Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02585g6.25ON73773739210.0
NCAS0H008606.25ON75575119870.0
KAFR0G026606.25ON73574119530.0
SAKL0E01452g6.25ON73774519410.0
KNAG0M012306.25ON73875219360.0
Suva_15.1766.25ON74574219240.0
Kpol_1037.296.25ON74676319140.0
YOR001W (RRP6)6.25ON73374118700.0
ZYRO0C07678g6.25ON74175518670.0
Smik_15.1706.25ON77375018660.0
Skud_15.1626.25ON73474518470.0
TPHA0J003706.25ON74375818320.0
TBLA0A071706.25ON77176218070.0
TDEL0G044406.25ON73574417960.0
KLLA0D01309g6.25ON74474817940.0
NDAI0D008506.25ON79050917950.0
ACL001C6.25ON74575017660.0
Ecym_30306.25ON74776317570.0
Kwal_56.224476.25ON73575017370.0
KLTH0C11066g6.25ON73574617200.0
SAKL0C06600g1.223ON222077820.41
KAFR0G004208.860ON37451752.1
Suva_14.433.61ON164242752.6
TPHA0L023105.11ON1092170733.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02585g
         (737 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...  1514   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   769   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   756   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   752   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   750   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   745   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   741   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   724   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   723   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   723   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   716   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   710   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   700   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   696   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   695   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   696   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   684   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   681   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   673   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   667   0.0  
SAKL0C06600g Chr3 complement(615551..622213) [6663 bp, 2220 aa] ...    36   0.41 
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     33   2.1  
Suva_14.43 Chr14 complement(68457..73385) [4929 bp, 1642 aa] {ON...    33   2.6  
TPHA0L02310 Chr12 complement(485671..488949) [3279 bp, 1092 aa] ...    33   3.9  

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score = 1514 bits (3921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/737 (100%), Positives = 737/737 (100%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
           AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
           QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540
           ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540

Query: 541 HKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELK 600
           HKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELK
Sbjct: 541 HKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELK 600

Query: 601 DRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVL 660
           DRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVL
Sbjct: 601 DRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEIVVL 660

Query: 661 KKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKA 720
           KKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKA
Sbjct: 661 KKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTGEGPKA 720

Query: 721 AKKRRLVTKGKKISFKK 737
           AKKRRLVTKGKKISFKK
Sbjct: 721 AKKRRLVTKGKKISFKK 737

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/751 (52%), Positives = 530/751 (70%), Gaps = 29/751 (3%)

Query: 9   VLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLD 68
           +L KV+ TVRA++ALA+QDV+F++SID  +A+SLE+S   +A ++N++LLSID N+E++D
Sbjct: 12  LLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSEQVD 71

Query: 69  GTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRR 128
           GT ENLE++ K+F N+MD LFEK+DRS+DI+ R    ++ +  MQ++D+ +  +  P ++
Sbjct: 72  GTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDLTPGKQ 131

Query: 129 ISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEIL 188
           I KPQL F TP+DN+ESHPF PLL EKP ALK +EES Q++   E  P H+ QPYEYEI 
Sbjct: 132 ILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEYEID 191

Query: 189 NQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYY 248
           +QEYN+ IL+KK+PIPSTSW D   IWVD ++ LQ +M +L+ S+EIAVDLEHHD+R+YY
Sbjct: 192 HQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYRTYY 251

Query: 249 GLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGLYI 308
           G+ CLMQISTR  DY++DT+ALR+DL++LN VF NP+ITKVFHGAFMDIIWLQRDLGLY+
Sbjct: 252 GITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLGLYV 311

Query: 309 VSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHF 368
           V LFDTFHAS+A+GLPKHSLAYLLEK+A FKTSKKYQLADWR RPLSKAM AYARADTHF
Sbjct: 312 VGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARADTHF 371

Query: 369 LLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVAN--IFTPVEKESPWR 426
           LLNIFDQMRN LI   KLAGVL+ESRNVA RRFEYS ++PK+   N  +++P+EK+ PW+
Sbjct: 372 LLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDDPWK 431

Query: 427 TLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVSV 486
           T+M+QYNIP  KEPL++ELY+WRD +ARRDDESPR+VMPNQLLVSLVAY P+D   VVSV
Sbjct: 432 TIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGVVSV 491

Query: 487 SSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDV----SQDELQFLPSHK 542
           S+ VTD+VR NSK LANLIK  L ++K  +    NN     + V      D  Q L  H+
Sbjct: 492 SNSVTDYVRSNSKILANLIKNCLAKMKDNKFLD-NNVAEEGISVVPETGHDLSQKLTIHQ 550

Query: 543 IELMTGAFKEIENQLTQATKSKQAMTSSVVLSE-ILLHPEHAVKYHNGSACSVEESELKD 601
           ++ +   F+ + ++   + K++ +    + L + I    +  +KY           + K+
Sbjct: 551 LQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGKIQTTAEQYKE 610

Query: 602 RYLSYIKA--TLLAASKNINMVLETSNS----NAPLETEETHNKKSDQIQVIPEKQEDMD 655
           R   +  A   L      I ++ E   +    N P  T  T+     Q+  + EK ED+D
Sbjct: 611 RSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATN--AEGQVNEMIEKPEDLD 668

Query: 656 EIVVLKKKKIHSNDQKAKHDDGDIVEEP----VDYSK-ANILASDNREVKKK----DKKR 706
           E++VL+K    +N  K+  +     EEP    +DY K A +L +D      +    +K++
Sbjct: 669 EVIVLRK----TNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRNNNGNKRK 724

Query: 707 VFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 737
            FDPYS+  EGP A KKR+ VT+GK +SFK+
Sbjct: 725 RFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/741 (52%), Positives = 517/741 (69%), Gaps = 27/741 (3%)

Query: 9   VLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLD 68
           +L  V+ TVRAS+ LA+QDV+F++S+D+ V++S+ +    +  ++N+I+LSID N E LD
Sbjct: 9   LLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLD 68

Query: 69  GTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRR 128
              E L E  K  SN++D LFEK+DRSLDIL   +         ++ ++    EN P +R
Sbjct: 69  EGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQKR 128

Query: 129 ISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEIL 188
           I+KPQL F  P+DNSESHPF PLL EKPNALK+I+EST+L+ + E++PEH+  PYEYEI 
Sbjct: 129 INKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEID 188

Query: 189 NQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYY 248
           NQ YN+ IL+ +EPIPS SW +T  +WVDN+ SL  M+ ++KK +EIA+DLEHHD+R+YY
Sbjct: 189 NQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYY 248

Query: 249 GLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGLYI 308
           G+VCLMQISTR  DY+VDTIALR+DLK+LNEVFT+P + KV HGAFMDIIWLQRDLGLYI
Sbjct: 249 GIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYI 308

Query: 309 VSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHF 368
           VSLFDTFHAS+ALG P+HSLAYLLE++ANFKTSKKYQLADWR RPLSKAM AYARADTHF
Sbjct: 309 VSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHF 368

