467 bp, 1488 aa] {ON}
            YIL115C (REAL)
          Length = 1488

 Score = 32.7 bits (73), Expect = 4.8
 Identities = 66/311 (21%), Positives = 128/311 (41%), Gaps = 21/311 (6%)
 Frame = +1

Query: 10   DSGDNVLKKVMETVRASNALASQDVEFHKSID-TSVANSLEKSMKS----MASVMNNILL 174
            +S   + ++      +S   +SQ+    +  D +S +N+++    S     AS   N + 
Sbjct: 932  ESNKEISEEESSQEESSQEESSQEESNQEGSDVSSESNAVDSENTSEQVLSASSQENGIP 991

Query: 175  SIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDV 354
               N NEKL+  +E+ + V K         +    +S +  +      D +      +D 
Sbjct: 992  QNGNTNEKLETESEDSKHVAK---------YGDKPKSTEEASDIDENIDQQTQEGEQEDG 1042

Query: 355  NVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKS--IEESTQLVLATEDIP 528
            N  +ND +    +P+LN  T V   + H  +   + + +  +S   EES +   +T D  
Sbjct: 1043 NGLQNDDAE--EEPELN--TAVKEFQDHNSEEDAVSEQDTYQSNEAEESDEDNSSTNDRE 1098

Query: 529  EHFQQPYEYEILNQEYNNDILEKKEPIPSTS----WVDTNA-IWVDN---INSLQDMMQE 684
            E   + Y+     ++ N D L      P  +    + D+N    ++N    + +Q  + E
Sbjct: 1099 ESISESYD---KLEDINTDELPHGGEAPPVNDEERFADSNVQTSLENNYVESGIQTDLSE 1155

Query: 685  LKKSSEI---AVDLEHHDFRSYYGLVCLMQIST---RTQDYIVDTIALRDDLKMLNEVFT 846
            + + +E+   AV ++HH  ++    V    I T    T+++ V   A  DD   L E + 
Sbjct: 1156 ISQENEVQTDAVPVKHHYTQTVEKEVVDNDIQTEPIETRNFSVQ--AFEDDENYLAEQYK 1213

Query: 847  NPLITKVFHGA 879
               + K + GA
Sbjct: 1214 PKPLMKYYTGA 1224

 Score = 32.0 bits (71), Expect = 8.3
 Identities = 38/159 (23%), Positives = 64/159 (40%), Gaps = 6/159 (3%)
 Frame = +1

Query: 1591 SQDELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGS 1770
            S+++  FLP  K      + KEI  + +   +S Q  +S    ++             GS
Sbjct: 920  SEEKNPFLPERK-----ESNKEISEEESSQEESSQEESSQEESNQ------------EGS 962

Query: 1771 ACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEK 1950
              S E + +     S     +L+AS   N + +  N+N  LETE   +K   +    P+ 
Sbjct: 963  DVSSESNAVDSENTS---EQVLSASSQENGIPQNGNTNEKLETESEDSKHVAKYGDKPKS 1019

Query: 1951 QEDMDEIVVLKKKKIHSNDQKAKHDDG------DIVEEP 2049
             E+  +I     + I    Q+ + +DG      D  EEP
Sbjct: 1020 TEEASDI----DENIDQQTQEGEQEDGNGLQNDDAEEEP 1054

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 32.7 bits (73), Expect = 4.9
 Identities = 28/133 (21%), Positives = 56/133 (42%), Gaps = 15/133 (11%)
 Frame = +1

Query: 31  KKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMK-------------SMASVMNNIL 171
           +++ME V  S       +E    +   V N++E+S+              S    +NNI 
Sbjct: 394 QQLMEKVVDSGFFNPSLLELPPELSLDVFNNIEESLSNNNSNNNPLNMVTSTTPGLNNIN 453

Query: 172 LSIDNNNEKLDGTNENLEEV-CKEFSNVMDVLFEKADRSLDILNRKSSTNDN-KKNMQFL 345
            + +NN E     N NL+ +    F N  + LF+  +   ++L    + N N   ++  +
Sbjct: 454 FNQNNNGENNSTANHNLDSLDTNIFKNSYNSLFDSNNNGNNLLGNNLTNNINDDPSLNII 513

Query: 346 DDVNVAENDPSRR 384
           +   + + DP ++
Sbjct: 514 NTTEIDDIDPLQK 526

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 32.7 bits (73), Expect = 4.9
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 12/119 (10%)
 Frame = +1

Query: 19   DNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDN---- 186
            DN+   +    + +    +Q  E+ K I        EK      S +NN + S+      
Sbjct: 1141 DNLRDNLKSLEKENKESVAQVEEYKKQISDK-----EKEYNGKLSELNNEINSVQQKNET 1195

Query: 187  ---NNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNK-----KNMQ 339
               NNEKL G  E +E+  ++ SN+     E  +  ++ L       + K     KNM+
Sbjct: 1196 ICQNNEKLKGEIEEIEKASEDQSNLKGSKIEALNAQIEELEESKQITETKLLDSVKNMK 1254

>Skud_16.409 Chr16 complement(738102..739418) [1317 bp, 438 aa] {ON}
            YPR120C (REAL)
          Length = 438

 Score = 32.3 bits (72), Expect = 5.2
 Identities = 27/107 (25%), Positives = 46/107 (42%)
 Frame = +1

Query: 1714 VLSEILLHPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPL 1893
            V S  ++H E+  +  + S    +  ++     S  K   L  SK    + +   +N PL
Sbjct: 11   VRSSSMIHNENKTQLSSTSVKITQAKKIISTNGSSSKEQFLQDSKTRRALTDVPVNNNPL 70

Query: 1894 ETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGD 2034
               +     S   +V   K+E+   IV   +K+   NDQ A++DD D
Sbjct: 71   SQNKKIATNSKAAKV--RKEENSRPIVTAIQKRQIYNDQNAENDDDD 115

>YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON}
            NOP58Protein involved in pre-rRNA processing, 18S rRNA
            synthesis, and snoRNA synthesis; component of the small
            subunit processome complex, which is required for
            processing of pre-18S rRNA
          Length = 511

 Score = 32.3 bits (72), Expect = 5.4
 Identities = 33/159 (20%), Positives = 74/159 (46%), Gaps = 1/159 (0%)
 Frame = +1

Query: 1738 PEHAVKYHNGSACSVEESELKDR-YLSYIKATLLAASKNINMVLETSNSNAPLETEETHN 1914
            P++ + YH   A  V ++  K++  ++ + A   A S   + + E  + +  +  E +  
Sbjct: 337  PKYGLLYH---ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLE-SRA 392

Query: 1915 KKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNRE 2094
            K  +++  +  +       VV + KK+   + +A + D D  +   D S+++    +  +
Sbjct: 393  KVENRLSQLEGRDLRTTPKVVREAKKVEMTEARAYNADADTAKAASD-SESDSDDEEEEK 451

Query: 2095 VKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
             +KK+KKR  D    + +  KA K+++   + K+   KK
Sbjct: 452  KEKKEKKRKRDDDEDSKDSKKAKKEKKDKKEKKEKKEKK 490

>Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {ON}
            YOR310C (REAL)
          Length = 516

 Score = 32.3 bits (72), Expect = 5.4
 Identities = 36/161 (22%), Positives = 73/161 (45%), Gaps = 3/161 (1%)
 Frame = +1

Query: 1738 PEHAVKYHNGSACSVEESELKDR-YLSYIKATLLAASKNINMVLETSNSNAPLETEETHN 1914
            P++ + YH   A  V ++  K++  ++ + A   A S   + + E  + +  +  E +  
Sbjct: 337  PKYGLLYH---ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLE-SRA 392

Query: 1915 KKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNRE 2094
            K  +++  +  +       VV + KK+   + +A + D D  +   D S ++  + D  E
Sbjct: 393  KVENRLSQLEGRDLRTTPKVVREAKKVEITEARAYNADADTAKAASD-SDSDSDSDDEEE 451

Query: 2095 VK--KKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
             K  KKDKKR  D      +  K+ K+++   + K+   KK
Sbjct: 452  EKEEKKDKKRKRDDDEEVKDSKKSKKEKKEKKEKKEKKEKK 492

>YMR029C Chr13 complement(328660..330231) [1572 bp, 523 aa] {ON}
           FAR8Protein involved in recovery from cell cycle arrest
           in response to pheromone, in a Far1p-independent
           pathway; interacts with Far3p, Far7p, Far9p, Far10p, and
           Far11p
          Length = 523

 Score = 32.3 bits (72), Expect = 5.5
 Identities = 27/116 (23%), Positives = 57/116 (49%), Gaps = 4/116 (3%)
 Frame = +1

Query: 445 KPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPY-EYEILNQEYNND--ILEKKEPIPS 615
           K L+IEK   LK    S+  +++  D+ +  +QP+   +I+N ++ N   ++  K     
Sbjct: 252 KLLVIEKSFHLKLFSISSASLISDVDLLQDSEQPFSSSDIINIDFKNKWLLIASKNKSQI 311

Query: 616 TSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYYGLV-CLMQISTRT 780
             W       +DNI + +D+   +K++ EI  D +  D      ++ C++ I+ ++
Sbjct: 312 RIWE------LDNIEAPEDVPINIKETYEITHDNDDDDSNDSTNILDCILGITEKS 361

>Skud_40.1 Chr40 complement(218..1834) [1617 bp, 538 aa] {ON} YHR146W
            (REAL)
          Length = 538

 Score = 32.3 bits (72), Expect = 5.5
 Identities = 28/140 (20%), Positives = 55/140 (39%), Gaps = 7/140 (5%)
 Frame = +1

Query: 1810 LSYIKATLLAASKNINMVLETSNSNAP------LETEETHNKKSDQIQVIPEKQEDMDEI 1971
            L  + +    A+    M +  S+ + P      LE  E H    D +    E +  +++ 
Sbjct: 372  LGTVTSVKALATPKAQMPIRKSSQDEPVGETVQLELVEKHEPTGDAVDTFKETEGKLEQ- 430

Query: 1972 VVLKKKKIHSNDQKAKHDDGDIVEE-PVDYSKANILASDNREVKKKDKKRVFDPYSSTGE 2148
                 +++ + D  A  D   ++ E P    K +   S+ +E KKK K++          
Sbjct: 431  -----EEVFTLDPGATKDSKPVLAEYPQGERKKSPAVSEEKEKKKKKKRQEGKCSKEIKR 485

