Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02541g6.26ON34234217350.0
TDEL0G044306.26ON3472387591e-98
Kpol_1037.306.26ON3672907566e-98
KLTH0C11110g6.26ON2802427349e-96
Kwal_56.224436.26ON2802267243e-94
ZYRO0C07634g6.26ON3822347324e-94
Suva_15.1746.26ON2952347193e-93
YOL001W (PHO80)6.26ON2932337141e-92
Skud_15.1616.26ON2932377044e-91
Smik_15.1696.26ON2912356941e-89
SAKL0E01408g6.26ON3072266882e-88
KNAG0I017506.26ON3242516883e-88
TPHA0J003806.26ON3562486904e-88
KLLA0D01287g6.26ON3452186895e-88
ACR001C6.26ON3462336755e-86
Ecym_30296.26ON3512336687e-85
TBLA0A071606.26ON2682366554e-84
NCAS0D021506.26ON3692325593e-68
NDAI0C026406.26ON4272475494e-66
Smik_9.1407.240ON2851602023e-17
YIL050W (PCL7)7.240ON2851602005e-17
Suva_9.1497.240ON2861601962e-16
Skud_9.1197.240ON2851571919e-16
SAKL0F08602g7.240ON4741621799e-14
Ecym_43367.240ON3851581789e-14
ADL075W7.240ON2071581684e-13
Kwal_23.58077.240ON4651101665e-12
KLTH0A04268g7.240ON5801101665e-12
NCAS0E032207.240ON3411881602e-11
KAFR0I018407.240ON3251191602e-11
CAGL0M12342g7.240ON4571191612e-11
NCAS0A134807.240ON4481201603e-11
KAFR0L008807.240ON3131211556e-11
KNAG0D016307.240ON4381761559e-11
KLLA0C08305g7.240ON4091831532e-10
TPHA0C010907.240ON3851411513e-10
NDAI0A025607.240ON5031191504e-10
TDEL0H020207.240ON3631901486e-10
KNAG0L014707.240ON3541211461e-09
ZYRO0C08118g7.240ON4052011443e-09
Kpol_2000.147.289ON3101581254e-07
Smik_5.1897.240ON415601193e-06
Suva_5.1677.240ON424601193e-06
NDAI0E047707.240ON303571165e-06
Kpol_1033.137.240ON250601155e-06
YER059W (PCL6)7.240ON420671175e-06
Skud_5.1737.240ON420601176e-06
TBLA0D040707.240ON661601176e-06
NCAS0A137707.289ON3121421112e-05
SAKL0F09856g7.289ON3351321086e-05
Suva_14.503.70ON279971076e-05
CAGL0J09328g7.289ON2971521068e-05
CAGL0E02233g3.70ON266991051e-04
Suva_4.687.289ON3051651042e-04
TBLA0C048507.289ON3682031042e-04
Kwal_23.60067.289ON3041491032e-04
Kpol_1020.87.289ON2961401032e-04
KLTH0A05346g7.289ON3011421014e-04
TPHA0P008107.289ON2471121004e-04
Skud_14.483.70ON279991005e-04
Smik_14.423.70ON27997996e-04
YNL289W (PCL1)3.70ON27997996e-04
Ecym_80387.289ON314112996e-04
ZYRO0C09284g7.289ON311113997e-04
TBLA0J006507.289ON363132997e-04
AFR159C7.289ON308110998e-04
TDEL0H015507.289ON309151970.001
KNAG0A014903.70ON26297960.001
Kpol_1020.163.70ON282106960.002
Skud_4.797.289ON30998960.002
NDAI0C043005.347ON240150950.002
KLLA0E13223g3.70ON282128950.002
SAKL0C12100g3.70ON31497950.002
YDL127W (PCL2)7.289ON308113950.002
YDL179W (PCL9)7.289ON304134950.002
Smik_4.1107.289ON308113910.006
Ecym_35353.70ON370150910.007
Kwal_56.241516.236ON480134920.007
Smik_4.607.289ON305162910.008
Suva_4.1187.289ON309111900.009
Kwal_23.52313.70ON25696890.011
KLTH0A01584g3.70ON28188880.016
NDAI0A022707.289ON330106880.018
ZYRO0C02068g3.70ON33099870.023
Smik_7.1386.236ON437169860.032
Skud_4.1287.289ON308112860.032
KNAG0B029307.289ON31280850.040
TDEL0E007903.70ON25497830.058
Suva_7.1306.236ON442120840.062
KNAG0F018706.236ON48394840.063
KAFR0C015603.70ON26788820.078
NCAS0A098703.70ON29488810.11
KAFR0A082803.70ON24195800.12
KLLA0F05654g7.289ON311139810.13
YGL134W (PCL10)6.236ON433117800.19
CAGL0J06336g7.289ON314132790.22
ZYRO0E07326g6.236ON428119790.28
TPHA0A032507.289ON289121770.32
AEL195W3.70ON237108760.41
Skud_7.1396.236ON434138760.56
NDAI0I008606.236ON543173760.61
NDAI0A060503.70ON28688750.63
TDEL0E028005.347ON19980740.64
TPHA0E027506.236ON605170750.91
SAKL0A03938g6.236ON50191731.3
KNAG0B019605.347ON22791711.6
CAGL0J10846g5.347ON229106711.9
TBLA0A021006.236ON574105703.3
KLLA0B02024g6.236ON527104694.5
Kpol_339.105.347ON19058665.7
CAGL0H08998g6.236ON547101685.9
TPHA0C046402.333ON379119677.8
ZYRO0B14410g4.333ON574107677.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02541g
         (342 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   672   0.0  
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   296   1e-98
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   295   6e-98
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   287   9e-96
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   283   3e-94
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   286   4e-94
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   281   3e-93
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   279   1e-92
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   275   4e-91
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   271   1e-89
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   269   2e-88
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   269   3e-88
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   270   4e-88
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   270   5e-88
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   264   5e-86
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   261   7e-85
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   256   4e-84
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     219   3e-68
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   216   4e-66
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    82   3e-17
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    82   5e-17
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    80   2e-16
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    78   9e-16
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    74   9e-14
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    73   9e-14
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    69   4e-13
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    69   5e-12
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    69   5e-12
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    66   2e-11
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    66   2e-11
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    67   2e-11
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    66   3e-11
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    64   6e-11
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    64   9e-11
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    64   2e-10
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    63   3e-10
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    62   4e-10
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    62   6e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    61   1e-09
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    60   3e-09
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    53   4e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    50   3e-06
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    50   3e-06
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    49   5e-06
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    49   5e-06
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    50   5e-06
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    50   6e-06
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    50   6e-06
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    47   2e-05
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    46   6e-05
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    46   6e-05
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    45   8e-05
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    45   1e-04
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    45   2e-04
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    45   2e-04
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    44   2e-04
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    44   2e-04
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    44   4e-04
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    43   4e-04
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    43   5e-04
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    43   6e-04
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    43   6e-04
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    43   6e-04
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    43   7e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    43   7e-04
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    43   8e-04
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    42   0.001
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    42   0.001
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    42   0.002
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    42   0.002
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                41   0.002
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    41   0.002
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    41   0.002
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    41   0.002
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    41   0.002
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    40   0.006
Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar...    40   0.007
Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {...    40   0.007
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    40   0.008
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    39   0.009
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    39   0.011
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    39   0.016
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      39   0.018
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    38   0.023
Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W ...    38   0.032
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    38   0.032
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    37   0.040
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    37   0.058
Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W ...    37   0.062
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    37   0.063
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    36   0.078
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    36   0.11 
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    35   0.12 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    36   0.13 
YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85...    35   0.19 
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    35   0.22 
ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {...    35   0.28 
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    34   0.32 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    34   0.41 
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    34   0.56 
NDAI0I00860 Chr9 complement(197860..199491) [1632 bp, 543 aa] {O...    34   0.61 
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    33   0.63 
TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON...    33   0.64 
TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.2...    33   0.91 
SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly...    33   1.3  
KNAG0B01960 Chr2 complement(376106..376789) [684 bp, 227 aa] {ON...    32   1.6  
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    32   1.9  
TBLA0A02100 Chr1 complement(508272..509996) [1725 bp, 574 aa] {O...    32   3.3  
KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some s...    31   4.5  
Kpol_339.10 s339 (17261..17833) [573 bp, 190 aa] {ON} (17261..17...    30   5.7  
CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly...    31   5.9  
TPHA0C04640 Chr3 complement(1004694..1005833) [1140 bp, 379 aa] ...    30   7.8  
ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]...    30   7.9  