Query: 369 LLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPWRTL 428
           LLNI+DQ+RN L+ + KL GVL ESRNVA RRFEYSK++P++P  N+++ +EKE PWRTL
Sbjct: 369 LLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRTL 428

Query: 429 MYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVSVSS 488
           M+QYNIP ++E L++ L+EWRDM+ARRDDESPRY+MPNQL+V+LVAY P DP  V+S S 
Sbjct: 429 MFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQ 488

Query: 489 VVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDE----LQFLPSHKIE 544
           VVTD+VR NSK +ANLIK       L   K  N +L    D    E       +   +I+
Sbjct: 489 VVTDYVRSNSKIIANLIKN-----ALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIK 543

Query: 545 LMTGAFKEIENQLTQATKSKQAMTSSV------VLSEILLHPEHAVKYHNGSACSVEESE 598
                F +I  +L      +Q   S         LS+ L      ++Y NG   SV++ +
Sbjct: 544 ETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKL----DIIEYKNGEKHSVKQQQ 599

Query: 599 LKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHN-KKSDQIQVIPEKQE-DMDE 656
           L  R+ +Y K   +    N+   L        L+ ++    KK+     IP K E D+DE
Sbjct: 600 LVSRFNTYTKQ--VNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDE 657

Query: 657 IVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKA-NILASDNREVKKKDKKRVFDPYSSTG 715
           +VVL  KK++    K K ++ + ++  +DYSK+  IL  D +  K++ KKR FDP++++ 
Sbjct: 658 VVVL--KKVNRQPNKTKLEENEKIDF-IDYSKSEKILKGDKQRKKRESKKRQFDPFAASN 714

Query: 716 EGPKAAKKRRLVTKGKKISFK 736
           EGPKAA+KR+  T+G+ +S+K
Sbjct: 715 EGPKAARKRKSGTRGRNLSYK 735

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/745 (51%), Positives = 525/745 (70%), Gaps = 18/745 (2%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           MSSD  D +L  ++ TVRA++AL++QD++F KS+D+ ++ S+E S   + +++N +LLSI
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           D NN+ ++   +N +E  K+  ++MD LFEK+D + D L R +S N    N+Q+LDD + 
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKR-NSINQGNSNVQYLDDSSR 119

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
           +  +PS+RI KPQLNFKTP+DN+ESHPFKPLL  KP+AL+ + E  +    TE+IP H+ 
Sbjct: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
            PY YEI  QEYN  IL+ ++PIPS  W DT+ +WVD   SLQ ++ EL+ + EIAVDLE
Sbjct: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQISTR +D++VDTIALR++L +LNE+FT+P + KVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLG+Y+VSLFDT+HAS++LGLP+HSLAYLLEK+A FKTSKKYQLADWR RPL+K M A
Sbjct: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YARADTHFLLNI+DQ+RN LI   KLA VL +SRNVA RRFEY+ ++PKI  A++F+P+E
Sbjct: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           K+ PWR LMYQYNIP+ +EPL+R+LYEWRD +ARRDDESPRYVMPNQLLVSLVA  P DP
Sbjct: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540
             V+SVS+ +TD+VR NSK L+NLIKK LE +K G+V S NN   S L+  +D  Q L  
Sbjct: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDV-STNNAGSSQLE-EKDLSQVLSI 537

Query: 541 HKIELMTGAFKEIENQLTQATKSKQAMTSSVVL--SEILLHPEHAVKYHNGSACSVEESE 598
            +I+ M   F  + +++ +A  +  +M    +L   + +   + AV Y   S   ++E++
Sbjct: 538 SQIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQ 597

Query: 599 LKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQED----- 653
           L++R L   +        +  + +  +      ET+E     S++  V    + D     
Sbjct: 598 LQERKLEVSEKLKEVQEPDFRLHVNVTTK----ETDEVSKDVSEKDDVNRASETDPLETN 653

Query: 654 MDEIVVLKKKKIHS-NDQKAKHDDGDIVEEPVDYSKA-NILASDNREVKKKDKKRVFDPY 711
            DEI+VLKKKK H   D+K   +  D+  EP+DY  A  +L +  +  K+K  KR FDPY
Sbjct: 654 KDEIIVLKKKKRHEPQDRKKVGNSTDV--EPMDYKNAEKLLGNSKKSSKQKTTKRRFDPY 711

Query: 712 SSTGEGPKAAKKRRLVTKGKKISFK 736
           +S   GP++AKKR+  T GK +SFK
Sbjct: 712 TSENVGPQSAKKRKKPTPGKNMSFK 736

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/752 (53%), Positives = 520/752 (69%), Gaps = 29/752 (3%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           M S+    +L K + TVRAS++L  QDV+F  ++D +VA+S+++    +  ++N+IL SI
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKN-MQFLDDVN 119
           D N++    + E + E  ++F+N+ D LFEK+DRS+DI+ + +  N    + +Q+LDD+ 
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 120 VAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHF 179
             ++   +RI+KPQL+F  PVDNSES PFKPLL EKPNALK ++ES Q+V ATE+IP H+
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 180 QQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDL 239
             PY+YEI NQEYNNDILE + PIPST W ++  +WVD+   LQ ++++LKK  E+A+DL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 240 EHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIW 299
           EHHD+RSYYG+VCLMQISTR  DY+VDTIALRD+L +LN+VFT+P++TKVFHGAFMDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 300 LQRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMM 359
           LQRDLGLYIVSLFDTFHASKALG PKHSLAYLLE  ANFKTSKKYQLADWR RPLSK M 
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 360 AYARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPV 419
            YARADTHFLLNIFDQMRN LI   KLAGVL ESR VA RRFEYSK++PK+   ++FTP+
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 420 EKESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVD 479
           EKESPWRTLM+QYN+  +KE L++ LYEWRD +ARRDDESPRY+MPNQLL+SL AY P D
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 480 PISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSI-----NNRLPSSLDVSQDE 534
           P+S+VSV+S VTD VR NSK LANLIK  +E  KLG   S      N   P  L +SQ  
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPFVLTLSQ-- 538

Query: 535 LQFLPSHKIELMTGAFKEI-ENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACS 593
                   I+ +   F ++ EN  + + +    +  S    + L   +  V Y++     
Sbjct: 539 --------IKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD-LSKGKVTVSYNDAKTTP 589

Query: 594 VEESELKDR---YLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEK 650
           V +S L+ R   +  Y+KA      K  ++V    +   P  T  T +  S  ++  P+ 
Sbjct: 590 VSQSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKN 649

Query: 651 -QEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKAN-ILAS---DNREVKKKDKK 705
            +EDMDEIVVL  KK+     K K +D D   E VDYSK + +L     D ++    +KK
Sbjct: 650 IKEDMDEIVVL--KKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKK 707

Query: 706 RVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 737
           R FDP+S+  EGPKA KKR+ VTKGK  SFK+
Sbjct: 708 R-FDPFSAISEGPKAPKKRKAVTKGKNASFKR 738