Query: 2149 GPKAAKKRRLVTKGKKISFK 2208
                ++K+R   + KK+  K
Sbjct: 486  SESTSEKKRSTKESKKVPVK 505

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
            similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 32.3 bits (72), Expect = 5.6
 Identities = 53/257 (20%), Positives = 97/257 (37%), Gaps = 4/257 (1%)
 Frame = +1

Query: 487  EESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSL 666
            ++  Q  L + ++  H  QP+ Y    Q+   + L+K +      W   +       N  
Sbjct: 160  QQQQQDYLHSSNVYLHSHQPHRYLDQQQQDRQEELQKHQLREQPQWFQPHT----EENYY 215

Query: 667  QDMMQELKKSSE---IAVDLEHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNE 837
             + +Q L  SS    +++   H D   YY          R+++   D +   DD     +
Sbjct: 216  GEQLQRLSFSSNNRRLSISSYHSDKPVYYEYE---DFGMRSEEDEEDGLRNDDD-----D 267

Query: 838  VFTNPLITKVFHGAFMDIIWLQRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEK-YANF 1014
            + T   + +++H   +  + L     L   S+F  +    A+ LP   +   +E+ Y  F
Sbjct: 268  IVTTD-VERLYH---LSHLMLSPGRKLRKDSIFSDYGNDMAMPLPNAQMNLQIEEEYTTF 323

Query: 1015 KTSKKYQLADWRRRPLSKAMMAYARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVAL 1194
              S+   +  WRR    K  + +         NIF       +SS +   +        L
Sbjct: 324  ADSES--IPQWRRM---KERLKW---------NIFGNKSEPALSSSEYTSMDDTEPQPLL 369

Query: 1195 RRFEYSKYKPKIPVANI 1245
            R+  +   KP IPV +I
Sbjct: 370  RKKYFWSRKPTIPVIHI 386

>SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {ON}
            some similarities with uniprot|P31376 Saccharomyces
            cerevisiae YAL011W SWC3 Protein of unknown function
            component of the Swr1p complex that incorporates Htz1p
            into chromatin required for formation of nuclear-
            associated array of smooth endoplasmic reticulum known as
            karmellae
          Length = 657

 Score = 32.3 bits (72), Expect = 5.7
 Identities = 23/103 (22%), Positives = 48/103 (46%)
 Frame = +1

Query: 1876 NSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVD 2055
            N    ++ +E   +K  + +   +K E+  + ++LKK++I    Q +       V EP  
Sbjct: 167  NIEQEMKKKEKDERKKRESEEKKKKAEERKQQLLLKKQEIKLQKQASAKPPSSSVHEP-- 224

Query: 2056 YSKANILASDNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVT 2184
                       R+ KK+ KK V  P  S+ + P++ + ++++T
Sbjct: 225  ---------KKRQPKKRVKKEVQQPKESS-QQPQSIEDQKMIT 257

>Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa]
           {ON} complement(173760..175733) [1974 nt, 658 aa]
          Length = 657

 Score = 32.3 bits (72), Expect = 5.7
 Identities = 28/132 (21%), Positives = 56/132 (42%), Gaps = 8/132 (6%)
 Frame = +1

Query: 118 NSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVM---DVLFEKADRSL 288
           N LEK  KS    +   L  +   + + +  N NL E+ KE+S V+   ++ F+  +   
Sbjct: 57  NHLEKQYKSNLDTLEKTLNDMQELHVRNESLNRNLSELKKEYSEVIEEKEIQFKTLNSDY 116

Query: 289 DILNRKSSTNDNK-----KNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPL 453
           D++  +     N+       +   ++    E + S+ + K   N +    N +    K L
Sbjct: 117 DVVKEECEFLRNQYQTMASRVGDQEEYKKLETEASQNLIKMYEN-ELSKQNKQIISLKKL 175

Query: 454 LIEKPNALKSIE 489
           + EK   L+ ++
Sbjct: 176 VTEKDGELEDLK 187

>KAFR0A01600 Chr1 (324219..326366) [2148 bp, 715 aa] {ON} Anc_1.294
           YJL076W
          Length = 715

 Score = 32.3 bits (72), Expect = 5.8
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 6/133 (4%)
 Frame = +1

Query: 196 KLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDP 375
           K D TNEN+     ++S+               L+RK+ ++  K + Q    ++ A + P
Sbjct: 124 KDDFTNENILSPVSKYSS---------------LDRKNRSHSKKFSFQQPSRISTATHLP 168

Query: 376 SRRISKPQLNFKTPVDNSESH---PFKPLLIEKPNALKSIE---ESTQLVLATEDIPEHF 537
           ++   +P L  KT +   +     P+KP  +EKP+A  SI     S++ +  T  IP+  
Sbjct: 169 TQ--IRPILESKTLLGTPQFTTVTPYKPNRVEKPHAKPSIHPLANSSKTISETLKIPD-- 224

Query: 538 QQPYEYEILNQEY 576
             P   + LN  Y
Sbjct: 225 --PKTVKDLNTSY 235

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
           Anc_5.230 YLR006C
          Length = 765

 Score = 32.3 bits (72), Expect = 5.9
 Identities = 34/173 (19%), Positives = 77/173 (44%), Gaps = 13/173 (7%)
 Frame = +1

Query: 79  DVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMD 258
           D+    +I +   + ++  +  ++S +NN  ++I+++N     +N N + + +      D
Sbjct: 283 DISNSINIKSRRCSQIDVPLSKLSSHVNNENMNINHSNNISPNSNNNTKNLAETNKLKRD 342

Query: 259 VLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDN---- 426
           ++     RS    N+K+S ND ++     DD N+        ++ P  N  T  DN    
Sbjct: 343 IIMNYELRSSSNNNQKTS-NDTER----FDDTNI-----DSEMNSPTFNPNTSSDNLRRE 392

Query: 427 --SESHPFKPLLIEKPNALK---SIEESTQLVLATED----IPEHFQQPYEYE 558
             +E+ P   ++ ++    K   SI     ++ A +     +P++F+   ++E
Sbjct: 393 SVTETEPDFRIITDEEQLRKVSNSIANDENILHAPKQAILLLPKNFEGDVKFE 445

>ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weakly
            similar to uniprot|P17065 Saccharomyces cerevisiae
            YNL272C SEC2 Guanyl-nucleotide exchange factor for the
            small G-protein Sec4p located on cytoplasmic vesicles
            essential for post-Golgi vesicle transport
          Length = 779

 Score = 32.3 bits (72), Expect = 5.9
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +1

Query: 1981 KKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKR 2118
            KK+K HS  QK  H    I EE  + ++ N  +S+  E K +D+K+
Sbjct: 633  KKEKEHSTPQKPTHSPETIQEEKENINEDNPRSSEVEEKKTEDEKK 678

>Smik_6.426 Chr6 complement(688927..691308) [2382 bp, 793 aa] {ON}
           YPL221W (REAL)
          Length = 793

 Score = 32.3 bits (72), Expect = 5.9
 Identities = 32/120 (26%), Positives = 48/120 (40%), Gaps = 14/120 (11%)
 Frame = +1

Query: 97  SIDTSVANSL--------------EKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVC 234
           S++ SVAN L              E  +KS      + L  I+ ++E  +  ++N E   
Sbjct: 606 SLNKSVANELMALGNVAKDHTENWENELKSQEGQSEDNLFGIEYDDENTNTNSDNAESSS 665

Query: 235 KEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKT 414
           +E S       EK  RSL I   KS     KKN+        A+ + S   + P  N K+
Sbjct: 666 RETSR--PTFSEKILRSLSIKRNKSKLGSFKKNIPH----KAAQQEVSPDRASPSPNSKS 719

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
            YBR198C
          Length = 814

 Score = 32.3 bits (72), Expect = 6.0
 Identities = 67/303 (22%), Positives = 126/303 (41%), Gaps = 28/303 (9%)
 Frame = +1

Query: 34   KVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGT- 210
            K++     +   +   V+  K  +T+ A    K   +++  + N+LL   N NE + G+ 
Sbjct: 218  KILHGTDINRLYSINSVDHIKENETANAFISGKYRITISKTILNLLLYFLNENENVGGSL 277

Query: 211  -----NENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKK---NMQF-------- 342
                 N++L+ V      +++      DR  D L  +SSTNDN     N++         
Sbjct: 278  ILSMINKHLQPV------IVNSPVTAKDRLADGLKIESSTNDNNNANVNLEINSIPVKLG 331

Query: 343  ---LDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLA 513
                D+  V E +   +I   Q   K   DN++++  K LL E     KSI+  T    A
Sbjct: 332  PLPKDEEFVKEVETELKIKDDQ--EKQQQDNNDANT-KTLLQE----YKSIQNDTASDAA 384

Query: 514  TEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVD-NINSLQ------- 669
            T    ++     + + L +E   ++LE+ + I  T  V++ A  V  +I++L        
Sbjct: 385  TV-TDKNEDDKDKSDNLIKETKEEVLEENKNIIKTP-VESKAFMVSPSIDTLPLPLKTSL 442

Query: 670  DMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTN 849
            D+  E++K  E    +   + ++    VC+       +D  +  +   DD ++    F +
Sbjct: 443  DLKLEIQKVKESRDAIRLDNIQTSLPSVCMYTFHNTNKD--MSCLEFSDDCRLAATGFQD 500

Query: 850  PLI 858
              I
Sbjct: 501  SFI 503

>KAFR0I00750 Chr9 (150956..153493) [2538 bp, 845 aa] {ON} Anc_8.560
            YPL084W
          Length = 845

 Score = 32.3 bits (72), Expect = 6.0
 Identities = 49/204 (24%), Positives = 96/204 (47%), Gaps = 10/204 (4%)
 Frame = +1

Query: 1558 INNRLPSSLDVSQDELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEIL-L 1734
            I+ +    L   +D+L+   SH +   T  FK+++  L Q T+ +Q +  S VLS +   
Sbjct: 425  IDTQTDPQLAFMRDQLKSW-SHTVR--TSNFKDMDIFLKQITERRQKI--SAVLSSLPDS 479