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/342 (96%), Positives = 329/342 (96%)

Query: 1   MTPQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLT 60
           MTPQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLT
Sbjct: 1   MTPQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLT 60

Query: 61  RFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLT 120
           RFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLT
Sbjct: 61  RFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLT 120

Query: 121 ATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQ 180
           ATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQ
Sbjct: 121 ATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQ 180

Query: 181 KNFFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYD 240
           KNFFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYD
Sbjct: 181 KNFFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYD 240

Query: 241 IDMPAKTLHEHQQNDAVKNCXXXXXXXXXXXXXIPIPQTIPQNRPKRNFDTVEERHNIYI 300
           IDMPAKTLHEHQQNDAVKNC             IPIPQTIPQNRPKRNFDTVEERHNIYI
Sbjct: 241 IDMPAKTLHEHQQNDAVKNCSNNNSNYQTASNNIPIPQTIPQNRPKRNFDTVEERHNIYI 300

Query: 301 EEKSKMNTNGLAEKLTSSSYKKQITEDKKNQILDNSIYPSSI 342
           EEKSKMNTNGLAEKLTSSSYKKQITEDKKNQILDNSIYPSSI
Sbjct: 301 EEKSKMNTNGLAEKLTSSSYKKQITEDKKNQILDNSIYPSSI 342

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  296 bits (759), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 145/238 (60%), Positives = 183/238 (76%), Gaps = 4/238 (1%)

Query: 3   PQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDS-NIKENERKYGLTR 61
           P ++     +EI TI LPR F KC + DL +LI+RML F+IQINDS  + + E   GLTR
Sbjct: 19  PSESSKEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTR 78

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTA 121
           FHS++ P ISV+NY  RLTKYS LEH VLL+AVYYIDLLS+VYP F L+SLT HRFLLTA
Sbjct: 79  FHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTA 138

Query: 122 TTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQK 181
           TT+ASKGLCDSFCTNTHY+KVGGV  +ELN+LE EFL++VNYRI+PRD+NI +CK+E + 
Sbjct: 139 TTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKL 198

Query: 182 NFFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239
             F L E  E ++  + R   +S+ N+GYNVL  Y+ KI+++VG Y+SSPDK+K VNY
Sbjct: 199 QKFTLYE--EPEMGQNSRP-QNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNY 253

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  295 bits (756), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 197/290 (67%), Gaps = 15/290 (5%)

Query: 12  EEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDS--------NIKENERK-YGLTRF 62
           E I TI LP  F+ C + DLV LIARML F+I++ND+        N + N R    LTRF
Sbjct: 41  ENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRF 100

Query: 63  HSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTAT 122
           HS++ PNISV+NY  RLTKYS LEH VLLS VYYIDLLS+VYP F +NSLT HRFLLTAT
Sbjct: 101 HSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTAT 160

Query: 123 TIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKN 182
           TIASKGLCDSFCTN+HYSKVGGV C+ELN+LE EFLR+VNYRIIPRD+NI  CK+E Q+N
Sbjct: 161 TIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQN 220

Query: 183 FFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDID 242
            F +  S  S +  +++  +    N+G+N+L  YY+KI+++VG +S+S DK++K NY + 
Sbjct: 221 KFTMDFSDLSMVGMTVQSNH---QNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLL 277

Query: 243 MPAKTLHEHQQNDAVKNCXXXXXXXXXXXXXIPIPQTIPQNRPKRNFDTV 292
           +    + +   N+  +N                + +  P   PKRNF+T+
Sbjct: 278 LSGNNMEKEVSNNIKENSNGQNIGESEQAISSKLSRDPP---PKRNFETI 324

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  287 bits (734), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 182/242 (75%), Gaps = 13/242 (5%)

Query: 4   QDAQINTDEE-IPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRF 62
           +D + +T E+ +P + LP DF +CP+ DLVILI+RML F+I+INDS  K+N  +  LTRF
Sbjct: 18  EDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSSE--LTRF 75

Query: 63  HSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTAT 122
           HS++ P ISV++Y  RLT+YS LE +VL+++VYYIDLLS +Y AF+LNSLT HRFLLTAT
Sbjct: 76  HSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTAT 135

Query: 123 TIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKN 182
           T+ SKGLCDSFCTN+HY+KVGGVQC+EL+VLE+EFL++VNYRI+PRD+NI  CK E ++ 
Sbjct: 136 TVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREG 195

Query: 183 FFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDID 242
            F+     + +  P          N G+NVL  YY KIIE+VG Y SSPDKTK+ +Y + 
Sbjct: 196 LFVTATYAKENRGP----------NNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVMK 245

Query: 243 MP 244
            P
Sbjct: 246 TP 247

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  283 bits (724), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 175/226 (77%), Gaps = 12/226 (5%)

Query: 14  IPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVF 73
           +P + LP DF +C + DLVILI+RML F+ +INDS  K++ ++  LTRFHS++ P ISV+
Sbjct: 29  VPEVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPKDDAKE--LTRFHSRVPPQISVY 86

Query: 74  NYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSF 133
           +Y  RLT+YS LE +VL+++VYYIDLLS +YP+F+LNSLT HRFLLTATT+ASKGLCDSF
Sbjct: 87  DYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSF 146

Query: 134 CTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPESIESD 193
           CTN+HY+KVGGVQC+EL+VLE+EFL+KVNYRI+PRD+NI+ CK E +   F+ P   +S 
Sbjct: 147 CTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPTYSKSC 206

Query: 194 LAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239
             P          N G+NVL  YY KIIE+VG + SSPDKTK+ +Y
Sbjct: 207 RGP----------NNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHY 242

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  286 bits (732), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 137/234 (58%), Positives = 175/234 (74%), Gaps = 1/234 (0%)

Query: 7   QINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKEN-ERKYGLTRFHSK 65
           +I+   ++PT+ LP+ F +C + DLVILI+RML F+IQ+NDS+     +    LT+FHSK
Sbjct: 35  RIDNVNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSK 94

Query: 66  IAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIA 125
           + P ISV+NY  RLTKYS L+H VL++AVYYIDL+S+VYP F LNSLT HRFLLTATT+A
Sbjct: 95  VPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVA 154

Query: 126 SKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFI 185
           SKGLCDSFCTNTHY+KVGGV C+ELNVLE E LR++NYRIIPRD+NI +C +E Q   F+
Sbjct: 155 SKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFV 214

Query: 186 LPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239
           L      D  P L     + +N+GYNVL  YY KI+++VG   S+ DK+K VNY
Sbjct: 215 LDTQDGDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNY 268

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  281 bits (719), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 137/234 (58%), Positives = 181/234 (77%), Gaps = 6/234 (2%)

Query: 11  DEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQIND-SNIKENERKYGLTRFHSKIAPN 69
           D+ IP I LP +F KC + DLV+LI+RML  +I IN+ S+ K  + +  LTR+HSKI PN
Sbjct: 15  DQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPN 74

Query: 70  ISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGL 129
           IS+FNYF RLTK+S LEH VL++++YYIDLL   YP F LNSLTAHRFLLTATT+A+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134

Query: 130 CDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEV-QKNFFILPE 188
           CDSF TN HYSKVGGV+C+ELN+LEN+FL++VNYRI+PRD+NIT C +E  QK F I   
Sbjct: 135 CDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKN 194

Query: 189 SIES-DLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDI 241
           ++ S DL       Y++ S +GYNVL +YY +I+++VG + +SPDK+++VNY +
Sbjct: 195 ALGSVDLGS---YSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL 245