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/742 (50%), Positives = 524/742 (70%), Gaps = 20/742 (2%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           M+S++ D +L KV+  +RA+++LA+QDV+F++++D   +  L+     +  ++N I+LSI
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           D +++ L+   E + ++ K+F N+MD L EK+D SLD LNR S++N++  ++Q+L D + 
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
            ++ P++R+ KPQL FKTP+DNSESHPF PLL EKPNALK + +S +++   E+ P H+ 
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
            PYEYEI +QEYN +IL+ K  IPS  W  +  IW+++  +L+ M+++LK + EIAVDLE
Sbjct: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQ+STR +DY+VDT+ LR+DL +LNEVFTNP I KVFHGAFMDIIWL
Sbjct: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M A
Sbjct: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSKY+P  P + +++P E
Sbjct: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           KE+PWR LMYQYNI  ++E L+++LYEWRD++ARRDDESPR++MPNQLL +LVAY P+D 
Sbjct: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKS---INNRLPSSLDVSQDELQF 537
           I VVS+S+ VTDHVR+N+K LANLIK  L  +K    +S   ++++  S+       L+ 
Sbjct: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSA------SLEA 552

Query: 538 LPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHN-GSACSVEE 596
           +   +I  +   F    +      +S  +  SS++  +IL + E  + Y + G    V+ 
Sbjct: 553 ITVSQIRDIMDRFSVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKV 612

Query: 597 SELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDE 656
            +++DR   +  A  L   ++I   +E      P+  E++   K +     P K ED DE
Sbjct: 613 EDMRDRAQRFNSA--LVGLEDIKFEVEK-----PVNVEKSEMVKIETTPEPPTKIEDPDE 665

Query: 657 IVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYSSTG 715
           +VVLKKK+IH   Q AK  D    EE VDYSK  N+L+S   +  K+ +KR FDP  +  
Sbjct: 666 VVVLKKKRIHKK-QVAKRSDV-AAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFNDS 723

Query: 716 EGPKAAKKRRLVTKGKKISFKK 737
           EGP+A KK+R  T+GK +SFK+
Sbjct: 724 EGPRAPKKKRPTTRGKNVSFKR 745

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/763 (50%), Positives = 523/763 (68%), Gaps = 43/763 (5%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           MS D    +L  V+ TVRA+++LA+QDV+F++++D  ++ SL +S K + +++N +LLSI
Sbjct: 1   MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           + NNE+L+   E LE+  K+FSNVMD LFEK+DRSLDI+ R  ++NDNK   Q+L D   
Sbjct: 61  NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ 120

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
           ++++PS+R++KPQL F  PVDNSES PF PLL +KP+++KS  +S  ++  +E++P H+ 
Sbjct: 121 SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA 180

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
            PYE EI  QEYN  +L+  EP+ S  W ++ + WVD   +LQ M+ +LK+ +EIAVDLE
Sbjct: 181 HPYEVEIDKQEYNASVLQVAEPLKSQPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLE 239

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQISTR +D++VDT+ALRD+L +LNEVF +P I KV HGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWL 299

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLY+VSLFDT+HAS+ALG P+HSLAYLLEKYANFKTSKKYQLADWR RPLSK M A
Sbjct: 300 QRDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHA 359

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YARADTHFLLNI+DQ+RN LI   KLA VL ESRNVA RRFEYS+++PK+P   +FTP+E
Sbjct: 360 YARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIE 419

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           KE PWRTL+YQYN+P  K  L++ ++EWRDM+ARRDDESPRY+MPNQL++SLV Y P+DP
Sbjct: 420 KEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDP 479

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIK------LGEVKSINNRLPSSLDVSQDE 534
             V+SVS+V+TDHVR NSK +ANLIKK LE++K      L   ++I+ ++      + D+
Sbjct: 480 AGVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKF--ASDK 537

Query: 535 LQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSV 594
           L      +I+ MT  FKEI +  +   K        ++ S I L     V Y +     V
Sbjct: 538 LTI---SQIQNMTALFKEIASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVV 594

Query: 595 EESELKDR------YLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIP 648
              +L  R      +++    T LA    IN+      S+A +  EE   K+ + +   P
Sbjct: 595 TNEQLAGRAEEVEGFMNEANNTTLA----INI-----ESSAEMHVEEPEAKEKNALFSPP 645

Query: 649 ------------EKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDN 696
                       +  EDM++I+VLK  K  +N +  K   G   +E +DYSK + + S  
Sbjct: 646 ISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILS-- 703

Query: 697 REVKKKDKKRVFDPYSSTG--EGPKAAKKRRLVTKGKKISFKK 737
           +E ++  KKR  DP+      EGPKAAKKR+ + +GK +SFK+
Sbjct: 704 KEKRENSKKRKGDPFGEENGLEGPKAAKKRKQINRGKNVSFKR 746

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/741 (51%), Positives = 517/741 (69%), Gaps = 12/741 (1%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           M+S++ D +L +V+  VRA+++LASQDV+F+K++D   +  L+     +A + N I+LSI
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           D ++E  +   E++ ++   F N+MD L E +D SLD LN   ++     ++Q+L + + 
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
               P++R+ KPQL FK+P+DNSESHPF PLL EKPNALK + ES +LV   E+ P H+ 
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
            PYEYEI +QEY+ +IL+ +E IPS SW D+  IWVD    L+ M+++LK + EIAVDLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQISTR +DY+VDT+ LR++L +LNEVFTNP I KVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSKY+P  P + +++P+E
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           KESPW+ LMYQYNIP ++E L+RELY+WRD++ARRDDESPR+VMPNQLL +LVAY P D 
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDE--LQFL 538
           I VVS+++ VT+HVR+N+K LANLI+  L  IK    ++    +PSS +   D   L+ +
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEA--TPIPSS-ETKADGILLETI 537

Query: 539 PSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKY-HNGSACSVEES 597
              +I  +   F  + N     +++K    SS++L +IL   EH + Y  +G    V+  
Sbjct: 538 SVPQIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTE 597

Query: 598 ELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQEDMDEI 657
           +++ R  ++  A  LA  ++I   +E      P++ EE              + +++D++
Sbjct: 598 DIRIRAQNFKSA--LANLEDIIFEIEKPLV-VPVKLEEIKTVDPASAPNHSPEIDNLDDL 654

Query: 658 VVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYSSTGE 716
           VVLKKK I    Q AK + G   ++ VDYSK  NIL++   +  ++ KKR FDP SS   
Sbjct: 655 VVLKKKNIQKK-QPAK-EKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSN 712

Query: 717 GPKAAKKRRLVTKGKKISFKK 737
           GP+AAKKRR   KGK +SFK+
Sbjct: 713 GPRAAKKRRPAAKGKNLSFKR 733

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/755 (52%), Positives = 517/755 (68%), Gaps = 32/755 (4%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           M+ +S + +L KV+ TVRA+ ALA+QDV+F++S+D  VA SL+K+   + S++N+ LL I
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           D N+  L+G  E LE+  K+FSN+MD LFEK+DRSLDIL R  + +     + +LDD   
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAAR 119