Query: 1735 HPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAAS---------KNINMVLETSNSNA 1887
              E+ VK  +     V+ S   D+  S +K  +             KN N   +TS+SNA
Sbjct: 480  QKENVVKLKSSL---VQASRSDDKLFSLMKPYINEIKLLENEDLLWKNFNK-FDTSSSNA 535

Query: 1888 PLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKA 2067
            P   +    K ++ +  I + +   D++ VLK+ + ++ ++  +  + D +   +  +KA
Sbjct: 536  PSLLDIDDTKSAEILSKIEKVRLLADDLRVLKEDRNNTLEELKEKLNEDDITNLLILNKA 595

Query: 2068 NILASDNREVKKKDKKRVFDPYSS 2139
            +   +D R++   + ++ F P SS
Sbjct: 596  S-SETDLRDLFSSELEK-FSPLSS 617

>KLLA0E19405g Chr5 complement(1725950..1728676) [2727 bp, 908 aa] {ON}
            similar to uniprot|Q7LIB1 Saccharomyces cerevisiae
            YPL195W APL5 Delta-like subunit of the yeast AP-3 complex
            which functions in transport of alkaline phosphatase to
            the vacuole via the alternate pathway suppressor of loss
            of casein kinase 1 function delta-like subunit of the
            yeast AP-3 adaptin component of the membrane-associated
            clathrin assembly complex
          Length = 908

 Score = 32.3 bits (72), Expect = 6.0
 Identities = 44/187 (23%), Positives = 75/187 (40%), Gaps = 20/187 (10%)
 Frame = +1

Query: 1546 EVKSINNRLPSSLDVSQDELQFLPSHKIELMT----GAFKEIENQLTQATKSKQAMTSSV 1713
            E +    RL +   ++ D++    +  IEL      G  K IE  +  +TK K++  S  
Sbjct: 716  EERRRQERLDNPFYLNDDKIDRAETKLIELSDNDDEGETKTIEPVIKISTKKKKSNKSPS 775

Query: 1714 V--LSEILLHPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNA 1887
            V  LS+I++ P   +          +E + K     +  A  L+ S        +   N 
Sbjct: 776  VQILSDIVVAPPSTI---------TKEGKKKSNTSGHSDAITLSTSNKFKSFDFSRKDNI 826

Query: 1888 PLETEETHNKK--------------SDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHD 2025
              + E T +++              SD +  I   Q+D +E++V+KKKK      K K  
Sbjct: 827  DYDGEYTVDQEELEKLKNKLAEQHISDNLTAI---QDDKEEVIVIKKKK------KKKTK 877

Query: 2026 DGDIVEE 2046
            DG   E+
Sbjct: 878  DGSKKEK 884

>Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W
            (REAL)
          Length = 944

 Score = 32.3 bits (72), Expect = 6.1
 Identities = 39/195 (20%), Positives = 80/195 (41%), Gaps = 11/195 (5%)
 Frame = +1

Query: 1546 EVKSINNRLPSSLDVSQDELQFLPSHKIEL--MTGAFKEIENQLTQATKSKQAMTSSVV- 1716
            E++ + ++L    + +      L S K EL  +T    E+ENQ  +     ++  S +  
Sbjct: 270  ELRKVKDQLKELENKADATCSQLDSKKNELRKLTDQLNELENQANEKDSQLKSKESELKK 329

Query: 1717 LSEILLHPEHAVKYHNGSACSVEESELKDRYLSYI--------KATLLAASKNINMVLET 1872
            L+  L   E+ V   NGS  S +ESELK   +           K + L A +N    L  
Sbjct: 330  LTNQLNELENKVN-QNGSQSSAKESELKKSKIQITELEEKINEKNSQLTAKENELKTLVA 388

Query: 1873 SNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPV 2052
              +   ++  +  ++   + + +    E ++  + + +++  S DQ+       + +   
Sbjct: 389  QLNQLEIKMNQKDSQLGSKEEELKAINEKLNADIKIARQQTASRDQRISDLQTKVQDLEN 448

Query: 2053 DYSKANILASDNREV 2097
            D S+     +D + V
Sbjct: 449  DLSRMEKTHNDTKSV 463

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
            YEL061C
          Length = 963

 Score = 32.3 bits (72), Expect = 6.1
 Identities = 37/161 (22%), Positives = 65/161 (40%), Gaps = 22/161 (13%)
 Frame = +1

Query: 28   LKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNIL------------ 171
            L K  E+    N   + + EF+ ++++S+    +K  ++  S+ NNI             
Sbjct: 791  LSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDIA 850

Query: 172  ----LSIDNNN------EKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTND 321
                L ID+NN      + ++  N  L E  KE   V +   +K +  LD     +S   
Sbjct: 851  HSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLN-ELD-----TSIRT 904

Query: 322  NKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPF 444
              K++ +  D+    N P +   K   N   P+DN +   F
Sbjct: 905  VLKDIDYEKDIK-ETNSPLKPSHKHDYNHTIPLDNDKKRSF 944

>KNAG0C02110 Chr3 complement(409079..412210) [3132 bp, 1043 aa] {ON}
            Anc_1.377 YFR016C
          Length = 1043

 Score = 32.3 bits (72), Expect = 6.1
 Identities = 33/137 (24%), Positives = 57/137 (41%), Gaps = 25/137 (18%)
 Frame = +1

Query: 1786 ESELKDRYLSYIKATLLA------ASKNINMVLETSNSNAPLET----EETHNKKSDQIQ 1935
            + +L ++  S IK T +        S++ NMV + S  +   E     EE  N +     
Sbjct: 427  QPQLAEKVFSEIKKTNIEWKHGSDESESGNMVNDASKDDVKFENTDEQEEVINAEKKDEN 486

Query: 1936 VIPEKQEDMDEIVVLK---------------KKKIHSNDQKAKHDDGDIVEEPVDYSKAN 2070
            +  + +E   + V  K                 K+ +N QK+K  +G   E+ +D  + N
Sbjct: 487  LTKKAREVETDFVTTKPSTTMTKANVGALDISSKLDTNVQKSKLPEGQ-KEQCIDKERDN 545

Query: 2071 ILASDNREVKKKDKKRV 2121
            I+  D  + KKK K+ V
Sbjct: 546  IIEEDENDTKKKVKEGV 562

>YPR042C Chr16 complement(650435..653662) [3228 bp, 1075 aa] {ON}
            PUF2Member of the PUF protein family, which is defined by
            the presence of Pumilio homology domains that confer RNA
            binding activity; preferentially binds mRNAs encoding
            membrane-associated proteins
          Length = 1075

 Score = 32.3 bits (72), Expect = 6.2
 Identities = 30/135 (22%), Positives = 61/135 (45%), Gaps = 3/135 (2%)
 Frame = +1

Query: 40   METVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNN-ILLSIDNNNEKLDGTNE 216
            + +VR+SN+  +  ++ + +  T   N     M  + S  NN  ++   N N+  +G + 
Sbjct: 903  VSSVRSSNSRHNSVIQMNNAGPTPALNFNPAPMSEINSYFNNQQVVYSGNQNQNQNGNSN 962

Query: 217  NLEEVCKEFSNVMDVLFEKADRSLDILN--RKSSTNDNKKNMQFLDDVNVAENDPSRRIS 390
             L+E+  +F +    +    + SL I+N    S+ N+N  N  +   +N      SR +S
Sbjct: 963  GLDELNSQFDSFR--IANGTNLSLPIVNLPNVSNNNNNYNNSGYSSQMNPL----SRSVS 1016

Query: 391  KPQLNFKTPVDNSES 435
                N     +N+++
Sbjct: 1017 HNNNNNTNNYNNNDN 1031

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 32.3 bits (72), Expect = 6.2
 Identities = 25/118 (21%), Positives = 56/118 (47%), Gaps = 1/118 (0%)
 Frame = +1

Query: 31  KKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGT 210
           +K + T+    A   +D+   K +  S  +++E+       + N+I   ID  +++ D  
Sbjct: 319 RKSVHTLEKEIASLERDIRKSKDVQKSTKDTIERLRSDRVVLDNDIERLIDLQSQQ-DNE 377

Query: 211 NENLEEVCKEFSNVMDVLFEKADRSLDILNR-KSSTNDNKKNMQFLDDVNVAENDPSR 381
            + ++E  + F N  D   +K +   + +NR KS     ++ ++ LD+ +  E+  +R
Sbjct: 378 YQTVKEEKRTFKNRYDKELQKQEEVKENINRTKSRIEVLERTIEKLDEESRNESGTNR 435

>TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6.75
            YLR278C
          Length = 1161

 Score = 32.3 bits (72), Expect = 6.2
 Identities = 24/103 (23%), Positives = 53/103 (51%), Gaps = 12/103 (11%)
 Frame = +1

Query: 91   HKSIDTSVANSLEKSMK-----SMASVMNNILLSIDNNNEKLDGT-NENLEEVCKEFSNV 252
            +  +D    + L++S K     S+ + ++N+L++   +++K DG  ++N+E+  +E SN 
Sbjct: 784  NSQVDRETKHDLKRSRKVLENTSLPNGLSNLLIN-GTDSDKSDGNLDDNIEKTSEELSNN 842

Query: 253  MDVLFEKADRSLDILNR------KSSTNDNKKNMQFLDDVNVA 363
                   ++    I+NR      ++ ++DNKKN   +   N +
Sbjct: 843  FTNPGTSSESEKAIINRLFCNAPENVSDDNKKNQYIVKKPNAS 885

>NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]
           {ON} Anc_4.15 YHL030W
          Length = 1868

 Score = 32.3 bits (72), Expect = 6.5
 Identities = 19/62 (30%), Positives = 33/62 (53%)
 Frame = +1

Query: 31  KKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGT 210
           ++++E V    AL+    +F +S+DT +A  L K     ASV   +  S+ N   +L+G+
Sbjct: 12  RELVEKVELRLALSDTTTKFQQSLDTFLAPLLLKLASPHASVRQAVFNSLKNILSRLNGS 71

Query: 211 NE 216
            E
Sbjct: 72  TE 73

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 32.3 bits (72), Expect = 6.5
 Identities = 48/224 (21%), Positives = 90/224 (40%), Gaps = 19/224 (8%)
 Frame = +1