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  279 bits (714), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 182/233 (78%), Gaps = 2/233 (0%)

Query: 8   INTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQIND-SNIKENERKYGLTRFHSKI 66
           I+ D+ IP + LP DF KC + DLV+LI+RML  +I IN+ S  K+++ +  LTR+HSKI
Sbjct: 12  IHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKI 71

Query: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIAS 126
            PNIS+FNYF RLTK+S LEH VL++++YYIDLL  VYP F LNSLTAHRFLLTATT+A+
Sbjct: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVAT 131

Query: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFIL 186
           KGLCDSF TN HY+KVGGV+C+ELN+LEN+FL++VNYRIIPRD+NIT C +E ++  F++
Sbjct: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVI 191

Query: 187 PESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239
            ++    L       Y +   +GYNVL +YY +I+++VG +++SPDK++KV+Y
Sbjct: 192 DKNALGSLDLD-SYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDY 243

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  275 bits (704), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 179/237 (75%), Gaps = 10/237 (4%)

Query: 8   INTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQIND-SNIKENERKYGLTRFHSKI 66
           I+  + IP + LP +F KC + DLV+LI+RML  +I IN+ S  K+ + +  LTR+HSK+
Sbjct: 12  IHEHQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKV 71

Query: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIAS 126
            PNIS+FNYF RLTK+S LEH VL++++YYIDLL   YP F LNSLTAHRFLLTATT+A+
Sbjct: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAA 131

Query: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFI- 185
           KGLCDSF TN HY+KVGGV+C+ELN+LEN+FL++VNYRIIPRD+NIT C +E ++  F+ 
Sbjct: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVA 191

Query: 186 ---LPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239
               P S + D        Y S   +GYNVL +YY +I+++VG +++SPDK+KKV+Y
Sbjct: 192 DKNAPGSFDLD-----SYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDY 243

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  271 bits (694), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 180/235 (76%), Gaps = 6/235 (2%)

Query: 8   INTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNI-KENERKYGLTRFHSKI 66
           ++ D+ I  + LP DF KC + DLV+LI+RML  +I IN++++ K  E +  LTR+HSKI
Sbjct: 12  MHEDQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKI 71

Query: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIAS 126
            PNIS+FNYF RLTK+S LEH VL++++YYIDLL   YP F LNSLTAHRFLLTATTIA+
Sbjct: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIAT 131

Query: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEV-QKNFFI 185
           KGLCDSF TN HY+KVGGV+C+ELN+LEN+FL++VNYRIIPRD+NI  C +E  QK F I
Sbjct: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVI 191

Query: 186 LPESIES-DLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239
              ++ S DL       Y+    +GYNVL +YY +I+++VG +++SPDK+KK++Y
Sbjct: 192 DKNALGSFDLDS---YSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDY 243

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  269 bits (688), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 167/226 (73%), Gaps = 12/226 (5%)

Query: 17  IKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYF 76
           I LP +FLKC +  LV+LI+RML  +IQ+NDS  K+   K  LTRFHS++ P ISV+NY 
Sbjct: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLK--LTRFHSRVPPGISVYNYL 104

Query: 77  TRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTN 136
            RL KYS LE +VL++AVYYIDLLS+VYP+F LNSLT HRFLLTATT+ASKGL DSFCTN
Sbjct: 105 IRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTN 164

Query: 137 THYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPESIESDLAP 196
            HY+KVGGVQC+ELNVLE EFL++VNYRIIPRD+NI  CK E Q+  FI     +    P
Sbjct: 165 VHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKIKGP 224

Query: 197 SLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDID 242
                     N G+NVL  YY K+I++VG  +SSPDKT KV+Y ++
Sbjct: 225 ----------NNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLE 260

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  269 bits (688), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 137/251 (54%), Positives = 177/251 (70%), Gaps = 26/251 (10%)

Query: 10  TDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIK------------------ 51
           T  EI T+ LP +F  C + DL+ LI+RML F+IQIND   +                  
Sbjct: 17  TGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAAD 76

Query: 52  -ENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLN 110
            +   +  LTRFHS + P ISV+NY  RLTKYS LE SVLL+++YYIDLLS+VYPAF +N
Sbjct: 77  TDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTIN 136

Query: 111 SLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDN 170
           SLT HRFLLTATT+ASKGLCDSFCTN HY+KVGGVQ +ELN+LE+EFL+K+NYR++PRD+
Sbjct: 137 SLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDD 196

Query: 171 NITFCKMEVQKNFFIL--PESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYS 228
           NIT+CK E + + F +    ++ +   P+  Q      N+GYNVL  YY+KII++VGK+S
Sbjct: 197 NITWCKYEHRAHEFTIYNKAALTNVSKPTHTQ-----RNSGYNVLQMYYHKIIQLVGKFS 251

Query: 229 SSPDKTKKVNY 239
           SS DK+KK NY
Sbjct: 252 SSLDKSKKANY 262

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  270 bits (690), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 139/248 (56%), Positives = 176/248 (70%), Gaps = 25/248 (10%)

Query: 14  IPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSN--IKENERKY-------------- 57
           I TI LP  FLKC + DLV+LI+RML F+IQIND N  + EN                  
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 58  --GLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAH 115
              LTRFHS++ PNISV NY  RLTKY+ LEHSVLLS++YYIDLLS+VYP F +NSLT H
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 116 RFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFC 175
           RFLL ATT+ASKGL DSFCTN+HY+KVGGV+C+ELN+LE +FLR++NYRIIPRD+NI  C
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 176 KMEVQKNFFI--LPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDK 233
           K+E + + F   L + + +++ P L        N+GYNVL  YY K++++VG   +S DK
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQPELTH-----PNSGYNVLNIYYRKMVQIVGLLKNSTDK 266

Query: 234 TKKVNYDI 241
           +KKVNY I
Sbjct: 267 SKKVNYII 274

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  270 bits (689), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 164/218 (75%), Gaps = 10/218 (4%)

Query: 17  IKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYF 76
           I LP ++L+C +  LV++I+RML F+IQIND+N   N+    LTRFHSK AP+I+V+ Y 
Sbjct: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQ-TMELTRFHSKAAPSITVYQYL 77

Query: 77  TRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTN 136
            RLTKYS LEHSVLLSAVYYIDLLS VYP F LNSLT HRFLLTATTIASKGLCDSFCTN
Sbjct: 78  IRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTN 137

Query: 137 THYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPESIESDLAP 196
           THYSKVGGVQC+ELN+LENEFL +V YRIIPRD+NI  CK+E         + + S++  
Sbjct: 138 THYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIE---------QKLGSNMLI 188

Query: 197 SLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKT 234
            ++       + G+NVL  YY KI+++VG   +SPDKT
Sbjct: 189 PMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT 226

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  264 bits (675), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 128/233 (54%), Positives = 170/233 (72%), Gaps = 9/233 (3%)

Query: 10  TDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPN 69
           T E +  ++LPR FL C +  LV+LI+RML  +I +ND+   +  +   LTRFHS++ P 
Sbjct: 9   TSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQ-GDKSKPIKLTRFHSRVPPA 67

Query: 70  ISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGL 129
           ISV+NY  RLTKYS LEH VLL++VYYIDLL+NVYP F L+SLT HRFLLTATT+ASKGL
Sbjct: 68  ISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGL 127

Query: 130 CDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPE- 188
           CDSFCTNTHY+KVGGVQC+ELNVLENEFL +VNYRI+PRD+NI  C +E Q+  F     
Sbjct: 128 CDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSYSNI 187

Query: 189 SIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDI 241
            ++ D A   R       N G+ VL +YY+++I ++G ++ SPDK+  +++ +
Sbjct: 188 PMDKDCALQDR-------NNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTL 233

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  261 bits (668), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 127/233 (54%), Positives = 170/233 (72%), Gaps = 8/233 (3%)