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
           ++  P++RI KPQ+ F+ P+DN+E+HPFKPLL  KP+AL+ + +  +LV A EDIPEH+ 
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
           QPYEYEI NQEYN  IL+  EPIPS  W  +  +WVDN  SL  M+Q+LKKS+EIAVDLE
Sbjct: 180 QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQ+STR  DY+VDT+ALRDDL +LNEVF NPLI KVFHGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLYIVSLFDT+HAS+ALG P+HSLAYLLE +A+FKTSKKYQLADWR RPLSKAM A
Sbjct: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YARADTHFLLNI+DQ+RN LI   KLAGVL ESRNVA R F+YSKY+PK+P +++++PV+
Sbjct: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           +   W+ LM QYNIP++KE L++ LYEWRD +ARRDDESPRYVMPNQLL  LV Y P+DP
Sbjct: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLG----EVKSINNR----LPSSLDVSQ 532
             V+SVS  VTDHVR N+K LANLI K L++I       +V+S+ ++    L   L V Q
Sbjct: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQ 539

Query: 533 DELQFLPSHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSAC 592
            E Q    H    ++ AFK     L+Q T +    +SS++   IL  P   V Y      
Sbjct: 540 IESQVSQFHD---LSKAFK----GLSQGT-NSSNSSSSIIFGNILHAPCGFVGYGRSLKK 591

Query: 593 SVEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQ-------IQ 645
            V + +++ R L   +A     ++    + E  +  + L  E   +KK  +         
Sbjct: 592 PVTDKQIEKRKLELSEALEFIDAETATTIQE-EDRGSELTHEPADDKKVSENDESKKEEA 650

Query: 646 VIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKK 705
              E +ED +EI+ L  KK+    +K+K  +    EEP+DY K+  +     +  K  KK
Sbjct: 651 KETEPEEDKNEIITL--KKVKDRGKKSKRSNESEPEEPIDYKKSKKILE-TEKKSKSTKK 707

Query: 706 RVFDPYSST---GEGPKAAKKRRLVTKGKKISFKK 737
           R FDPY+++   G  PK  KKRR+  +GK  SFK+
Sbjct: 708 RAFDPYAASNDAGNAPKPKKKRRM-ARGKSASFKR 741

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/750 (49%), Positives = 518/750 (69%), Gaps = 30/750 (4%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           M+S + D +L KV+  +RA+++LA QDV+F+K++D      L+     +A + N I+LSI
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           D ++E  +  +E++  +  +F N+MD L E +D SLD LNR  ++  N  ++Q+L D + 
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
               P++R+ KPQL FKTP+DNSESHPF PLL EKPNALK + +S +L+   ++ P H+ 
Sbjct: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
            PYEYEI +QEY ++IL+ ++ IPS SW D+  IW+D +  L+ M++ELK   EIAVDLE
Sbjct: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQISTR +DY+VDT+ LR+ L +LNEVFT+P I KVFHGAFMDIIWL
Sbjct: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M+A
Sbjct: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSKY+P+IP + +++P+E
Sbjct: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           KE+PWR LMYQYNI  +KE L+++LY+WRD++ARRDDESPR+VMPNQLL +LVAY P+D 
Sbjct: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540
           I V+S+++ +T+HVR+N+K L NLIK  L  IK    +        S+  ++  L+ +  
Sbjct: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESM-TNEVSLEAITI 579

Query: 541 HKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKY-HNGSACSVEESEL 599
            +I  +   F  + N      ++K   T S++L  IL   E+ + Y +NG    V+  ++
Sbjct: 580 PQIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDI 639

Query: 600 KDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETH-----NKKSDQIQV--IPEKQ- 651
           + R  S+  A              ++  +  LE E+ H      KK ++I    +P+   
Sbjct: 640 RARAQSFNSAL-------------SNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSA 686

Query: 652 --EDMDEIVVLKKKKIH-SNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRV 707
             E+ D+IVVLKKK IH +    AK   G   E+ +DYSK  N+L+S + + +++ KKR 
Sbjct: 687 TIENPDDIVVLKKKNIHRTQSMNAKDTMG---EKAIDYSKIPNVLSSKSDQNRRQQKKRR 743

Query: 708 FDPYSSTGEGPKAAKKRRLVTKGKKISFKK 737
            DP  +  +GP+AAKK+R  T+G+ +SFK+
Sbjct: 744 SDPLFNDSDGPRAAKKKRPATRGRNVSFKR 773

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/745 (50%), Positives = 519/745 (69%), Gaps = 19/745 (2%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           M S++ D +  K+++ VRA+++LASQDV+F+K+++   +N L+     +  ++N I+LSI
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           D ++E  +   + +  + K+F N+MD L E +D SLD LN  +++  +   +Q+L D + 
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
            ++  ++R+ KPQL FK  +DNSESHPF PLL EKPNALK + ES +L  A E+ P H+ 
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
            PY YEI +QEY++D+L+ K+ IPS SW D+  IW+D    L  M+++LK +SEIAVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQ+STR +DY+VDTI LRD L +LNEVFT+PLI KVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLY+V LFDT+HASKA+GLP+HSLAYLLE +ANFKTSKKYQLADWR RPLSK M A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YARADTHFLLNI+DQ+RN LI S KLAGVL ESRNVA RRFEYSK++P+ P + +++P+E
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           KE+PWR LMYQYNI  +KE L+++LY WRD +ARRDDESPR+VMPNQLL +LVAY P+D 
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDE-----L 535
           I VVS+++ VT+HVR+N+K LANLI     E  LG +K  N +  +S+  S+ +     L
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLI-----ENALGNIKDTNKKT-TSITSSESKPDGISL 534

Query: 536 QFLPSHKIELMTGAFKEIENQLTQATKSKQA-MTSSVVLSEILLHPEHAVKYH-NGSACS 593
           + +   +I  +   F  + N      ++K    TSS++L + L   E  + Y   G+   
Sbjct: 535 EVITISQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNK 594

Query: 594 VEESELKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQED 653
           V+  ++K R   +  A  LA  +NI   LE   +  P   E+    + +    +P K E 
Sbjct: 595 VKVEDIKARAQKFNSA--LAGLENIMFELEKPVT-VPASVEKGEAVEIESAPELPSKAES 651

Query: 654 MDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSK-ANILASDNREVKKKDKKRVFDPYS 712
            D+I+VLKKKK+H   Q AK  D   V+E VDYSK  ++L+S   + +K+ +KR FDP S
Sbjct: 652 FDDIIVLKKKKMHKK-QPAKGKDM-TVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSS 709

Query: 713 STGEGPKAAKKRRLVTKGKKISFKK 737
           +  EGP+AAKK+R   +GK +SFK+
Sbjct: 710 NDSEGPRAAKKKRPAPRGKNMSFKR 734

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/758 (48%), Positives = 508/758 (67%), Gaps = 43/758 (5%)