Query: 124  LEKSMKSMASVMNNILLSIDNNNEKLDGT-------NENLEEVCKEFSNVMDVLFEKADR 282
            +E + K +   +N  L ++ N N+KLD T        ++L+E  ++   +  +L    D+
Sbjct: 861  IESAKKKVEKELNKELENMKNENKKLDNTLAKKEKELQSLDEELQKLRKMQSLLETDKDQ 920

Query: 283  SL-DILNRKSSTNDNKKNMQFLDD-----VNVAENDPSRR------ISKPQLNFKTPVDN 426
            S  ++   KS    + + +  L D      N  +N  S R      + +   N K  V N
Sbjct: 921  SARELTEWKSKFQGHDELVTRLTDKLKSLANSFKNIQSERDTLQKHLMEITDNNKLDVQN 980

Query: 427  SESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEP 606
             ES   + L  E+ NA+    +    +   E         Y  EI       D L++   
Sbjct: 981  LESQ-IEALSTERDNAILERNDLLNTITNLESATTQIHNNYREEIARLTSKTDDLQRTVN 1039

Query: 607  IPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRS 738
                   + N    +++ +LQ   +E K+ ++  ++L+  D RS
Sbjct: 1040 TQEKQLNEKN----EDLIALQKSSEEQKEDAK-KLELKFADVRS 1078

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 32.3 bits (72), Expect = 6.5
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +1

Query: 73   SQDV-EFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSN 249
            SQD+ E H+ + ++    LE  ++S+ + + +      ++ EK +      +E  K    
Sbjct: 1287 SQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKL 1346

Query: 250  VMDVLFEKADRSLDI-LNRKSSTNDNKKNMQFLDDVNVAEN 369
              D   E+ +   D  L  + S N+    +Q L+D  VAEN
Sbjct: 1347 SQDSFIEQLNELKDAKLALEKSLNNANARIQELEDAKVAEN 1387

>KNAG0B06680 Chr2 (1318427..1319701) [1275 bp, 424 aa] {ON} Anc_4.342
            YML074C
          Length = 424

 Score = 32.0 bits (71), Expect = 6.8
 Identities = 25/106 (23%), Positives = 46/106 (43%)
 Frame = +1

Query: 1894 ETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANI 2073
            + +E   + SD++  + +  +    I  L  K  H ++++ + D     EE V   K+  
Sbjct: 211  DDDEEEEELSDELDDLEDASDVEGRIEELVAKDEHKSNKRKQQD-----EEEVPAKKSKK 265

Query: 2074 LASDNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
             A + ++VK++ K              K  KK +   K KK+ FKK
Sbjct: 266  EAKEEKKVKEEKKA-------------KEEKKAKEEKKAKKVEFKK 298

>Ecym_2008 Chr2 (10349..11782) [1434 bp, 477 aa] {ON} similar to
            Ashbya gossypii AGR397C
          Length = 477

 Score = 32.0 bits (71), Expect = 7.0
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 6/110 (5%)
 Frame = +1

Query: 1654 EIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELKDRYLSYIKATL 1833
            E+EN+   A     AM  S ++S    HP+  V         +E SE  + Y S  +A  
Sbjct: 264  EVENEPADADYELNAMYKSELVSTEAKHPDQEVP----PLGLIERSEDANGYESVSRAHN 319

Query: 1834 LAASKNINMVLETSNSNAPLETEETH------NKKSDQIQVIPEKQEDMD 1965
             +   N N+  E + + A   TE         N ++ Q ++I E  ED+D
Sbjct: 320  ESKQLNTNIDKELNKNPAISNTEVLRNVFNPLNVENAQFKLIEESDEDID 369

>TPHA0J00470 Chr10 (106019..107488) [1470 bp, 489 aa] {ON} Anc_6.38
           YMR004W
          Length = 489

 Score = 32.0 bits (71), Expect = 7.0
 Identities = 36/153 (23%), Positives = 70/153 (45%), Gaps = 5/153 (3%)
 Frame = +1

Query: 94  KSIDTSVANSLEKSMKSMASV-MNNILLSIDNN----NEKLDGTNENLEEVCKEFSNVMD 258
           +SI  S+ N L  +  ++  + ++N +L I+NN    N  +  T    +E CKEF+N + 
Sbjct: 297 RSILHSMINKLIDNTPNLYPIELDNTILDINNNLSMVNSNVKKTISVYDEECKEFANSII 356

Query: 259 VLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESH 438
             F+K    ++IL+   +  +  K M   + + + ++  S       +  K  V  +E  
Sbjct: 357 PTFKK---YIEILSSLKNLFERYKIMGGNNILQLYKHVESNMGRLENMKGKPDVSGAEYD 413

Query: 439 PFKPLLIEKPNALKSIEESTQLVLATEDIPEHF 537
             K  ++     +  +E++ +L L  E I E F
Sbjct: 414 RLKNTILYDKKLI--LEQTNRLWLIRECIMEEF 444

>KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {ON}
            Anc_8.787 YOR310C
          Length = 499

 Score = 32.0 bits (71), Expect = 7.1
 Identities = 33/154 (21%), Positives = 66/154 (42%), Gaps = 1/154 (0%)
 Frame = +1

Query: 1738 PEHAVKYHNGSACSVEESELKDR-YLSYIKATLLAASKNINMVLETSNSNAPLETEETHN 1914
            P++ + YH   A  V ++  K++  ++ + A   A S   + + E  + +  +  E    
Sbjct: 337  PKYGLLYH---ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLE-CRA 392

Query: 1915 KKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNRE 2094
            K  +++  +  +       VV  +KK+   + K+ + D D V    +    +    D  +
Sbjct: 393  KVENRLSQLEGRDLRTTPKVVRDEKKVEITETKSYNADADAVSAVAEEESDS---DDEEK 449

Query: 2095 VKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKK 2196
             +KK+KKR  D      +  K +KK +   K KK
Sbjct: 450  EEKKEKKRKRDDGDDAEKKEKKSKKEKKDKKAKK 483

>KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {ON}
            Anc_8.787 YOR310C
          Length = 501

 Score = 32.0 bits (71), Expect = 7.1
 Identities = 33/154 (21%), Positives = 66/154 (42%), Gaps = 1/154 (0%)
 Frame = +1

Query: 1738 PEHAVKYHNGSACSVEESELKDR-YLSYIKATLLAASKNINMVLETSNSNAPLETEETHN 1914
            P++ + YH   A  V ++  K++  ++ + A   A S   + + E  + +  +  E    
Sbjct: 337  PKYGLLYH---ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLE-CRA 392

Query: 1915 KKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNRE 2094
            K  +++  +  +       VV  +KK+   + K+ + D D V    +    +    D  +
Sbjct: 393  KVENRLSQLEGRDLRTTPKVVRDEKKVEITETKSYNADADAVSAVAEEESDS---DDEEK 449

Query: 2095 VKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKK 2196
             +KK+KKR  D      +  K +KK +   K KK
Sbjct: 450  EEKKEKKRKRDDGDDAEKKEKKSKKEKKEKKDKK 483

>Ecym_2276 Chr2 (541135..542649) [1515 bp, 504 aa] {ON} similar to
           Ashbya gossypii AFL020W
          Length = 504

 Score = 32.0 bits (71), Expect = 7.1
 Identities = 25/85 (29%), Positives = 42/85 (49%)
 Frame = +1

Query: 211 NENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRIS 390
           NE +        N   ++FE++  SLD +  K ++  +KK +Q L DV V  N  +   S
Sbjct: 396 NETIRFFLGNLQNWAKLVFEESTSSLDDIQIKETSKISKKEVQLLADVIV--NALALLTS 453

Query: 391 KPQLNFKTPVDNSESHPFKPLLIEK 465
               N+K PV N+ +   K  L+++
Sbjct: 454 DLPENYK-PVSNNINEEDKAKLVDR 477

>KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {ON}
            similar to uniprot|Q12499 Saccharomyces cerevisiae
            YOR310C NOP58 Protein involved in pre-rRNA processing 18S
            rRNA synthesis and snoRNA synthesis component of the
            small subunit processome complex which is required for
            processing of pre-18S rRNA
          Length = 511

 Score = 32.0 bits (71), Expect = 7.1
 Identities = 36/167 (21%), Positives = 71/167 (42%), Gaps = 9/167 (5%)
 Frame = +1

Query: 1738 PEHAVKYHNGSACSVEESELKDR-YLSYIKATLLAASKNINMVLETSNSNAPLETEETHN 1914
            P++ + YH   A  V ++  K++  ++ + A   A S   + + E  + +  +  E +  
Sbjct: 337  PKYGLLYH---ASLVGQASGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLE-SRA 392

Query: 1915 KKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNRE 2094
            K   ++  +  +       VV + KK    + +A + D D V      + ++  + D  E
Sbjct: 393  KVESRLSQLEGRDLRTTPKVVREHKKTEITEARAYNADADTVSSAAAPADSDDESEDEEE 452

Query: 2095 VK--------KKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 2211
             K        KKDKKR  D    + E  K+ K+++   + K+   KK
Sbjct: 453  TKEEKKSKKDKKDKKRKRDDDEESKESKKSKKEKKDKKEKKEKKEKK 499

>TPHA0C02590 Chr3 (574010..575803) [1794 bp, 597 aa] {ON} Anc_2.596
           YMR036C
          Length = 597

 Score = 32.0 bits (71), Expect = 7.4
 Identities = 33/141 (23%), Positives = 61/141 (43%), Gaps = 4/141 (2%)
 Frame = +1

Query: 178 IDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVN 357
           +D N  K         E  K F N+  +L   + +     ++      + K+  ++DD +
Sbjct: 14  LDPNTSKRLSFTSPFHEGTKIFKNIHSLLKSSSKKD----SQSPLQEKDAKDKMYIDDDS 69

Query: 358 VAEN----DPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDI 525
           +++      PSR  SK +LN+KT VD    H     +I   N L +++ S +     +D 
Sbjct: 70  ISDELLIASPSRNKSKSKLNYKT-VDRLPLHDISDSVI---NTLANMDRSQRY----DD- 120