Query: 12  EEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNIS 71
           + +P  +LPR FL C +  LV+LI+RML  +I++ND+  + N  +  LTRFHS++ P+IS
Sbjct: 18  QPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTESNTLQ--LTRFHSRVPPSIS 75

Query: 72  VFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCD 131
           V++Y  RLTKYS LEH VLL++VYYIDLLS+V+P F L+SLT HRFLLTATT+ASKGLCD
Sbjct: 76  VYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCD 135

Query: 132 SFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPESIE 191
           SFCTNTHY+KVGGVQCNELNVLENEFL +VNYRI+PRD NI  C  E Q+  F       
Sbjct: 136 SFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSF----- 190

Query: 192 SDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDIDMP 244
           +++     Q   S  N  ++VL  YY+++I ++G   +SPDK+  +N+ ++ P
Sbjct: 191 ANIPADAEQDQKSEENR-FDVLENYYHRMIHLIGNLDASPDKSYDLNFTLEEP 242

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  256 bits (655), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 169/236 (71%), Gaps = 14/236 (5%)

Query: 10  TDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDS-----NIKENERK-YGLTRFH 63
           + EE   + L ++F+KC K DL+ LI+RML F I INDS     N+  N      LTRFH
Sbjct: 5   SGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFH 64

Query: 64  SKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATT 123
           SK+ PNIS+F+Y  RLTKYS LE SVL+++VYYIDLLSNVYP F+LNSLT HR+LLTATT
Sbjct: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATT 124

Query: 124 IASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNF 183
           IASKGLCDSFCTN+HY+KVGG++CNELNVLE EFL +V YR+IPRDN I  CK+E +   
Sbjct: 125 IASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYK--- 181

Query: 184 FILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239
           +   E I +D+          + N+GYNVL+ YY K++++VG   SS +  + VNY
Sbjct: 182 YSPIEDINNDIHIP-----DELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNY 232

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  219 bits (559), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 151/232 (65%), Gaps = 9/232 (3%)

Query: 13  EIPTIKLPRDFLKCPKGDLVILIARMLQFIIQIND----SNIKENERKYGLTRFHSKIAP 68
           +I  I++P +++KC + DLV+L++RML  +IQ ND    ++   ++    LTRFHS+I P
Sbjct: 25  KIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNMHLTRFHSRIPP 84

Query: 69  NISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKG 128
           NIS+FNY  RLTKY  +EH VLLS +YYIDL +  YP F  NSLTAHRFLLTA T+A KG
Sbjct: 85  NISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKG 144

Query: 129 LCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPE 188
           LCDSFCT   Y+K+GGVQ  ELN+LE  FLR VNYRIIPR +N+T  K+E     F L  
Sbjct: 145 LCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDH 204

Query: 189 SIESDLAPSLR-QGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239
               D  P L    Y  + + GY+VL  YY  I+ + G  +SS    K+V Y
Sbjct: 205 LDMKD--PKLSFLSYDYLPDNGYSVLNIYYQNIVRITG--ASSDLLFKRVIY 252

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  216 bits (549), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/247 (48%), Positives = 162/247 (65%), Gaps = 16/247 (6%)

Query: 10  TDEEIPT---IKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENE--RKYGLTRFHS 64
           TD E P    I LP  F++CP+ DLV+LI+RML  +I+IND+   +N     Y  TRFHS
Sbjct: 47  TDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYA-TRFHS 105

Query: 65  KIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTI 124
           ++ P IS+ NY  RLTK+ +L+ SVLL+AVYYIDLLS V+P+F+ NSLTAHRF+LTA  +
Sbjct: 106 RVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIV 165

Query: 125 ASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFF 184
           ASK LCDS  + THY+K GGVQ NEL +LE  FL+ + YR++PRD N   C ME   + F
Sbjct: 166 ASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTF 225

Query: 185 ILPESI--ESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVG---KYSSSPDKTKKVNY 239
            L +    ES  + S RQ    + ++GYNVL  YY +II+++G     S SPD    V+Y
Sbjct: 226 ALNDGQIKESGTSFSYRQ----LPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAV-TVDY 280

Query: 240 DIDMPAK 246
            +  P +
Sbjct: 281 FLMRPRR 287

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 81/160 (50%), Gaps = 20/160 (12%)

Query: 27  PKGDLVILIARMLQFIIQINDSNIKENERKYGLTR---------FHSKIAPNISVFNYFT 77
           P  +L+I+++ +L  II +ND+    +++  G T          F+ K  P I V  Y  
Sbjct: 106 PTDELIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTPILAFYGKNVPEIDVVQYLE 165

Query: 78  RLTKYSLLEHSVLLSAVYYIDLLSNVYP-----------AFNLNSLTAHRFLLTATTIAS 126
           R+ KY    + + LS + Y D +S  Y             F ++S   HR L+T  TI +
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLITGITICT 225

Query: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           K L D F +N+ Y+KVGG+   ELN LE +FL   +++++
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 81/160 (50%), Gaps = 20/160 (12%)

Query: 27  PKGDLVILIARMLQFIIQIND---------SNIKENERKYGLTRFHSKIAPNISVFNYFT 77
           P  +L+++I+ +L  II  ND         S+  E+E    +  F+ K  P I+V  Y  
Sbjct: 106 PTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLE 165

Query: 78  RLTKYSLLEHSVLLSAVYYIDLLSNVYP-----------AFNLNSLTAHRFLLTATTIAS 126
           R+ KY    + + LS + Y D +S  Y             F ++S   HR L+T  TI +
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICT 225

Query: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           K L D F +N+ Y+KVGG+   ELN LE +FL   +++++
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 80.1 bits (196), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 81/160 (50%), Gaps = 20/160 (12%)

Query: 27  PKGDLVILIARMLQFIIQINDSNIK---------ENERKYGLTRFHSKIAPNISVFNYFT 77
           P  +L+++++ +L  I++ ND             E+E    +  F+ K  P I+V  Y  
Sbjct: 107 PTDELILMVSALLNKIVKANDETTDPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLE 166

Query: 78  RLTKYSLLEHSVLLSAVYYIDLLSNVYPA-----------FNLNSLTAHRFLLTATTIAS 126
           R+ KY    + + LS + Y D +S  Y +           F ++S   HR L+T  TI +
Sbjct: 167 RIQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICT 226

Query: 127 KGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           K + D F +N+ Y+KVGG+   ELN LE +FL   +++++
Sbjct: 227 KFMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 78.2 bits (191), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 78/157 (49%), Gaps = 20/157 (12%)

Query: 30  DLVILIARMLQFIIQIND---------SNIKENERKYGLTRFHSKIAPNISVFNYFTRLT 80
           +L+ +I+ +L  I+  ND         S   ++E    +  F+ K  P ISV  Y  R+ 
Sbjct: 109 ELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLERIQ 168

Query: 81  KYSLLEHSVLLSAVYYIDLLSNVYP-----------AFNLNSLTAHRFLLTATTIASKGL 129
           KY    + + LS + Y D +S  Y             F ++S   HR L+T  TI +K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICTKFL 228

Query: 130 CDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
            D F +N+ Y+KVGG+   ELN LE +FL   +++++
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 81/162 (50%), Gaps = 17/162 (10%)

Query: 22  DFLKCPKGDLVILIARMLQFIIQIND----SNIKE---NERKYGLTRFHSKIAPNISVFN 74
           D    P   L+ ++  +L  I++ ND    +N++E   N+    +  F  K  P IS+  
Sbjct: 290 DIATFPNNKLLNMLTSLLNKIVKSNDQLRNTNVQESAFNDYTSQVLSFRGKHVPAISLDQ 349

Query: 75  YFTRLTKYSLLEHSVLLSAVYYIDLLS----------NVYPAFNLNSLTAHRFLLTATTI 124
           YF R+ KY    + V LS + Y D ++          +    F ++S   HR ++ A T+
Sbjct: 350 YFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDSYNIHRLIIAAVTV 409

Query: 125 ASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           ++K   D F +N+ Y++VGG+   ELN LE +FL   ++ +I
Sbjct: 410 STKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 73.2 bits (178), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 80/158 (50%), Gaps = 13/158 (8%)

Query: 22  DFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTR--------FHSKIAPNISVF 73
           D  K P   L+ ++  +L  II+ ND      + K+ +          F  K  P I++ 
Sbjct: 186 DIAKFPTDKLLEMLTSLLYKIIKSNDRLKSFEQEKHDINSKYVAHVLSFRGKHIPAITLG 245

Query: 74  NYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA-----FNLNSLTAHRFLLTATTIASKG 128
           +YF R+ KY  + + V LS + Y D ++    A     F ++S   HR ++ A T+++K 
Sbjct: 246 DYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHRLIIAAVTVSTKF 305

Query: 129 LCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
             D F +N+ Y++VGG+  +ELN LE +F    ++ +I
Sbjct: 306 FSDFFYSNSRYARVGGISLHELNRLELQFSILCDFELI 343

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 80/158 (50%), Gaps = 13/158 (8%)

Query: 22  DFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLT--------RFHSKIAPNISVF 73
           D  + P   L+ ++  +L  II+ ND     ++ K+ +          F  K  P I++ 
Sbjct: 17  DIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLG 76

Query: 74  NYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA-----FNLNSLTAHRFLLTATTIASKG 128
           +YF R+ KY  + + V LS + Y D ++    A     F ++S   HR ++ A T+++K 
Sbjct: 77  DYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKF 136

Query: 129 LCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
             D F +N+ Y++VGG+   ELN LE +F    ++ +I
Sbjct: 137 FSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELI 174

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNV-----YPAFNLNSLTAHR 116
           F  K  P I++  YF R+ KY    + V LS + Y D ++          F ++S   HR
Sbjct: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHR 383

Query: 117 FLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
            +++A T+++K   D F +N+ Y++VGG+   ELN LE +FL   ++ +I
Sbjct: 384 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNV-----YPAFNLNSLTAHR 116
           F  K  P I++  YF R+ KY    + V LS + Y D ++          F ++S   HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 117 FLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
            +++A T+++K   D F +N+ Y++VGG+   ELN LE +FL   ++ +I
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 82/188 (43%), Gaps = 43/188 (22%)

Query: 22  DFLKCPKGDLVILIARMLQFIIQIND----------------SNIKENERKYGLTRFHSK 65
           D  K     L+ +I+ +L+ +I+ ND                 N  E++    +  F  K
Sbjct: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187

Query: 66  IAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA------------------- 106
             P I +  YF R+ KY    + VLL+ + Y D +S V                      
Sbjct: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247

Query: 107 --------FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFL 158
                   F L+S   HR +++A T+++K   D F +N+ Y+KVGG+  +E+N LE +FL
Sbjct: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307

Query: 159 RKVNYRII 166
              N+ +I
Sbjct: 308 LISNFDLI 315

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 10/119 (8%)

Query: 58  GLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSN----------VYPAF 107
            L  FH K  P+I++  YF R+ KY    + V L  +   D ++               F
Sbjct: 177 SLLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLF 236

Query: 108 NLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
            ++S   HRF++   T+ +K L D F +N+ Y+KVGG+  +E+N LE +FL   ++++I
Sbjct: 237 VMDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 14/119 (11%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS-----------NVYPA---F 107
           F  K  P I+++ YF R+ KY    + V LS + Y D +S           +  PA   F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 108 NLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
            ++S   HR ++   T+ +K   D F +N+ Y++VGG+  +ELN LE +FL   ++ ++
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 58/120 (48%), Gaps = 15/120 (12%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS---------------NVYPA 106
           F  K  P IS+  YF R+ KY    + V LS + Y D +S               N    
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 107 FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           F ++S   HR ++   T+ +K   D F +N+ Y++VGGV   ELN LE +FL   ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 61/121 (50%), Gaps = 12/121 (9%)

Query: 58  GLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA----------- 106
            +  F  K  P I++  YF R+ KY    + V LS + Y D + N   +           
Sbjct: 171 AMLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQ 230

Query: 107 -FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRI 165
            F ++S   HR ++   T+++K L D F +N+ Y+KVGG+   ELN LE +FL   ++ +
Sbjct: 231 IFVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNL 290

Query: 166 I 166
           +
Sbjct: 291 L 291

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 83/176 (47%), Gaps = 33/176 (18%)

Query: 27  PKGDLVILIARMLQFIIQIND--------SNIKENERKY----GLTRFHSKIAPNISVFN 74
           P  D++ ++  +L  I+  ND        +  ++ ++ +     +T F+ K  P I++  
Sbjct: 239 PIDDILQMLTALLDKIVSSNDELNNGGPPAGCEDKQQDHDTINAITSFYGKHVPQITIEQ 298

Query: 75  YFTRLTKYSLLEHSVLLSAVYYIDLLS------------NV--------YPAFNLNSLTA 114
           Y  R+ KY    + + LS + + D +S            NV        +  F ++S   
Sbjct: 299 YLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFVMDSYNI 358

Query: 115 HRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYR-IIPRD 169
           HR L+   T+++K   D F +N  Y++VGG+   E+N LE +FL   +++ +IP D
Sbjct: 359 HRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLLIPID 414

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 83/183 (45%), Gaps = 38/183 (20%)

Query: 22  DFLKCPKGDLVILIARMLQFIIQINDS-----NIKENERK-----YGLTRFHSKIAPNIS 71
           D    P   L+ ++  +L  II+ NDS     N + ++ K       +  F  K  P I+
Sbjct: 190 DIATFPTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGIT 249

Query: 72  VFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA------------------------- 106
           +  YF R+ KY    + VLLS + + D ++    A                         
Sbjct: 250 LKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSS 309

Query: 107 ---FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNY 163
              F ++S   HR ++ A T+++K + D F +N+ Y++VGG+   ELN LE +FL   ++
Sbjct: 310 PQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDF 369

Query: 164 RII 166
           R+I
Sbjct: 370 RLI 372

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 64/141 (45%), Gaps = 36/141 (25%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSN------------------- 102
           F  K  P IS+  YF R+ KY  + + V LS + Y D +S                    
Sbjct: 208 FRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADE 267

Query: 103 ----------------VYP-AFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGV 145
                           V P  F ++S   HR ++TA T+++K   D F +N+ Y++VGG+
Sbjct: 268 SQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGI 327

Query: 146 QCNELNVLENEFLRKVNYRII 166
              ELN LE +FL   +++++
Sbjct: 328 SLQELNHLELQFLILCDFQLM 348

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (49%), Gaps = 14/119 (11%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS---NVYPAFN---------- 108
           F  K  P I++  YF R+ KY    + V LS + Y D +S   N  P  N          
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 109 -LNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
            ++S   HR ++   T+ +K   D F +N+ Y++VGG+   ELN LE +FL   ++ ++
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 78/190 (41%), Gaps = 45/190 (23%)

Query: 22  DFLKCPKGDLVILIARMLQFIIQINDSNIKEN-----ERKY---------GLTRFHSKIA 67
           D    P   L+ ++  +L  II+ ND     N     ER+           +  F  K  
Sbjct: 142 DIATFPTEKLLEMLTALLDKIIKSNDRLASSNPTLNQERELMNNNNVYLNSVLSFRGKHI 201

Query: 68  PNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSN------------------------- 102
           P IS+ +YF R+ KY    + V LS + Y D +S                          
Sbjct: 202 PQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDMPAKQQQ 261

Query: 103 ------VYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENE 156
                    AF ++S   HR L+   T+++K   D F +N+ Y++VGG+   ELN LE +
Sbjct: 262 QTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQELNHLELQ 321

Query: 157 FLRKVNYRII 166
           FL   ++ ++
Sbjct: 322 FLVLCDFELL 331

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 16/121 (13%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS---NVYP------------- 105
           F  K  P I++  YF R+ KY    + V LS + Y D +S   N  P             
Sbjct: 211 FKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTL 270