Query: 6   GDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNE 65
            D +L  V+ +VRA++ALA+QDV+F++S+D  +A+SL  + + +  ++N+I+ S+D N+E
Sbjct: 3   ADELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSE 62

Query: 66  KLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDP 125
            L    ENL+E  K+  N++D LFE AD S+D L++ S  + N   M++L+D    E+D 
Sbjct: 63  GLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDN 122

Query: 126 SRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEY 185
             R+SKPQLNF  PVDNSE+HPF+PLL +KPNA+  ++E  ++V  TED P+H+ QPYE 
Sbjct: 123 VTRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYET 182

Query: 186 EILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFR 245
           EI  QEYN  +L+  +PIPS  W +T AIWVDN  SL  M+ ELK ++E+AVDLEHHDFR
Sbjct: 183 EIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFR 242

Query: 246 SYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLG 305
           SYYG+ CLMQISTR  DY+VDTIALRD L++LN VFT+P ITK+ HGAFMDIIWLQRDLG
Sbjct: 243 SYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLG 302

Query: 306 LYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARAD 365
           LYIVSLFDT+HAS+ALG P+HSLAYLLE++A+FKTSK+YQLADWR RPLSKAM AYARAD
Sbjct: 303 LYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARAD 362

Query: 366 THFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPW 425
           THFLLNIFDQ+RN LI   KLA +L ESR VA RRFEYSKYKP +P + +F+P E + PW
Sbjct: 363 THFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPW 422

Query: 426 RTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVS 485
           R+++YQYNIP  K  L++ L+EWRD +ARRDDESPRY+MPNQL+ SLV Y P +P  V+S
Sbjct: 423 RSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVIS 482

Query: 486 VSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSI------NNRLPSSLDVSQDELQFLP 539
           V+ ++TD VR N+K +ANLIK  LE++K   + +        ++  SS D+S  +++F+ 
Sbjct: 483 VNRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKFIV 542

Query: 540 SHKIELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESEL 599
           S + E +   +    + L   T SK+    S+V S+I    +  + Y  G+   + E +L
Sbjct: 543 S-QFENILEKYSSNNSNLNDVT-SKEG-KDSLVFSKIFNSRDDIITYDKGTKHLITEQQL 599

Query: 600 KDRYLSYIKATLLAASKNINMVLETSNSNA-PLETEETHNKKSDQIQVIP---------- 648
            DR             K ++  ++ +   A  +E ++TH +   Q    P          
Sbjct: 600 SDR------------QKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLP 647

Query: 649 -----EKQEDMDEIVVLKKKKIHSNDQ-KAKHDDGDIVEEPVDYSKAN-ILASDNREVKK 701
                E+QED+DEI+VLK  K   N Q + +    D     +DYSK + IL+ DNR  ++
Sbjct: 648 AFEDKEEQEDLDEIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILSQDNR--RR 705

Query: 702 KDKKRVFDPYSSTG--EGPKAAKKRRLVTKGKKISFKK 737
              KR +DP+S+       + AK+RR   K + +SFK+
Sbjct: 706 TPNKRKYDPFSADNNENALQGAKRRRPTAKNRNVSFKR 743

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/762 (50%), Positives = 511/762 (67%), Gaps = 41/762 (5%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           MS D+ + +L+ ++  VRAS ALA+QDV+F+KS+D  V++SL K+      + N++LLSI
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           D N   L+   + + +    FSN+MD L EK+D  +D L++ ++ N       FLD+ + 
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
             ++PS+RI KPQL F  PVDN++S PFKPLL+EKPNALK +++S  LV  +  +P H+ 
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
           QPYEYEI NQEYN +++E ++P P   W  T+AIW+D   SL D++ +L+K SEIAVDLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD RSYYG+ CLMQISTR QDYIVDTI+LRDDL +LNE+FTNP ITKVFHGA MDIIWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLYIVSLFDTFHASKALGL +HSLAYLLE YA+FKTSKKYQLADWRRRPL+  M+A
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YAR+DTHFLLNIFDQ+RN LI   KLAGVL ESRNVA RRFEY K++P +P+ N++T +E
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           KE+PW++L+ QYNI  +KE L+++L+EWRDM+ARRDDESPRY+MP Q+L+SL++Y P D 
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINN--RLPSSLDVSQDELQFL 538
             V+SVS++VT+HVR NS TLANLIKK LE       KSI N     S+ ++S+ +    
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALE-----STKSIPNSSDSSSTFNMSRTDTNVA 560

Query: 539 PSHKIELMTGAFKEIENQLTQATKSKQAMT-----SSVVLSEILLHPEHAVKYHNGSACS 593
               I  +     +  N L++   + + +T     SS++ S I+        Y      S
Sbjct: 561 SLISITEINNICLKF-NSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTS 619

Query: 594 VEESELKDRYLSYIKATLLAASKNINMV----------LETSNSNAPLETEETHNKKSDQ 643
            +  ++  R++  +   L   S N + +          +E +  N P+ T E    KS Q
Sbjct: 620 FKSEDMIARHIR-LSEGLKGLSANNSFIYQPPVEDIKSIEITTEN-PIPTLE---PKSTQ 674

Query: 644 IQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHD---DGDIVEEPVDYSKA-NILASDNREV 699
            +   E  ED +EI+VL  KK++   QK K D   D  +V   VDYSKA  I    +  +
Sbjct: 675 KKTTKEINEDNEEIIVL--KKVNRKYQKGKKDADKDSTVV---VDYSKAKKIFQKKDETI 729

Query: 700 KKKDKKR-VFDPYSSTGEG---PKAAKKRRLVTKGKKISFKK 737
               KKR  FDPY++ G+    P+A KKR+  T+GK IS+K+
Sbjct: 730 NGNSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/744 (49%), Positives = 501/744 (67%), Gaps = 28/744 (3%)

Query: 7   DNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEK 66
           D +L+KV++T+RAS+ALA+QDV+FH+S+   +  SL+++   M S++N++L SID N+E 
Sbjct: 7   DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEP 66

Query: 67  LDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPS 126
           L    E L E  K+FSN+MD LFE +D S DIL R   +  + + ++FLD+ +  ++ PS
Sbjct: 67  LVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPS 126

Query: 127 RRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYE 186
           +RISKPQLNFK PV+N+E  PF PLL EKP AL+ +   + +V   + +PEH+ QPYEYE
Sbjct: 127 KRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYEYE 184

Query: 187 ILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRS 246
           I +QEY   ++ K EPIPS  W  T A+WVDNI  L+ M+ +LK  +EIAVDLEHHD+RS
Sbjct: 185 IEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRS 244

Query: 247 YYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGL 306
           YYG+VCLMQISTR +DY++DTIALRDDL++LNEVF NP I KVFHGAFMDIIWLQRDLGL
Sbjct: 245 YYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGL 304