Query: 526 PEHFQQPYEYEILNQEYNNDI 588
               +Q  +  ILN + +N +
Sbjct: 121 ----EQSLDKHILNLKIDNPL 137

>ZYRO0D11154g Chr4 complement(943550..945451) [1902 bp, 633 aa] {ON}
            similar to uniprot|P52488 Saccharomyces cerevisiae
            YDR390C UBA2 Nuclear protein that acts as a heterodimer
            with Aos1p to activate Smt3p (SUMO) before its
            conjugation to proteins (sumoylation) which may play a
            role in protein targeting essential for viability
          Length = 633

 Score = 32.0 bits (71), Expect = 7.5
 Identities = 30/106 (28%), Positives = 44/106 (41%), Gaps = 7/106 (6%)
 Frame = +1

Query: 1753 KYHNGSAC--SVEESELKDRYLSYIKATLLAASKN-INMVLETSNSNAPLET----EETH 1911
            K H+GS    S EE +  + Y   ++  L    ++ IN  +E      PL T    EE  
Sbjct: 505  KLHDGSVILFSDEEGDESEMYRKPLEIYLDVVEESAINSEIELPALEIPLFTPPKQEEED 564

Query: 1912 NKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEP 2049
              K    +  PEK+ED + IV+L        D+     DG   + P
Sbjct: 565  EGKETSTEESPEKEEDKNGIVIL------DEDEGKDEKDGTTTKRP 604

>TBLA0E01220 Chr5 complement(270455..272359) [1905 bp, 634 aa] {ON}
            Anc_4.149 YGR013W
          Length = 634

 Score = 32.0 bits (71), Expect = 7.5
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 5/84 (5%)
 Frame = +1

Query: 1891 LETEETHNKKSDQI-----QVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVD 2055
            +E E T+N  ++ +      ++P  ++D+DE +  K +K +  D+  K   G    E VD
Sbjct: 535  IEPESTNNANNNMLFINTNNILPFDEDDLDERLQ-KLRKSNIVDELVKEYLGVYESELVD 593

Query: 2056 YSKANILASDNREVKKKDKKRVFD 2127
            Y   NI  + ++ +   + K+ FD
Sbjct: 594  YIIDNIKENKDKNILLDELKQTFD 617

>NCAS0F01270 Chr6 (247049..247924) [876 bp, 291 aa] {ON} Anc_5.561
            YDR446W
          Length = 291

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 22/111 (19%), Positives = 52/111 (46%)
 Frame = +1

Query: 1783 EESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDM 1962
            +E + KDR  +  + +     K    +LE  ++++      T + K   + V+       
Sbjct: 94   QEPDAKDRTTTSQELSETTEKKRKRKLLENESASS------TKSSKKLNVMVVEGSSPHK 147

Query: 1963 DEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKK 2115
            +++  LK+ ++       K++D D++E P +Y + N L  ++ + +  DK+
Sbjct: 148  EKLSSLKENRVPVK----KNNDLDVIENPGEYPQINKLLYESSKKEPVDKE 194

>YBL050W Chr2 (125125..125154,125271..126119) [879 bp, 292 aa] {ON} 
           SEC17Peripheral membrane protein required for vesicular
           transport between ER and Golgi, the 'priming' step in
           homotypic vacuole fusion, and autophagy; stimulates the
           ATPase activity of Sec18p; has similarity to mammalian
           alpha-SNAP
          Length = 292

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query: 19  DNVLKKVMETVRASNALAS-QDVEFHKSIDTSVANSLEKS-MKSMASVMNNILLSIDNNN 192
           D  LKK +  + A++A+A+ + ++  +S D + A+S E + +KS+   +N          
Sbjct: 200 DYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESNFLKSLIDAVN---------- 249

Query: 193 EKLDGTNENLEEVCKEFSNVM 255
              +G +E L E CKEF N M
Sbjct: 250 ---EGDSEQLSEHCKEFDNFM 267

>YLR440C Chr12 complement(1015568..1017697) [2130 bp, 709 aa] {ON}
           SEC39Component of the Dsl1p tethering complex that
           interacts with ER SNAREs Sec20p and Use1p; proposed to
           be involved in protein secretion; localizes to the ER
           and nuclear envelope
          Length = 709

 Score = 32.0 bits (71), Expect = 7.6
 Identities = 42/219 (19%), Positives = 87/219 (39%), Gaps = 2/219 (0%)
 Frame = +1

Query: 82  VEFHKSIDTSVANSLEKSMKSMASVMN-NILLSIDNNNEKLDGTNENLEEVCKEFSNVMD 258
           + + K  +T +     K   S+ S  N  + + +  + EK  G  +N E   K  SNV+D
Sbjct: 222 LSYGKKWETFITEFFNKQQFSLKSDTNYQLFIKLYYSLEK--GVKDNSEASRKLQSNVVD 279

Query: 259 VLFEKADRSLDILNRKSSTNDNKKNMQ-FLDDVNVAENDPSRRISKPQLNFKTPVDNSES 435
           +LF  ++   ++ +     ++    +  F D++ + E      +   Q   +  +  S  
Sbjct: 280 ILFHNSENLFNLSSLTHKLDELWSILSGFPDEITIEEQKTITALEMKQF-MEFFIKCSTK 338

Query: 436 HPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPS 615
             FK +      A+   EES QL   +    E F +  E     Q     +L+    I  
Sbjct: 339 FSFKEIF-----AITQEEESAQLAHFSSLCHEEFNKANEISSFLQAMYETVLD----ISK 389

Query: 616 TSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDF 732
              + T     + + S+ +++ ++ + + I   +E  D+
Sbjct: 390 DDKIFTRISMDEKLYSILEILLQMNEFAYIEAIIERFDY 428

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2.292
            YIL091C
          Length = 723

 Score = 32.0 bits (71), Expect = 7.7
 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 1/97 (1%)
 Frame = +1

Query: 1876 NSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHD-DGDIVEEPV 2052
            ++ A + ++E  N       ++ +++++++E          SN+ + + D D +  +  V
Sbjct: 28   SAGAKVSSQEVFNSS-----IVDDEEQELNE----------SNESEQEEDIDEEEKKNKV 72

Query: 2053 DYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKAA 2163
              +   IL S++ E+KKK KKRV D  S   +G + A
Sbjct: 73   YGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELA 109

>Suva_13.411 Chr13 complement(703383..705641) [2259 bp, 752 aa] {ON}
            YMR227C (REAL)
          Length = 752

 Score = 32.0 bits (71), Expect = 7.7
 Identities = 23/89 (25%), Positives = 47/89 (52%), Gaps = 5/89 (5%)
 Frame = +1

Query: 1795 LKDRYLSYIKATLLAAS---KNINMVLETSNSN--APLETEETHNKKSDQIQVIPEKQED 1959
            LK R++  IK     A    K + +  E+S      P +TE  HN++ D+ +   E++ED
Sbjct: 630  LKSRFIDSIKKLEKEAEMKRKQLQLTEESSQKQHQQPSDTEVPHNEEEDEEEDEEEEEED 689

Query: 1960 MDEIVVLKKKKIHSNDQKAKHDDGDIVEE 2046
              E    ++ + + N+++ ++D+G+  +E
Sbjct: 690  EAEEEEDEEDE-NENEEEDENDEGEHAQE 717

>TBLA0C00370 Chr3 complement(64323..65228) [906 bp, 301 aa] {ON}
            Anc_8.12 YFL044C
          Length = 301

 Score = 31.6 bits (70), Expect = 7.7
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = +1

Query: 1843 SKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDM-DEIVVLKKKKIHSNDQKAK 2019
            S   N++L +  S+A   T + H K   +I  +PE    +   +     K +  + Q  K
Sbjct: 69   SNGDNLMLTSIKSSAVTSTPDDHGKNVVRIHKVPEDNSCLFHSLSYCLNKNLDRSQQLRK 128

Query: 2020 HDDGDIVEEPVDYSKA 2067
            +    ++E+PV YS A
Sbjct: 129  NVATRVMEDPVTYSTA 144

>NDAI0H03500 Chr8 (852528..855134) [2607 bp, 868 aa] {ON} Anc_1.377
            YFR016C
          Length = 868

 Score = 32.0 bits (71), Expect = 7.9
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 4/99 (4%)
 Frame = +1

Query: 1846 KNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHD 2025
            K   ++ E++   A L+     NK++D  ++ P K+E  D I   K +  H N  K   +
Sbjct: 48   KKKKVLKESTAEAAELDEIVNANKENDNKKITPVKEEKGDTI---KPESTHDNSTKTTDN 104

Query: 2026 DG----DIVEEPVDYSKANILASDNREVKKKDKKRVFDP 2130
            +     +  E  VD  K        +++KK  KK+V  P
Sbjct: 105  ENIDATNTEENGVDPLKKKKKLKRIKKIKKVKKKKVPTP 143

>TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {ON}
           Anc_7.309 YDL194W
          Length = 880

 Score = 32.0 bits (71), Expect = 7.9
 Identities = 34/152 (22%), Positives = 59/152 (38%), Gaps = 7/152 (4%)
 Frame = -2

Query: 737 DLKSWCSKSTAISEDFFNSCIISCRL-----LMLSTQIALVSTQEVEGIGSFFSKISLLY 573
           ++K+      A+    F  C IS        L + T + + + Q+  GI           
Sbjct: 353 EIKANYDYEAAVGSTSFWDCFISTETRPKETLRMFTGLGIQAFQQFAGIN---------- 402

Query: 572 S*FKISYSYGCWKCSGISSVAKTSCVDSSID--FNALGFSISRGLNGWLSLLSTGVLKFS 399
             F   Y    ++ + + S    S +  +++  FN  G  +   +     L+S G+L  +
Sbjct: 403 --FVFYYGVNFFEKTAVESSYIISFITYAVNVFFNVPGLLLVEYIGRRDLLISGGILMTT 460

Query: 398 CGFEILLLGSFSATLTSSRNCIFFLLSFVEDF 303
           C F I   G  S  + SS+  I F+  FV  F
Sbjct: 461 CNFIIAGAGCLSDNVISSKVMIAFICCFVASF 492

>NDAI0A02890 Chr1 (648510..651236) [2727 bp, 908 aa] {ON} 
          Length = 908

 Score = 32.0 bits (71), Expect = 7.9
 Identities = 32/139 (23%), Positives = 55/139 (39%), Gaps = 2/139 (1%)
 Frame = -2