Query: 106 AFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRI 165
            F +NS   HR ++    +++K   D F +N  Y+KVGG+   E+N LE +FL   ++ +
Sbjct: 271 LFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSL 330

Query: 166 I 166
           +
Sbjct: 331 L 331

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 82/201 (40%), Gaps = 56/201 (27%)

Query: 22  DFLKCPKGDLVILIARMLQFIIQINDSNI------KENERKYGLT---------RFHSKI 66
           D    P   L+ ++  +L  I++ ND  I      ++ E   G+T          F  K 
Sbjct: 179 DIAGFPTDKLLEMLTALLDKIVKSNDKLIDTSFYHQQQEEHDGITNDSCLRSVLSFRGKH 238

Query: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS------------------------- 101
            P IS+ +YF R+ KY    + V LS + Y D +S                         
Sbjct: 239 IPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAGNNNNG 298

Query: 102 --NV--------------YPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGV 145
             NV                 F ++S   HR ++  TT+++K   D F +N+ Y++VGG+
Sbjct: 299 HDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYARVGGI 358

Query: 146 QCNELNVLENEFLRKVNYRII 166
              ELN LE +FL   ++ ++
Sbjct: 359 SLQELNYLELQFLILCDFELL 379

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 76/158 (48%), Gaps = 21/158 (13%)

Query: 23  FLKCP-KGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTK 81
           F++ P   D++  +A     IIQ+  S+ + N              P  S+F +   L K
Sbjct: 10  FIRQPVSHDMICFLASTTDSIIQLKPSSNEAN-------------IP--SIFEFIKGLIK 54

Query: 82  YSLLEHSVLLSAVYYIDLLSNVYPA--FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHY 139
           +S ++ S L+++  Y+  L ++ PA  + + S T HR  L    +A+K L DS   N H+
Sbjct: 55  HSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKSLNDSSPLNKHW 113

Query: 140 SKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNITFC 175
           +K   G +   ++N +E E L  +N+  I +  ++  C
Sbjct: 114 TKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%)

Query: 107 FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           F ++S   HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL   ++ ++
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 49/120 (40%), Gaps = 20/120 (16%)

Query: 2   TPQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSN------------ 49
           T +D  ++ D   P      +  + P   L+ ++  +L  II+ ND              
Sbjct: 138 TQEDKILDGDRSNPQATPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTAATNPSLTQEIE 197

Query: 50  ------IKENERKY--GLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS 101
                 + ++E+KY   +  F  K  P I +  YF R+ KY    + V LS + Y D +S
Sbjct: 198 NGRCLTLTDDEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 257

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%)

Query: 107 FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           F ++S   HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL   ++ ++
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 49/120 (40%), Gaps = 20/120 (16%)

Query: 2   TPQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSN------------ 49
           T +D  +  D+  P      +  + P   L+ ++  +L  II+ ND              
Sbjct: 147 TQEDRVLEGDKSNPQATPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTAAANPSLTQEIE 206

Query: 50  ------IKENERKY--GLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS 101
                 + +NE+KY   +  F  K  P I +  YF R+ KY    + V LS + Y D +S
Sbjct: 207 NGKSPTLTDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 266

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 109 LNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRI 165
           +NS T HR +L   T++SK L D   +N  Y++  G+   ELN LE +FLR  N+ +
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 37/60 (61%)

Query: 107 FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           F ++S   HR ++   T+++K   D F +N+ Y++VGG+   ELN LE +FL   ++ ++
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 51  KENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS 101
           K+N     +  F  K  P IS+  YF R+ KY  + + V +S + Y D +S
Sbjct: 31  KDNSMAQSVLSFRGKHIPQISLEQYFQRIQKYCPITNDVFISLLVYFDRIS 81

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 101 SNVYPA-FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLR 159
           S  +P  F ++S   HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL 
Sbjct: 323 SRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLV 382

Query: 160 KVNYRII 166
             ++ ++
Sbjct: 383 LCDFELL 389

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 49/120 (40%), Gaps = 20/120 (16%)

Query: 2   TPQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSN------------ 49
           T +D  ++ D     +    +  + P   L+ ++  +L  II+ ND              
Sbjct: 143 TQEDKILDGDTSNSQVTPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTAATNPSLTQEIE 202

Query: 50  ------IKENERKY--GLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS 101
                 + +NE+KY   +  F  K  P I +  YF R+ KY    + V LS + Y D +S
Sbjct: 203 NGRCLALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%)

Query: 107 FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           F ++S   HR ++   T+++K L D F +N+ YS+VGG+   ELN LE +FL   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 47/117 (40%), Gaps = 24/117 (20%)

Query: 5   DAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKEN----------- 53
           D  I+  +  P++ +     + P   L+ ++  +L  II+ ND     N           
Sbjct: 150 DGDISNQQVTPSLNIA----EFPTDKLLKMLTALLTKIIKSNDRTAATNPSLTQEIENGK 205

Query: 54  -------ERKY--GLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS 101
                  ERKY   +  F  K  P I +  YF R+ KY    + V LS + Y D +S
Sbjct: 206 CLTLTDSERKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%)

Query: 107 FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166
           F ++S   HR ++   T+A+K   D F +N  Y+KVGG+   ELN LE +FL   +++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS 101
           F  K  P I++F YF R+ KY  + + V LS + Y D +S
Sbjct: 444 FRGKHIPQITLFQYFQRIQKYCPISNDVFLSLLVYFDRIS 483

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 67/142 (47%), Gaps = 8/142 (5%)

Query: 38  MLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYI 97
           M+QF+     S I+        T   + I P +S  N+   L K+S ++   L++   Y+
Sbjct: 19  MIQFLASTTASIIQVKPHSEPKTN-TAHIIPTLS--NFIKALIKHSNVQTPTLMATTVYL 75

Query: 98  DLLSNVYP--AFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQCNELNVL 153
             L ++ P   + + + T HR  L    +A+K L DS   N H+++   G +Q  E+N +
Sbjct: 76  SKLKSIIPCNVYGIET-TRHRIFLGCLILAAKTLNDSSPMNKHWAQYTDGLLQIREVNTI 134

Query: 154 ENEFLRKVNYRIIPRDNNITFC 175
           E E L   ++ +  +  ++  C
Sbjct: 135 ERELLEYFDWDVTIKTKDLIIC 156

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 14/132 (10%)

Query: 38  MLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYI 97
           M+ F+     S I+  E   G           +S+ ++   L  +S ++   L+S V Y+
Sbjct: 19  MVHFLAATTSSVIQVKENVAGSV---------VSLVDFIKGLITHSNVQTPTLMSTVVYL 69

Query: 98  DLLSNVYPA--FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQCNELNVL 153
             L ++ PA  + + + T HR  L    +A+K L DS   N H+S+   G +   E+N +
Sbjct: 70  TRLRSIIPATVYGIET-TRHRIFLGCLILAAKNLNDSSPLNKHWSRYTNGLLDIREVNTI 128

Query: 154 ENEFLRKVNYRI 165
           E E L   ++++
Sbjct: 129 ERELLEYFDWKL 140

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 5/97 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + TRL +Y+ +    LL+AV Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNY 163
             DS   N H++K   G     ++N++E + L+ +N+
Sbjct: 113 HNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 72/152 (47%), Gaps = 26/152 (17%)

Query: 30  DLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKI-----APNISVFNYFTRLTKYSL 84
           +++  +AR  + IIQ+ ++              HS I     AP + +F    +L KYS 
Sbjct: 18  EMITYLARSTESIIQVRET--------------HSMIDVAIPAPKLELF--IKKLVKYSN 61

Query: 85  LEHSVLLSAVYYIDLLSNVYPA--FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKV 142
           ++   L++   ++  L ++ PA  + + + T HR  L    +++K L DS   N H+++ 
Sbjct: 62  VQTPTLMATTVFLTKLRSIIPANVYGIET-TRHRIFLGCLILSAKTLNDSSPLNKHWAQY 120