Query: 307 YIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADT 366
           Y+VSLFDTFHAS+A+GLP+HSLAYLLEK+ANFKTSKKYQLADWR RPLSKAM AYARADT
Sbjct: 305 YVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADT 364

Query: 367 HFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPWR 426
           HFLLNI+DQ+RN LI   KLAGVL ESRNVA RRFEYSK++P  P   ++ P++K  PW+
Sbjct: 365 HFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWK 424

Query: 427 TLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVSV 486
            LM+QY+I  ++E L+++LY+WRD +ARRDDESPRYVMPNQLLV L    P +PI+V+SV
Sbjct: 425 VLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISV 484

Query: 487 SSVVTDHVRRNSKTLANLIKKKL----EEIKLGEVKSINNRLPSSLDVSQDELQFLPSHK 542
           +S+VTDHVR NS  LA+LIK  L    +E   G  ++ NN        S D    L   +
Sbjct: 485 NSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNN--------STDAASLLTVPQ 536

Query: 543 IELMTGAFKEIENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELKDR 602
           I+ +   F  +    T      +   SS + ++IL   + AV Y   +   + + EL  R
Sbjct: 537 IQKLAACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKR 596

Query: 603 YLSYIKAT-----LLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPE-KQEDMDE 656
               +++        +    I  + + SN+      EE      ++++  P   +EDMDE
Sbjct: 597 AAKALQSMEQFDEATSYYMPIPEIAKESNT-----MEEIRPPAPEEVKESPSPPKEDMDE 651

Query: 657 IVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSS--- 713
           I+ LKK K   +    +    +     VDY+K   + + N++  K  KKR FDPY++   
Sbjct: 652 IITLKKIKKQKSQSPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKFDPYAASNH 711

Query: 714 TGEGPKAAKKRRLVTKGKKISFKK 737
           + + P+A KKR+ V + + +SFK+
Sbjct: 712 SSDAPRAPKKRKPVNRERNVSFKR 735

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/748 (49%), Positives = 513/748 (68%), Gaps = 15/748 (2%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           MSS+  D +L  +++TVR+S+ALA+QD++F+KS+D+++  SLE +  ++ S++N++LLSI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           D NN+ +    ++  +  K  SN+MD LFEK+D +LD +   +  N    ++++L+D + 
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
           + N PS+RI KPQL+FKTPVDN+E HPFKPLL  KP++L+  E S ++V   E IP H+ 
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
            PYEYEI +Q+YN+ IL   EPIPS  W +T AIWVD +  L  M  EL K++E+A+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQIS R  D+IVDTIALR++L +LN++FT+P +TKV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLYIV LFDT+HAS+ LG PKHSLAYLLE++ANFKTSKKYQLADWR RPL+K M+A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YARADTHFLLNIFD++RN L+   K++ VL ESR VA RRFEYS ++PK+P + +F+P+E
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
           K+ PW+ +M+QYNIP  KE L+R LYEWRD +ARRDDESPRYVMPNQLLVSLVA  P +P
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540
           I+V+SVSS V++H+R NSK +ANLIK+ LE++K     S    L S+     D    + +
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 541 HKIELMTGAFKEIENQL-TQATKSKQAMTSSVVLSEIL-LHPEHAVKYHNGSACSVEESE 598
            +I+ +   F  + +++ +Q   ++Q    SV+ + I  L    AV+Y   +   + + E
Sbjct: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE 600

Query: 599 LKDRYLSYIKATL---LAASKNINMVLETSNSNAPLETEETHNKK----SDQIQVIPEKQ 651
           L  R    I  TL       +  ++VL ++   AP +     N+     SD  Q   E +
Sbjct: 601 LLKRQHE-ITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQ--EEIE 657

Query: 652 EDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANIL--ASDNREVKKKDKKRVFD 709
           E+ DE++ L+K++  SN+ K K        E +DY+  + L  ++ N    +K KKR FD
Sbjct: 658 ENKDEVITLRKRQSQSNN-KRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFD 716

Query: 710 PYSSTGEGPKAAKKRRLVTKGKKISFKK 737
           PYS    GP+  KK+    KGK +SFK+
Sbjct: 717 PYSVEHVGPQPIKKKSKPAKGKNVSFKR 744

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/509 (66%), Positives = 419/509 (82%), Gaps = 2/509 (0%)

Query: 7   DNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEK 66
           D +L +V++TVRAS ALA+QDV+F++S+D + A +L+++   +A ++N++LL++D N+E 
Sbjct: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85

Query: 67  LDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPS 126
           LDGT ENLE+  K+FSN+MD L EK+DRS+D+L R  +TN N  NMQ+LD+ +  ++  S
Sbjct: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145

Query: 127 RR--ISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYE 184
           +R  I KPQL F  PVDN+E+HPF PLL  KPNALKS++ES QL+   E++PEH+ QPYE
Sbjct: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205

Query: 185 YEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDF 244
           YEI NQ YN+ IL+  +PIPS  W++T AIWVD   SLQ M+++L   +E AVDLEHHD+
Sbjct: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265

Query: 245 RSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDL 304
           R+YYG+VCLMQISTRTQDYIVDT+ LR  L+ LNE FTNP ITKV HGAFMDIIWLQRDL
Sbjct: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325

Query: 305 GLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARA 364
           GLYIVSLFDTFHAS+ALG PK+SLAYLLEK++NFKTSKKYQ+ADWR RPLSKAM +YAR+
Sbjct: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385

Query: 365 DTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESP 424
           DTHFLLNIFDQMRN L+  GKLAGVL+ESRNVA RRFEY KY+P I  + +++P+EK  P
Sbjct: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445

Query: 425 WRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVV 484
           W+TLMYQYNIP+ KE L++ELY+WRD +ARRDDESPRY+MPNQLLVSLVAY PV+P  VV
Sbjct: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505

Query: 485 SVSSVVTDHVRRNSKTLANLIKKKLEEIK 513
           SVS++VTDHVR NSK LANLIK  L +IK
Sbjct: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIK 534

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/750 (48%), Positives = 493/750 (65%), Gaps = 19/750 (2%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           M+S   D + K+++ T+RA+ AL++QD++F++S+  SV   L+ +  ++ S++N +LLS+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120
           D NN +L    +N E+  KE SNVMD +FEK+D + D +   SS+ +   NMQ+L D + 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180
            ++ PS+RI KPQL FKTPVDN+E HPFKPLL EKP+ALK +EES  L    E++P H+ 
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240
            PYEYEI  Q YN+ +LE +E I    W  T  IWVDN+ SL  M+ ELK+  E+AVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300
           HHD+RSYYG+VCLMQIS+R++D++VDTIALRDDL +LN +  +P + KVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360
           QRDLGLY+VSLFDT+HAS+ALG PKHSLAYLLE +A FKTSKKYQLADWR RPL K +  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420
           YAR+DTHFLL+I+D +RN L+ +GKLA VL  SRNVA RRFEY+ ++P+IP +N+++P+E
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480
              PWR LMYQYN+P  KEPL+++LYEWRD +ARRDDES RYVMPNQLLVSLV+  P + 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540
             V+SVS+ VTD+VR N++TLANLIK+ LE IK G          SS     +    L  
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVA--EFSSSERALSNPAATLSL 538