Query: 713 STAISEDFFNSCIISCRLLMLSTQIALVSTQEVEGIGSFFSKISLLYS*FKISYSYGCWK 534
           ST   + F  +     + L + T IA+ + Q+  GI   F             Y    + 
Sbjct: 349 STTFWDCFLTTKTRPKQTLRMFTGIAIQAFQQFSGINFIFY------------YGVNFFN 396

Query: 533 CSGI--SSVAKTSCVDSSIDFNALGFSISRGLNGWLSLLSTGVLKFSCGFEILLLGSFSA 360
            +G+  S +    C   ++ FN  G  +         LL+ GVL F   F I ++GS   
Sbjct: 397 DTGVHNSYLVSFICYAVNVIFNVPGMILVEFFGRRKVLLTGGVLMFMSNFIIAIVGSSVE 456

Query: 359 TLTSSRNCIFFLLSFVEDF 303
           ++ + +  I F+  F+  F
Sbjct: 457 SVVADKVMIAFICLFIAAF 475

>TDEL0B02650 Chr2 (475009..477714) [2706 bp, 901 aa] {ON} Anc_5.658
           YOR058C
          Length = 901

 Score = 32.0 bits (71), Expect = 7.9
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 12/148 (8%)
 Frame = +1

Query: 85  EFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKE------FS 246
           + +K   T ++  LEK ++ +  + N I  S               E +CKE       S
Sbjct: 91  DVYKENFTIISKQLEKLLEDLNVIFNAIGYS-------------KSEIICKEKLIFNTLS 137

Query: 247 NVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDN 426
           + ++  FE+A+  +     K+ T+DN  + + L+ +    +DPS   S P L  +  +  
Sbjct: 138 DSINKFFEEAEGDM-----KTLTDDNNSSQEILNRILEIIHDPSGVQSIPDLYVRNAILI 192

Query: 427 SES-----HPFKPL-LIEKPNALKSIEE 492
            +S      P KPL L+ K   LK+ ++
Sbjct: 193 PQSKTVPTSPRKPLSLLSKRKLLKTAKK 220

>TBLA0E02400 Chr5 complement(595914..598733) [2820 bp, 939 aa] {ON}
            Anc_7.69 YOR324C
          Length = 939

 Score = 32.0 bits (71), Expect = 8.0
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 13/112 (11%)
 Frame = +1

Query: 1873 SNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIH-SNDQKAKHDDGDIVEEP 2049
            SN N+       +N  ++ I    +K E  ++    K KK+H SN +    DD  I+ + 
Sbjct: 390  SNGNSN-NNSSNNNNNNNNIHHEKDKDETQNDNHKQKHKKMHESNHKHTPSDDTSIIPDD 448

Query: 2050 VDYSKANI------------LASDNREVKKKDKKRVFDPYSSTGEGPKAAKK 2169
              Y+ +N               SD+ EV +K KK++   +  +   P +  K
Sbjct: 449  TSYTDSNKPHFDLNYSHYSDKHSDSTEVFEKGKKKLAQQFFKSMRPPMSPSK 500

>KAFR0A00770 Chr1 complement(137386..140244) [2859 bp, 952 aa] {ON}
            Anc_2.476 YMR086W
          Length = 952

 Score = 32.0 bits (71), Expect = 8.0
 Identities = 25/106 (23%), Positives = 51/106 (48%), Gaps = 10/106 (9%)
 Frame = +1

Query: 1891 LETEETHNKKSD-QIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDI-----VEEPV 2052
            +E  ET  K+ D ++ ++  +   ++E ++L+++K H+N++  K+ +  I      EE +
Sbjct: 244  IEETETELKQDDVELDMLIGENNALEEKIILEQEKDHNNNENEKNTETYIQISANEEESI 303

Query: 2053 DYSKANILASDNREVKK----KDKKRVFDPYSSTGEGPKAAKKRRL 2178
               + N   S N E +     K+  R  D  +   EG +    +RL
Sbjct: 304  KKGEKNTSVSPNEEKETQAGLKNLDRKIDVKAQGEEGVELNNNKRL 349

>Suva_5.192 Chr5 (293489..294127) [639 bp, 212 aa] {ON} YER079W
           (REAL)
          Length = 212

 Score = 31.2 bits (69), Expect = 8.1
 Identities = 26/95 (27%), Positives = 37/95 (38%), Gaps = 10/95 (10%)
 Frame = +1

Query: 184 NNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDN-------KKNMQF 342
           NNN KLD  NE   +   +  N  D +    +     LN  S++N N         + QF
Sbjct: 112 NNNNKLDPKNEKKNKKKNKGKNGTDTVAHDPNDKFYKLNATSTSNSNVISNSSTSLSDQF 171

Query: 343 LDDVNVAENDPSRRISKPQLNFK---TPVDNSESH 438
               +  E+ P    + PQ N       +DNS  H
Sbjct: 172 YFQKSNTESAPLSNANYPQSNLSPSLNSMDNSTKH 206

>TBLA0D03720 Chr4 complement(920546..923770) [3225 bp, 1074 aa] {ON}
            Anc_1.509 YJR061W
          Length = 1074

 Score = 32.0 bits (71), Expect = 8.1
 Identities = 42/192 (21%), Positives = 75/192 (39%), Gaps = 4/192 (2%)
 Frame = +1

Query: 1585 DVSQDEL----QFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAV 1752
            D+S D +    + +   K+ ++    + +ENQ ++  + +   T  ++L    L+     
Sbjct: 904  DLSNDTVSKIKEIVSQEKLAMIYNMTESLENQTSEFFRVRDYYTDELILD---LNSAGLN 960

Query: 1753 KYHNGSACSVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQI 1932
             YHN      +ESEL        KA  +   + +    E     A  + EE   KK ++ 
Sbjct: 961  LYHNIRG---KESEL-------FKADPILHEQQLR---ELEEEEADKKKEEEEKKKKEEE 1007

Query: 1933 QVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDK 2112
                +++ED  +    +KKK    ++K K       EE       +    +N E  K D 
Sbjct: 1008 DKKKKEEEDKKKKEEEEKKKKEEEEKKKKE------EEQKQQQNTDTETKNNDEQNKSDN 1061

Query: 2113 KRVFDPYSSTGE 2148
                D  +ST E
Sbjct: 1062 NN--DSQTSTEE 1071

>NDAI0C00790 Chr3 (151077..154331) [3255 bp, 1084 aa] {ON} 
          Length = 1084

 Score = 32.0 bits (71), Expect = 8.1
 Identities = 24/111 (21%), Positives = 46/111 (41%), Gaps = 1/111 (0%)
 Frame = +1

Query: 1843 SKNINMVLETSNSNA-PLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAK 2019
            S N    LET + N  P+E+       +    ++P+++   +    +K+K+I S +  A 
Sbjct: 319  SNNTEKSLETESPNIQPIESPPKKQTVNTTRSILPKQEPSSENATPIKQKEIGSEENDAD 378

Query: 2020 HDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKAAKKR 2172
             +D             NI +S+     K   +R+  P   T E  + ++ R
Sbjct: 379  VND-----------NTNISSSEEESSSKSVTQRITTPELPTAEDVQESEDR 418

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]
           {ON} Anc_1.295 YJL074C
          Length = 1229

 Score = 32.0 bits (71), Expect = 8.2
 Identities = 22/110 (20%), Positives = 47/110 (42%), Gaps = 10/110 (9%)
 Frame = +1

Query: 10  DSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNIL------ 171
           DS +  +K++ +     + L  +  E   S+     N L+ +  + + ++NN+       
Sbjct: 258 DSSEKYIKELDKRENIISELTKKLTEIDSSLKIKTTNDLQIAKANNSEILNNLTNLDVQI 317

Query: 172 ----LSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKS 309
               L ++  NE+ +    NLE + KE  +    L + + R   + N +S
Sbjct: 318 KDLKLQLETQNEQTNSDKSNLELINKEIESRRLKLSKISPRFQQLTNEES 367

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 32.0 bits (71), Expect = 8.3
 Identities = 37/180 (20%), Positives = 71/180 (39%), Gaps = 12/180 (6%)
 Frame = +1

Query: 19   DNVLKKVMETVRASNALASQDVEFHKSIDTSVAN---------SLEKSMKSMASVMNNIL 171
            +N+LKK+   +   N      +EF  +++ S             LE  +    +    IL
Sbjct: 1019 NNILKKLQNEL---NTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEIL 1075

Query: 172  LSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDI---LNRKSSTNDNKKNMQF 342
            L+ID N EK     + LEE  + F +    +  K D+  D+   L ++    D + N   
Sbjct: 1076 LNIDGNKEKA----QELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALT 1131

Query: 343  LDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATED 522
            + +++        R+ K  ++ K        H    L     N++ +I   T  + +T++
Sbjct: 1132 IREISQNLESFDERLEKYDIS-KNGATEDTQHTSSAL-----NSVSNINTDTMDIDSTDN 1185

>TBLA0A00680 Chr1 complement(145681..150165) [4485 bp, 1494 aa] {ON}
           Anc_2.662 YIR033W
          Length = 1494

 Score = 32.0 bits (71), Expect = 8.3
 Identities = 59/279 (21%), Positives = 106/279 (37%), Gaps = 23/279 (8%)
 Frame = +1

Query: 58  SNALASQDVEFHK-----SIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGT---- 210
           SN ++ Q+  F+      S D+S  N+   +  + A+  NN   + +NNN   + +    
Sbjct: 165 SNLVSPQNDGFNNFLNVLSFDSSKDNTTTAAAAAAAANNNNNNNNNNNNNNNNNSSSSSS 224

Query: 211 --NENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFL-------DDVNVA 363
             N N   +    SN    +  ++   L +L+  SSTN++  N            ++N+ 
Sbjct: 225 NNNNNGNSLAHIDSNHSTSIKNESIEDLQVLHNNSSTNNDNNNNDATATIPTPNSNLNLG 284

Query: 364 ENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ- 540
              P+   +    N   P+    + P     I   + +++I   T   L   ++P     
Sbjct: 285 NTTPN-NTNNGNTNSINPISFGRTDPIHTKYINPVDFMENINNPT---LINHNLPYQLSL 340