Query: 143 --GGVQCNELNVLENEFLRKVNYRIIPRDNNI 172
             G +   E+N +E E L   ++ +    N++
Sbjct: 121 TDGLLHLKEVNTIERELLEYFDWNLTLSTNDL 152

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + TRL +Y+ +    LL+ V Y++ L  + P  A  L S T HR  L    ++SK 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPS-TIHRLFLACLILSSKC 112

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRI 165
             DS   N H+++   G     ++N++E + L+ +N+ I
Sbjct: 113 HNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDI 151

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 76/165 (46%), Gaps = 25/165 (15%)

Query: 30  DLVILIARMLQFIIQI--NDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEH 87
           +++  +A     IIQI  NDS +            H    P +S+F    ++   S ++ 
Sbjct: 18  EMIQFLATSTASIIQIRKNDSPV------------HGCPPPELSIF--IKKVVVQSNVQT 63

Query: 88  SVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKV--G 143
             L++   Y++ L ++ P   + + + T HR  L    +A+K L DS   N H++    G
Sbjct: 64  PTLMATTVYLNKLKSIIPKNVYGIET-TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEG 122

Query: 144 GVQCNELNVLENEFLRKVNY--RIIPRD--NNITFCKMEVQKNFF 184
            ++  E+N +E E L   N+  RI   D  N++ F  + +Q+  F
Sbjct: 123 LLKVREVNTIERELLEYFNWDVRITTSDLINSLAFFLVPIQEQLF 167

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 86/203 (42%), Gaps = 31/203 (15%)

Query: 25  KCPKGDLVILIARMLQFIIQI---NDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTK 81
           K   G+++  ++      IQI   +DSN+  NE         S I P   ++ +   L  
Sbjct: 14  KAVTGEMIQFLSNCAASAIQIRPTSDSNL-TNESI-------SNIPP---LYTFIKNLVA 62

Query: 82  YSLLEHSVLLSAVYYIDLLSNVYPAFNLNSL--TAHRFLLTATTIASKGLCDSFCTNTHY 139
           +S ++   L++ V Y+  L  + P+ N+  +  T HR  L    IA+K L DS   N H+
Sbjct: 63  HSNVQTPTLMTTVVYLKKLKAIIPS-NVYGIETTRHRMFLGCLIIAAKTLNDSSPLNKHW 121

Query: 140 SKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNITFC------------KMEVQKNFFI 185
           +K   G +Q  E+N +E E L    + +    N++  C            K +  +NF +
Sbjct: 122 AKYTNGLLQLREVNTIEREILTYFKWDLQITVNDLLTCLAPFIKQVKDDEKRQKNQNFLL 181

Query: 186 LPESIESDLAPSLRQGYSSISNA 208
                   L   +   +S  SNA
Sbjct: 182 FNSPTPGQLRECINSKFSLSSNA 204

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 65/149 (43%), Gaps = 16/149 (10%)

Query: 30  DLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSV 89
           +++  +A   + +IQ+ +S+  E  RK             +S+ N+   L   S ++   
Sbjct: 18  EMIEFLAASSRSVIQVRESD-SERSRKV------------VSLENFIKGLVVQSNVQTPT 64

Query: 90  LLSAVYYIDLLSNVYPAFNLN-SLTAHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQ 146
           L+S   Y+  L ++ PA  L    T HR  L    IA+K L DS   N H++    G + 
Sbjct: 65  LMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKNLNDSSPMNKHWASYTNGLLD 124

Query: 147 CNELNVLENEFLRKVNYRIIPRDNNITFC 175
             E+N +E E L   ++ +      +  C
Sbjct: 125 TREVNTIERELLEYFDWNLQFSTQELAIC 153

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 16/140 (11%)

Query: 30  DLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSV 89
           +++  ++ + + IIQ+  SN              S   P   +  + T L   S ++   
Sbjct: 18  EMIAYLSNITESIIQVRRSN-----------SMISIALPPPPLVKFITNLCLKSNVQTPT 66

Query: 90  LLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSK--VGGV 145
           L++   Y+  L N+ P   + + S T HR  L    +ASK L DS   N H+++   G +
Sbjct: 67  LMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCLILASKTLNDSSPLNKHWARYTSGIL 125

Query: 146 QCNELNVLENEFLRKVNYRI 165
           Q  E+N +E E L   ++ I
Sbjct: 126 QLREVNTIERELLEYFDWNI 145

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 65/142 (45%), Gaps = 13/142 (9%)

Query: 38  MLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYI 97
           M++F+   ++S I+         R     A  +S+ ++   L   S ++   L+S   Y+
Sbjct: 19  MIEFLASTSNSVIQ--------VRTGESSAKVVSLVDFIKGLVVQSNVQTPTLMSTAVYL 70

Query: 98  DLLSNVYPAFNLNSL--TAHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQCNELNVL 153
             L ++ PA N++ +  T HR  L    IA+K L DS   N H++    G +   E+N +
Sbjct: 71  SKLRSIIPA-NVHGMETTRHRVFLGCLIIAAKNLNDSSPMNKHWASYTNGLLNTREVNTI 129

Query: 154 ENEFLRKVNYRIIPRDNNITFC 175
           E E L   ++ +     ++  C
Sbjct: 130 ERELLEYFDWNLRISTQDLVTC 151

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 12/112 (10%)

Query: 66  IAPNI---------SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTA-H 115
           I PNI         S+ ++   + KYS ++   L+++  +++ L  + P +     TA H
Sbjct: 30  IIPNIQQSGSLAIPSLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATH 89

Query: 116 RFLLTATTIASKGLCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRI 165
           R  L    +ASK L DS   N H+ K   G +   E+N +E E L  +++ +
Sbjct: 90  RLFLGCLILASKTLNDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + TRL +Y+ +    LL+A  Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRI 165
             DS   N H+++   G     ++N++E + L+ +N+ +
Sbjct: 113 HNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDL 151

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 5/97 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + TRL +Y+ +    LL+A  Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNY 163
             DS   N H+++   G     ++N++E + L+ +N+
Sbjct: 113 HNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 5/97 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + TRL +Y+ +    LL+A  Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPS-TIHRIFLACLILSAKF 112

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNY 163
             DS   N H+++   G     ++N++E + L+ +N+
Sbjct: 113 HNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 5/112 (4%)

Query: 68  PNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSL--TAHRFLLTATTIA 125
           P +S+ ++   L   S ++   L+S V Y+  L ++ P  N++ +  T HR  L    +A
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPP-NVHGIETTRHRIFLGCLILA 99

Query: 126 SKGLCDSFCTNTHYSKVGG--VQCNELNVLENEFLRKVNYRIIPRDNNITFC 175
           SK L DS   N H+ +     +   E+N +E E L   N+ ++  + ++  C
Sbjct: 100 SKNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 51/113 (45%), Gaps = 5/113 (4%)

Query: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA--FNLNSLTAHRFLLTATTI 124
           +P   +  +   L  YS ++   L++   Y+  L ++ PA  F + + T HR  L    +
Sbjct: 42  SPAPPLMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGCLIL 100

Query: 125 ASKGLCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNITFC 175
           A+K L DS   N H++    G +   E+N +E E L   ++ +      +  C
Sbjct: 101 AAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 66/132 (50%), Gaps = 11/132 (8%)

Query: 38  MLQFIIQINDSNIK-ENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYY 96
           M+ F++   +S I+ E+E     T   S+  P++++F    RL  +S ++   L+S + Y
Sbjct: 19  MIDFLVSTTNSIIQIESE-----TSSTSQQIPSLALF--IKRLIVHSNVQTPTLMSTLVY 71

Query: 97  IDLLSNVYPAFNLN-SLTAHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQCNELNVL 153
           +  L  + P+  +    T HR  +    +A+K L DS   N H+++   G  +  E+N +
Sbjct: 72  LTKLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSSPLNRHWTQYTNGLFKIQEINTI 131