Query: 541 HKIELMTGAFKEI--ENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESE 598
           H I+ +   F+ +  E Q    +   Q  +S +  S++   P  AV+Y NG    + ++ 
Sbjct: 539 HMIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPS-AVEYTNGQKHVIGDNV 597

Query: 599 LKDR---YLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQE--- 652
           L+ R    L    +  +    +I      S+S  P  +E+    +  + Q   +K E   
Sbjct: 598 LQTRKHALLQKFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEPDF 657

Query: 653 DMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKA------NILASDNREVKKKDKKR 706
           +  EIVVL+KKK  ++ QK K       E  VDYS A         ++  R  K + +KR
Sbjct: 658 EKSEIVVLRKKK-KAHAQKPKGTSSSPTET-VDYSNAKEVLGKGTSSTAKRGDKDRPRKR 715

Query: 707 VFDPYSSTGEGPKAAKKRRLVTKGKKISFK 736
            FDPY      P   KK+   +KGK ISFK
Sbjct: 716 KFDPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/763 (48%), Positives = 500/763 (65%), Gaps = 42/763 (5%)

Query: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60
           MSSD+ D +L K++ TVRA+++LA+QD++F + +D SV   L+++ + + S++N ++LS 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKK--NMQFLDDV 118
              N  L+   +NLE   K+ SN++D LFEK+D SLD+L +  S++ ++   NMQ+L+  
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 119 NVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEH 178
           +  +   S+RI KPQL FK PVDNSE HPFKPLL  KP+ALK +EE + L + TE +P H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 179 FQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVD 238
           +  PYEYEI NQ Y++ +L  KEPI  ++W +   IWVDNI +L DM+  LK   EIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 239 LEHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDII 298
           LEHHD+RSYYGLVCLMQISTR  D++VDTIALR DL++LNE+FT+P I KVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 299 WLQRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAM 358
           WLQRDLGLY+VSLFDT+HAS+ALG PKHSLAYLLE +ANFKTSKKYQLADWR RPLSK M
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 359 MAYARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTP 418
             YARADTHFLLNI+D++RN LI   KL+GVL  SRNVA RRFEY+ ++PK+    +F+P
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 419 VEKESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPV 478
           +EK+ PWRTLM QYN+P  KEPL+R+LY+WRDM+AR+DDES RYVMPNQLLVSLV   P 
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 479 DPISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLG--EVKSINNRLPSSLDVSQDELQ 536
           DP  +++V S + DHVR N++ L N+I K +EEIK G  E +SI N   + +     E+ 
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540

Query: 537 FLPSHKIELMTGAFKEIENQL-TQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVE 595
                 I+ M   FK + +++ + A +       S++    L     AV Y++     V 
Sbjct: 541 V---SLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVN 597

Query: 596 ESELKDR-------YLSYIKATLLAASKNINMVLETSNSNAPLET---------EETHNK 639
           + EL DR       +    KA  +A   +I  +  +SNS  P +T         EE+ N 
Sbjct: 598 DRELLDRKSDLSQKFSKVFKAAGIAIGSHIEKL--SSNSELPADTTSNVESPSKEESKNN 655

Query: 640 KSDQIQVIPEKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREV 699
             D        +ED  EI+VLK+K+ + ++ K+        +E VDY+  N +  +  + 
Sbjct: 656 SDDL-------KEDKHEIIVLKRKRDYGSNTKSTSKQPK--KEHVDYNNVNSILDNTSQQ 706

Query: 700 KKKDK-----KRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 737
            K +      KR F        G  A KK R  +KGK +S+KK
Sbjct: 707 DKPNSGRHVDKRKFHSDLQGSIGAAAIKKPR--SKGKTVSYKK 747

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/750 (46%), Positives = 496/750 (66%), Gaps = 38/750 (5%)

Query: 4   DSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNN 63
           D   ++L +V+ T+RAS+A+++QDV+F+KS+D++++ SL+++   + S++N++++SID+N
Sbjct: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDN 66

Query: 64  NEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAEN 123
           N+ ++     LE        VMD+LFEK++ +L  + +K S N    N+Q+LDD     +
Sbjct: 67  NDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGS-NIIGNNLQYLDDSQPLTD 125

Query: 124 DPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPY 183
               +I+KPQ +F  PVDN+ESHPFKPLL++KPNAL+ +++  QL +  E IP H+  PY
Sbjct: 126 TTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPY 185

Query: 184 EYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHD 243
           EYEI +QEY+  +LE + PIPS  W +T+A WVDN+ +L DM++EL K+ E+A+DLEHHD
Sbjct: 186 EYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHD 245

Query: 244 FRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRD 303
           +R+YYG+ CLMQISTR  D++VDTIALRD L +LNE+FTNP + KVFHGAFMD+IWLQRD
Sbjct: 246 YRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRD 305

Query: 304 LGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYAR 363
           LGLY+VSLFDTFHAS+ LG PKHSLAYLLE+YA+FKTSKKYQLADWR RPLSK + AYAR
Sbjct: 306 LGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYAR 365

Query: 364 ADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKES 423
           ADTHFLLNI+DQMRN LI  GKLA  L  SR VA RRFEY+K++P +  + +++PVE+E 
Sbjct: 366 ADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERED 425

Query: 424 PWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISV 483
           PWR+L++ YNIP  K  L++ LYEWRD +ARRDDESPRYVMPNQLLV+LV   P D   +
Sbjct: 426 PWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGL 485

Query: 484 VSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPSHK- 542
           +SV+S VT+HVR N+K+L+ LIKK L                S  D+  D++  + S+K 
Sbjct: 486 LSVTSFVTEHVRSNAKSLSQLIKKTLA---------------SPQDLFTDQINHMDSNKS 530

Query: 543 ---IELMTGAFKEIENQLTQATKSKQAMT--SSVVLSEILLHP------EHAVKYHNGSA 591
               +L  G  K       Q T+  + +      V+    L P      E  V Y     
Sbjct: 531 MVDSKLSPGDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQV 590

Query: 592 CSVEESELKDRYLSYIKATLLAASKNINMVLETS--NSNAPLETEETHNKKSDQIQ--VI 647
             +E + L DR    + A  +  + N+   L+ +   + AP  ++E    ++ ++    +
Sbjct: 591 HHIEPTVLDDR--RELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTV 648

Query: 648 PEKQEDMDEIVVLKKKK-IHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKR 706
            + +ED DEIVVLK++K +  +    K+ +G+  +E +D+     + +    V +K  KR
Sbjct: 649 SQLKEDKDEIVVLKRRKALPQSSSPPKNAEGN-PKEILDFKNNKKIMTATASVPRKSTKR 707