Query: 541 --QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWV--DNINSLQDMMQELKKSSEIA 708
              P    + NQ   N  LE   P+PS    + N +++  D+I          K+   + 
Sbjct: 341 SGLPKISRVENQIKIN--LEIFPPLPS----NLNMVYLPTDSI---------AKQKLYLT 385

Query: 709 VDLEHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLK 825
            D+EH+       LV L      T +Y   T   +  LK
Sbjct: 386 KDIEHYSIELQKNLVYLNCFLLSTSNYSKSTFVCQRCLK 424

>CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 aa]
            {ON} highly similar to uniprot|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase or uniprot|P25390
            Saccharomyces cerevisiae YCR073c SSK22
          Length = 1667

 Score = 32.0 bits (71), Expect = 8.4
 Identities = 55/249 (22%), Positives = 91/249 (36%), Gaps = 9/249 (3%)
 Frame = +1

Query: 31   KKVMETVRASNALASQ--DVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLD 204
            KKV E   +S    S+    + +   + ++ N++  +     +  +N   S +NNN   +
Sbjct: 448  KKVREDQSSSTPTESRRSPADINDGNNNNINNNINNNTNDNNNTNSNRNNSNNNNNNNNN 507

Query: 205  GTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRR 384
              N N  +     SN         + S D+  RKS+ N            N   + P+  
Sbjct: 508  NNNNNNNKDSNGTSNTAITTTSTTNNSADVTPRKSTPN------------NSVSDTPA-- 553

Query: 385  ISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEIL 564
               PQ N       S +  F   L++ P  +K  E  T L    +            +I+
Sbjct: 554  ---PQENL------SANEHFISQLLQDPAVVKRFEWQTMLANVLKG-----------DIV 593

Query: 565  NQEYNNDILEKKEPIPSTSWVDTNAIWVD-----NINSLQDMMQELKKSSEIAVDLEHH- 726
              E      E K P  +T + D   IW++     N  ++ D  + LK   E A ++    
Sbjct: 594  KSEKTKIAKEVKGPGFTTQYSDD--IWLELKAWMNGRNVDDQKKSLKLLRESADEVFQRV 651

Query: 727  -DFRSYYGL 750
             DFR   GL
Sbjct: 652  LDFRLPDGL 660

>Kpol_1019.12 s1019 complement(22993..24168) [1176 bp, 391 aa] {ON}
           complement(22993..24168) [1176 nt, 392 aa]
          Length = 391

 Score = 31.6 bits (70), Expect = 8.7
 Identities = 55/233 (23%), Positives = 91/233 (39%), Gaps = 11/233 (4%)
 Frame = +1

Query: 58  SNALASQDVEFHKSID--TSVANSLEKSMKSMASVM--NNILLSIDNNNEKLDGTNENLE 225
           S  L+  D     SI   T + +S  ++ K+    +  NN+ +    NN + D     L+
Sbjct: 64  SEELSKNDEIIENSIKKVTEIISSFNEATKNSYKTISINNMAIPEYLNNFQWDNRKFKLD 123

Query: 226 EVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLN 405
           +  KE ++++     + D   D+    ++ N+ K N+        AE   +  +S   L+
Sbjct: 124 KSIKELNSLISNESTQLDN--DVKATAANYNNAKTNLA------TAERRKTGDLSVRSLH 175

Query: 406 -FKTPVD---NSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEH---FQQPYEYEIL 564
               P D   NSE      +LI  P +LKS  E     L  + +PE      +  EY + 
Sbjct: 176 DIVKPEDFILNSEY--LTTVLIAVPKSLKSDFEKHYETLTEKIVPESASIISEDAEYILY 233

Query: 565 NQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEH 723
           N       L KK      S            N  ++++  LKK  + A  LEH
Sbjct: 234 NVH-----LFKKSVAKFNSAARERKYIPREFNYSEELIDNLKKEHDSAASLEH 281

>TBLA0B01850 Chr2 complement(423278..424456) [1179 bp, 392 aa] {ON}
            Anc_8.215 YDR083W
          Length = 392

 Score = 31.6 bits (70), Expect = 8.7
 Identities = 17/59 (28%), Positives = 29/59 (49%)
 Frame = +1

Query: 1873 SNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEP 2049
            SN +  ++  + HN+ ++++        D +     KK K     +K KH+D DI EEP
Sbjct: 43   SNESKQIDDAQKHNENTEEVFEEAITNNDAENDATEKKSK----KRKRKHNDKDIKEEP 97

>TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON} Anc_8.295
            YLR106C
          Length = 4901

 Score = 32.0 bits (71), Expect = 8.8
 Identities = 23/94 (24%), Positives = 39/94 (41%), Gaps = 2/94 (2%)
 Frame = +1

Query: 103  DTSVANSLEKSMKSMASVMNNILLSIDNNNEKL--DGTNENLEEVCKEFSNVMDVLFEKA 276
            D ++ + L++  +S      N L    N  E +  D  NEN+E   KE     D+  E  
Sbjct: 4251 DINLDSDLDEENESATEESGNELGDTSNEEEDIGDDDNNENVETEIKEEGADSDIDEENV 4310

Query: 277  DRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPS 378
            +  ++  N  +  +DN  +   +DD     N  S
Sbjct: 4311 NSDIEEENNVAENDDNNVSDMDVDDAEEETNQNS 4344

>Kwal_14.2503 s14 complement(787175..788464) [1290 bp, 429 aa] {ON}
           YJL049W - Hypothetical ORF [contig 224] FULL
          Length = 429

 Score = 31.6 bits (70), Expect = 8.9
 Identities = 26/111 (23%), Positives = 54/111 (48%), Gaps = 6/111 (5%)
 Frame = +1

Query: 7   SDSGDNVLKKVMETVRASNALASQDVE-FHKSIDTSVANSLE---KSMKSMASVMNNILL 174
           S+ GD + +     +++    AS+D++  H      + N+L    K+++++  +MN+I  
Sbjct: 249 SNLGDRIAETKQAVIKSIQTDASRDIQRLHLRTQKMLENNLSITCKNLQNIEQLMNDIER 308

Query: 175 SIDN--NNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTND 321
           SIDN    E L  + + ++ V  +   V     E  ++ LD +N +   N+
Sbjct: 309 SIDNVQLGEALSKSRDIIKNVSAQVGGV-----ESIEKLLDEINIERLRNE 354

>Kwal_47.16881 s47 complement(156308..157603) [1296 bp, 431 aa] {ON}
            YLR449W (FPR4) - 60 kDa nuclear FK506 binding protein
            [contig 219] FULL
          Length = 431

 Score = 31.6 bits (70), Expect = 8.9
 Identities = 27/123 (21%), Positives = 53/123 (43%), Gaps = 17/123 (13%)
 Frame = +1

Query: 1894 ETEETHNKKSDQIQVIPEKQEDMD-------------EIVVLKKKKIHSNDQKAKHDDGD 2034
            E E++    S++  + P++ E +D             E++    +K  + ++K K  D +
Sbjct: 187  EEEDSEEYDSEEYDLTPDEDELLDDLEDASDVEGRIEELIQQDAEKNKNKNKKRKQADEE 246

Query: 2035 ----IVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKAAKKRRLVTKGKKIS 2202
                 VE+P +  KA        E KK + K+V +  +   +     ++ +   K KK+ 
Sbjct: 247  EEEKAVEQPQETKKAK-----KEEAKKVENKKVENKKAENKKTEAKKEETKKDKKEKKVE 301

Query: 2203 FKK 2211
            FKK
Sbjct: 302  FKK 304

>TPHA0G02140 Chr7 (442673..443995) [1323 bp, 440 aa] {ON} Anc_2.396
            YMR135C
          Length = 440

 Score = 31.6 bits (70), Expect = 9.0
 Identities = 39/176 (22%), Positives = 70/176 (39%), Gaps = 19/176 (10%)
 Frame = +1

Query: 1651 KEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEE-------SELKDRY 1809
            K++   + Q   S +   S   + ++LL+    + Y + S    +E        ++KD  
Sbjct: 45   KKLSKTIYQTGLSTRKTISEPSIPKLLLNYFVTMAYESASIRLAKELGIIESNKDIKDFL 104

Query: 1810 LSY-----IKATLLAASKNINMVLETSNSNAPLETEE------THNKKSDQIQVIPEKQE 1956
              Y      K  +L     I  V++  NSN  +E  E        NKKSD          
Sbjct: 105  NLYKIEERAKIMVLIKKGKIGKVIDEINSNFGIEVLELTEDRKASNKKSDDDLHFKLLLL 164

Query: 1957 DMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKAN-ILASDNREVKKKDKKRV 2121
            ++ E++        SND    +DD + +   V+Y++   IL   + E+  K+ + V
Sbjct: 165  NLIEMIRAHNNDTRSNDSIDPNDDSEFIMSLVEYAQNKLILKVSSNEIYMKELELV 220

>CAGL0F02849g Chr6 (277229..277975) [747 bp, 248 aa] {ON} similar to
           uniprot|Q04031 Saccharomyces cerevisiae YDR412w
          Length = 248

 Score = 31.2 bits (69), Expect = 9.1
 Identities = 35/147 (23%), Positives = 60/147 (40%)
 Frame = +1

Query: 169 LLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLD 348
           L  I+   +  D   + +EE  K+F + +D+  E      ++   +   ++ KK      
Sbjct: 64  LQKIEERKKIRDERKQQIEEQLKQFKSKLDIELE------EVAGDQDWEDNTKKKKNQKS 117

Query: 349 DVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIP 528
           +V   E +        Q + K   D+ +    KP+L  K NA+ S E S   V+  E + 
Sbjct: 118 EVKEEEEEEWEGFQSDQ-DTKIDEDDKDESGVKPIL--KKNAVAS-EYSDNTVVEIETL- 172

Query: 529 EHFQQPYEYEILNQEYNNDILEKKEPI 609
               +P E      E NN  LE+ E +
Sbjct: 173 ----EPNENFAYLAEVNNVKLEQSEKV 195

>CAGL0J11572g Chr10 complement(1124993..1126375) [1383 bp, 460 aa]
           {ON} similar to uniprot|P33895 Saccharomyces cerevisiae
           YOL069w NUF2 spindle pole body protein
          Length = 460

 Score = 31.6 bits (70), Expect = 9.1
 Identities = 31/156 (19%), Positives = 72/156 (46%), Gaps = 9/156 (5%)
 Frame = +1

Query: 169 LLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSL--------DILNRKSSTNDN 324
           L+ +++  E+L   N++ +++    +N +D L E+  + +        ++ N K + +  
Sbjct: 238 LIELESKKERLMNYNDDDQDLQNSLNNSIDRLTEEKKKQIGYVSKLEGNVSNLKVTVDTL 297

Query: 325 KKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQL 504
           +K ++ + D+    +   +   + +LN +           K  L EK   LK++ ES  +
Sbjct: 298 EKAIEHIYDILRLLSTDLQESHRAELNIEG---------IKGPLTEKRTRLKNLLESN-V 347

Query: 505 VLATEDIPEHFQ-QPYEYEILNQEYNNDILEKKEPI 609
           +   + + E       EY+ +N+E+  + LE K+ I
Sbjct: 348 IYKYDVLKEQLNVAETEYQRINEEHYRETLENKKLI 383

>Kwal_26.6745 s26 (47670..48218) [549 bp, 182 aa] {ON} YAL059W
           (ECM1) - putative transmembrane domain protein involved
           in cell wall biogenesis [contig 44] FULL
          Length = 182

 Score = 30.8 bits (68), Expect = 9.2
 Identities = 30/125 (24%), Positives = 57/125 (45%)
 Frame = +1

Query: 25  VLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLD 204
           ++KKV +  RA+  L ++D+E         A +L +  ++    + N L+   + NE+L 
Sbjct: 1   MVKKVSKHSRAARRLEAEDIE---------AQTLAQLPRAENVDLTNKLIRTASKNEQL- 50

Query: 205 GTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRR 384
                           ++   +K DRS  ++++K++T +  +NM   D +  A N  SR 
Sbjct: 51  ----------------LEAKMKKKDRSSKMISKKATTKNGPQNMDH-DRLERALNINSRL 93

Query: 385 ISKPQ 399
             K Q
Sbjct: 94  DGKVQ 98

>NCAS0J02210 Chr10 complement(427346..428107) [762 bp, 253 aa] {ON}
            Anc_4.366 YJR135C
          Length = 253

 Score = 31.2 bits (69), Expect = 9.2
 Identities = 39/171 (22%), Positives = 73/171 (42%), Gaps = 20/171 (11%)
 Frame = +1

Query: 1654 EIENQLTQATKSKQAMTSSVVLSEILLHPEHA---------VKYHNGSACSVEESELKDR 1806
            E  N+L +  K+K+       L++ LL PE +               SA S++  ++   
Sbjct: 49   ETRNELAEEEKAKREAIWEEFLNKPLLFPERSDPIGLSLATSSLTMRSASSMDVIKVMKD 108

Query: 1807 YLSYIKATLLAASK---NINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVV 1977
              + +K+ +    K   N++++LE+ NS+A    E   N+ +    V    +E  D I  
Sbjct: 109  NCTNMKSMVTYQRKINENLSLLLESMNSSATTTIESDSNETNIYKDVHTRNKELWDNIQS 168

Query: 1978 LKKKKIHSNDQK----AKHDDGDIVEEPVDYSK----ANILASDNREVKKK 2106
            + K+ +  +D+     A     DI++  V+Y      A+   S +RE   K
Sbjct: 169  IMKQYLFDSDENEDALACEAVWDILKRLVNYDPTLTFADFKFSSHRETLMK 219

>NDAI0C03260 Chr3 (740705..742180) [1476 bp, 491 aa] {ON} Anc_5.87
           YHR159W
          Length = 491

 Score = 31.6 bits (70), Expect = 9.3
 Identities = 42/227 (18%), Positives = 93/227 (40%), Gaps = 20/227 (8%)
 Frame = +1

Query: 100 IDTSVANSLEKSMKSMASVMNNILLSIDNNNEK-------------LDGTNENLEE--VC 234
           +DTS  NS   +  ++ +++  +    D+N++K                T E  EE    
Sbjct: 18  VDTSTRNSYRNTNDNVNNLLEEVKSYDDSNSDKRSKRHQPTVSLLQTTPTREECEEDHPL 77

Query: 235 KEFSNVMDVLFEKAD-----RSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQ 399
           K F+++ DV  E A+     RSL   +    T  N  + + ++ ++   ++P   +   +
Sbjct: 78  KNFNDIYDVAEETAEFNDFHRSLRTPDVYIHTEKNPTSTKSINVISRPNSNPRSSMMPKR 137

Query: 400 LNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYN 579
            +   P+  S S P   L ++     K+++ S+    +T  +  H       E L+   N
Sbjct: 138 RSLIQPMVISPSTPEDSLDVDIYQFTKAVKSSSS---STTKLQNHVPLGISTENLHSRTN 194

Query: 580 NDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 720
           +  L     +   +  D  ++  +  N  Q++++  +K  ++   L+
Sbjct: 195 STQLITANELSKQN--DIASLLTNLANKEQELLESKQKIEDLQKQLQ 239

>AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR310C
            (NOP58)
          Length = 513

 Score = 31.6 bits (70), Expect = 9.4
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +1

Query: 1987 KKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVK----KKDKKRVFDPYSSTGEGP 2154
            KKI  ++ +A + D D    P D + A+    +  E K    KKDKKR  +   +  E  
Sbjct: 417  KKIEISEARAYNADADAATAPADSTPADSDDEEEEEKKVKKDKKDKKRKREE-DAEEEDS 475

Query: 2155 KAAKKRRLVTKGKK 2196
            K +KK +   K KK
Sbjct: 476  KKSKKEKKEKKEKK 489

>ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {ON}
            highly similar to uniprot|Q12460 Saccharomyces cerevisiae
            YLR197W SIK1 Component of the small (ribosomal) subunit
            (SSU) processosome that contains U3 snoRNA
          Length = 513

 Score = 31.6 bits (70), Expect = 9.4
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 4/93 (4%)
 Frame = +1

Query: 1852 INMVLETSNSNAPLETEETHNKK----SDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAK 2019
            I   +E  N N P E  +  +KK    S++ +   E++ED  E     KKK+   D+K K
Sbjct: 427  IQEAIELYNENKPEEEPKQESKKRKHTSEEEEQSEEEEEDKKE-----KKKVKKEDKKDK 481

Query: 2020 HDDGDIVEEPVDYSKANILASDNREVKKKDKKR 2118
             +  +  E+     K      + +E K+K +K+
Sbjct: 482  KEKKEKKEKKEKKEKKE--KKEKKEKKEKKEKK 512

>KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {ON}
            Anc_8.787 YOR310C
          Length = 523

 Score = 31.6 bits (70), Expect = 9.4
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = +1

Query: 1957 DMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYS 2136
            D D +  + +K   S+D+ +  ++ ++ EE  +  +         + +KKDKKR  D   
Sbjct: 430  DADTVADVAEKSDDSDDESSDEEEEEVKEEKKEKKEKKEKKEKKEKKEKKDKKRKRDE-D 488

Query: 2137 STGEGPKAAKKRRLVTKGKK 2196
               E  K +KK +   K KK
Sbjct: 489  EDEEKLKQSKKDKKEKKDKK 508

>Skud_5.83 Chr5 (128050..129786) [1737 bp, 578 aa] {ON} YEL013W
           (REAL)
          Length = 578

 Score = 31.6 bits (70), Expect = 9.7
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 5/61 (8%)
 Frame = +1

Query: 166 ILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRS-LDIL----NRKSSTNDNKK 330
           IL  ++++N+K++   +N +++      + D  FE+  RS +D+     N  S++NDN  
Sbjct: 488 ILQLLESHNDKVENLVKNDDDIINGVRKMADATFERLQRSGIDVKNPGNNSNSNSNDNNS 547

Query: 331 N 333
           N
Sbjct: 548 N 548

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 31.2 bits (69), Expect = 9.8
 Identities = 26/86 (30%), Positives = 36/86 (41%), Gaps = 8/86 (9%)
 Frame = +1

Query: 79  DVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEK--------LDGTNENLEEVC 234
           D  F KSI T    +LE+ +  +    NN LLS  NNN           D  N  +E + 
Sbjct: 11  DNAFPKSISTKQGITLERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRKNPTVENII 70

Query: 235 KEFSNVMDVLFEKADRSLDILNRKSS 312
           K        +F+  D +L  L +K S
Sbjct: 71  K------TQIFQLIDENLGKLYKKKS 90

>NDAI0F00460 Chr6 complement(106641..108614) [1974 bp, 657 aa] {ON}
           Anc_5.677 YOR073W
          Length = 657

 Score = 31.6 bits (70), Expect = 9.9
 Identities = 44/196 (22%), Positives = 75/196 (38%), Gaps = 6/196 (3%)
 Frame = +1

Query: 130 KSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKS 309
           K++    SV  +I     N+NE    T+E+   +    S++MD    +     +   R  
Sbjct: 284 KTLSDPVSVTTDISTHYTNSNENTINTHEDTSNIGNYSSSIMDYSIPE-----ESFQRSR 338

Query: 310 STNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKT----PVDNSE--SHPFKPLLIEKPN 471
           +     K   F D  N + ND    I+   +N        +D+     H  KP  I+  N
Sbjct: 339 TVGTVHKTEVFRDTSNDSINDNVNDIATDGINVNNSGILQIDSQHKIKHSMKPPKIKNKN 398

Query: 472 ALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVD 651
            +      T    ++ D+   F +P        +Y    L  K   P+   VD  A  V 
Sbjct: 399 KIIDEVMPTSTHDSSHDL--DFIRPRRTRGKTIDYKLPSLRAKMRRPTEKLVD--ATTVT 454

Query: 652 NINSLQDMMQELKKSS 699
           N + LQ + ++LK+ +
Sbjct: 455 NFHDLQ-VTRKLKRDT 469

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 193,325,012
Number of extensions: 4268962
Number of successful extensions: 15795
Number of sequences better than 10.0: 231
Number of HSP's gapped: 15631
Number of HSP's successfully gapped: 237
Length of query: 738
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 621
Effective length of database: 40,065,477
Effective search space: 24880661217
Effective search space used: 24880661217
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 35 (18.1 bits)