Query: 707 VFDPYSSTGEGPKAAKKRRLVTKGKKISFK 736
            FDPY+    GP   K+R+  T+G + SFK
Sbjct: 708 -FDPYAIQASGPDGVKRRK-KTRGIQKSFK 735

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/746 (47%), Positives = 495/746 (66%), Gaps = 28/746 (3%)

Query: 2   SSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSID 61
            S+ G +VL +V+ T+RAS+A+ +QDV F+K++D S+A S+      +  ++N+ILLS+D
Sbjct: 6   GSEDG-SVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVD 64

Query: 62  NNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVA 121
            NN+ ++  +E LE        VMD+LFEK++ +L     K    +  K +Q+LDD    
Sbjct: 65  ENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL-AAGEKRDNGELSKTVQYLDDSPSL 123

Query: 122 ENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQ 181
            +   ++I KPQL FK P+DNSESHPFKPLL +KP+AL+S++ES +L    ED+P H+ Q
Sbjct: 124 HDGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQ 183

Query: 182 PYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEH 241
           PYEYEI +QEYN  +L+  EP+PS  W +T A WVDN ++L+ M+ EL  ++EIA+DLEH
Sbjct: 184 PYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEH 243

Query: 242 HDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQ 301
           HD+R+YYG+ CLMQISTR +D+++DTIALRDDL +LNEVFT+P ITKV HGAFMDIIWLQ
Sbjct: 244 HDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQ 303

Query: 302 RDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAY 361
           RDLGLYIVSLFDT+HAS+ LG PKHSLAYLLE+YA+FKTSKKYQL+DWR RPL KA+ AY
Sbjct: 304 RDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAY 363

Query: 362 ARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEK 421
           ARADTHFLLNI+D MRN LI   KL+ VL +SRNVA RRFE++ ++PKI  +++F+P+E+
Sbjct: 364 ARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIER 423

Query: 422 ESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPI 481
           E PWRTLM+QYNIP  K  L+R LYEWRDM+ARRDDESPRYV+PNQLLVSL    P  P 
Sbjct: 424 EDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPA 483

Query: 482 SVVSVSSVVTDHVRRNSKTLANLIKKKLEEIK------LGEVKSINNRLPSSLDVSQDEL 535
            +++ S+ VT+H+R+N+K+LA LIKK LE         L    ++ N  P+ +       
Sbjct: 484 LIMATSTFVTEHIRQNAKSLALLIKKSLESSSNEFGQLLNSANTVQNSSPTKMS------ 537

Query: 536 QFLPSHKIELMTGAFKEIENQLTQATKSKQAMT-SSVVLSEILLHPEHAVKYHNGSACSV 594
               S  IE  +  F++     +    +   ++  S +  +  +  E  V Y    A  V
Sbjct: 538 ----SEDIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLV 593

Query: 595 EESELKDRYLSYIKATLLAASKNI---NMVLETSNSNAPLETEETHNKKSDQIQVIPEKQ 651
           + + L++R     K     A ++I    + +  ++S+A  + E          +    ++
Sbjct: 594 DHNSLENRRHQVSKK--YEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARK 651

Query: 652 EDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKAN-ILASDNREVKKKDKKRVFDP 710
           E+MDE++VLK++K  ++ ++   D      EP+D   A  IL + +  V++  K+  FDP
Sbjct: 652 EEMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKKR--FDP 709

Query: 711 YSSTGEGPKAAKKRRLVTKGKKISFK 736
           Y++   GP + KKR+  TKG + SF+
Sbjct: 710 YATLAAGPPSVKKRK-KTKGLQKSFR 734

>SAKL0C06600g Chr3 complement(615551..622213) [6663 bp, 2220 aa] {ON}
            highly similar to uniprot|P07259 Saccharomyces cerevisiae
            YJL130C URA2 Multifunctional carbamoylphosphate
            synthetase (CPSase)-aspartate transcarbamylase (ATCase)
            that catalyzes the two first reactions of the pyrimidine
            pathway; carbamoyl-phophate synthetase, aspartate
            transcarbamylase, and glutamine amidotransferase and
            gnl|GLV|KLLA0E15444g Kluyveromyces lactis
          Length = 2220

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 293  AFMDIIWLQRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKY---ANFKTSKKYQLADW 349
            AF+D+  ++ +LG  +  +  TF      G P HSL  LL+ Y    N  + K+ +L + 
Sbjct: 2049 AFLDLFTIREELGT-VNGITVTFMGDLKYGRPVHSLCRLLQHYQVRINLVSPKELRLPNG 2107

Query: 350  RRRPLSKAMMAYARADT 366
             RR L+ A +     DT
Sbjct: 2108 LRRELADAGLLGVENDT 2124

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 323 LPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHFLLNIF 373
           L K  L  L  +  NF  + +YQ+A W+ R  ++    +   D HF  NIF
Sbjct: 112 LVKGDLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSCFGLNDIHFCRNIF 162

>Suva_14.43 Chr14 complement(68457..73385) [4929 bp, 1642 aa] {ON}
            YNL297C (REAL)
          Length = 1642

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 4/42 (9%)

Query: 576  ILLHPEHAVKYHNGSACSVEESELKDRYLSYIKATLLAASKN 617
            I L+PEH   + N +ACS+E S L    L+++K  LL++S N
Sbjct: 1108 IKLYPEHFKDFKNNTACSMEWSIL----LNFMKKLLLSSSNN 1145

>TPHA0L02310 Chr12 complement(485671..488949) [3279 bp, 1092 aa]
           {ON} Anc_5.11 YMR308C
          Length = 1092

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 75/170 (44%), Gaps = 27/170 (15%)

Query: 148 FKPLL-IEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPST 206
           F PLL I  P+ L++ + +  + L  E+  E+FQQ  E+E++        ++ K     T
Sbjct: 619 FMPLLPIVLPSLLETAKATQDVSLIDEEEAENFQQYSEWEVVQ-------VQGKHIAIHT 671

Query: 207 SWVDTNAIWVDNINSLQDMMQELKKS------SEIA---VDLEHHDFRSYYG-------L 250
           S +D     ++ I     M++ L         +EIA   +D   HD     G       L
Sbjct: 672 SVLDDKVTAMELIQVYSTMLKNLFAPYVKEILTEIAIPSIDFYLHDGVRATGANLIPVLL 731

Query: 251 VCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPL--ITKVFHGAFMDII 298
            CL+       + ++    +  D K++  + + P+  IT+++H A +D I
Sbjct: 732 SCLISAVGNENEEVLQLWKVAAD-KLIGGILSEPMPEITQIYHSALVDGI 780

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,189,196
Number of extensions: 3968498
Number of successful extensions: 17783
Number of sequences better than 10.0: 401
Number of HSP's gapped: 18834
Number of HSP's successfully gapped: 430
Length of query: 737
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 620
Effective length of database: 40,065,477
Effective search space: 24840595740
Effective search space used: 24840595740
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)