Query: 154 ENEFLRKVNYRI 165
           E E L   N+ +
Sbjct: 132 ERELLEYFNWDV 143

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 70  ISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA--FNLNSLTAHRFLLTATTIASK 127
           +S+ ++   L K S ++   L+S V Y+  L ++ PA  + + + + HR  L    +A+K
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIET-SRHRMFLGCLILAAK 101

Query: 128 GLCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNITFC 175
            L DS   N H+ +   G +   E+N +E E L   N+ +   + ++  C
Sbjct: 102 NLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 23/151 (15%)

Query: 36  ARMLQF-------IIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHS 88
           A M+Q+       IIQ+ +SN   N    GL        P  S+ N+   L  +S ++  
Sbjct: 17  AEMIQYLASSTACIIQVKNSN---NLVDVGL--------PAPSLTNFIKGLVLHSNVQTP 65

Query: 89  VLLSAVYYIDLLSNVYPA--FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKV--GG 144
            L++   Y+  L ++ P   + + + T HR  L    +A+K L DS   N H++    G 
Sbjct: 66  TLMATAVYLAKLRSIIPGNVYGIET-TRHRIFLGCLILAAKTLNDSSPLNKHWALYTDGL 124

Query: 145 VQCNELNVLENEFLRKVNYRIIPRDNNITFC 175
           +  +E+N +E E L   ++ +     ++  C
Sbjct: 125 LHIHEVNTIERELLEYFDWNVTVTTKDLITC 155

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + T+L +Y+ +    LL+ V Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 59  SLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACLILSAKY 117

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNY 163
             DS   N H++K   G     ++N++E + L  +N+
Sbjct: 118 HNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNW 154

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 54/106 (50%), Gaps = 5/106 (4%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + T+L +Y+ +  S LL+   Y+  L  + P  A  L S T HR  L    I++K 
Sbjct: 54  SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPS-TIHRMFLACLIISAKY 112

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNI 172
             DS   N H+++   G     ++N++E + L  +N+ +   +N++
Sbjct: 113 HNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNWDLRINENDL 158

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 5/98 (5%)

Query: 72  VFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSL--TAHRFLLTATTIASKGL 129
           +F +  ++   S ++   L++   Y++ L N+ P  N+  +  T HR  L    +A+K L
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPT-NVYGIETTRHRIFLGCLILAAKTL 106

Query: 130 CDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRI 165
            DS   N H+S    G ++  E+N +E E L   N+ +
Sbjct: 107 NDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 69/150 (46%), Gaps = 17/150 (11%)

Query: 48  SNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLL------- 100
           S + E  +KY  TR ++ +    S+ ++   +TK S  + ++LL A YY   L       
Sbjct: 74  SFLSETAKKYSTTRINNDVQ---SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTC 130

Query: 101 -SNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLR 159
             +  P F   +  A R  LT   IA K L DS  +   +S + G+    L+ +E   L 
Sbjct: 131 PVSTIPEF---AFCAKRSFLTCIIIAHKYLNDSTFSMESWSLISGLNKKALSTIERWCLG 187

Query: 160 KVNYRIIPRDNNITFCKMEVQKNFFILPES 189
           K++Y +   D  + F   + +K  F LP++
Sbjct: 188 KLDYNLFVDD--LQFGSWQ-RKCLFQLPQT 214

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 12/128 (9%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + +RL +Y+ +  S LL+ V Y++ L  + P  A  L + T HR  L    +++K 
Sbjct: 58  SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPT-TCHRIFLACLILSAKY 116

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFIL 186
             DS   N H++K   G     ++N++E + L+   +       ++     E+  N + L
Sbjct: 117 HNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW-------DLRVESEELWDNLYDL 169

Query: 187 PESIESDL 194
              I  DL
Sbjct: 170 ANPIRRDL 177

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 5/97 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + T+L +Y+ +  S LL+ V Y+  L  + P  A  L S T HR  L    +++K 
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPS-TTHRIFLACLILSAKF 113

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNY 163
             DS   N H+S+   G     ++N++E + L+ +++
Sbjct: 114 HNDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHW 150

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 57/113 (50%), Gaps = 7/113 (6%)

Query: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA--FNLNSLTAHRFLLTATTI 124
           AP ++ F    RL K+S ++   L++   Y+  L ++ P+  + + + T HR  L    +
Sbjct: 46  APPLTKF--INRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLIL 102

Query: 125 ASKGLCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNITFC 175
           A+K L DS   N H+++   G +   E+N +E E L   ++ +    +++  C
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 64/134 (47%), Gaps = 14/134 (10%)

Query: 38  MLQFIIQINDS--NIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVY 95
           M+QF+     S   I+EN       R      P++S+F     +   S ++   L++   
Sbjct: 20  MIQFLATSTASIIKIRENNNPIQGCR-----PPDLSIF--IKNVVIQSNVQTPTLMATSV 72

Query: 96  YIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQCNELN 151
           Y++ L +V P   + +N+ T HR  L    +A+K L DS   N H++    G ++  E+N
Sbjct: 73  YLNKLKSVIPKNVYGINT-TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLLRIREVN 131

Query: 152 VLENEFLRKVNYRI 165
            +E E L  +N+ +
Sbjct: 132 TIERELLEYLNWDV 145

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 56/113 (49%), Gaps = 7/113 (6%)

Query: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA--FNLNSLTAHRFLLTATTI 124
           AP ++ F    RL K+S ++   L++   Y+  L ++ P+  + + + T HR  L    +
Sbjct: 46  APPLTEF--INRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIET-TRHRIFLGCLIL 102

Query: 125 ASKGLCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNITFC 175
           A+K L DS   N H+++   G +   E+N +E E L   ++ +     ++  C
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AEL195W
          Length = 370

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 73/150 (48%), Gaps = 13/150 (8%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  +  ++ +Y+ +  + LL+ V Y++ L  V P  A  + S T+HR  L    +++K 
Sbjct: 115 SLTTFIAKIVRYTNVYTATLLTTVVYLNKLKKVLPKDATGIPS-TSHRIFLACLILSAKF 173

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFIL 186
             DS   N H+++   G     ++N++E + L+  ++       NI   + ++ +N   L
Sbjct: 174 HNDSSPLNKHWTEYTDGLFTIQDVNLMERQLLKLFDW-------NIRVSEHDLHENLSSL 226

Query: 187 PESIESDLAPSLR-QGYSSISNAGYNVLTR 215
              I+ DL  S R + Y+S     ++  T+
Sbjct: 227 LLPIKQDLIRSKRLRNYTSKRKPSFSWTTK 256

>Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {ON}
           YPL219W (PCL8) - cyclin (Pho85p) [contig 165] FULL
          Length = 480

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 63/134 (47%), Gaps = 6/134 (4%)

Query: 59  LTRFHSKIAPNISVFNYFTRL-TKYSL-----LEHSVLLSAVYYIDLLSNVYPAFNLNSL 112
           L  F+    P ++   Y  RL  K+S      L  + LL +++     + +   ++L++ 
Sbjct: 345 LATFNMDSTPTLAYEEYLQRLHCKFSFAPIVYLTAAHLLQSLFLTRKDNKLCCKYHLDNC 404

Query: 113 TAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNI 172
             HR ++ +  +A+K L D   ++T +S++ G+    L  LE  FL  +N+  +   N+ 
Sbjct: 405 QVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFEGLKITNHS 464

Query: 173 TFCKMEVQKNFFIL 186
                +VQ+   +L
Sbjct: 465 LLQAAQVQQELSVL 478

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 73/162 (45%), Gaps = 21/162 (12%)

Query: 30  DLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSV 89
           +++  +A     IIQI  ++       +G  R      P++S F     +   S ++   
Sbjct: 19  EMIQFLATSTASIIQIRQTSTPN----HGFNR-----PPDLSTF--IKNVVIQSNVQTPT 67

Query: 90  LLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKV--GGV 145
           L++   Y++ L N+ P   + + + T HR  L    +A+K L DS   N H++    G +
Sbjct: 68  LMATSVYLNKLRNIIPRNVYGIET-TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEGLL 126

Query: 146 QCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILP 187
           +  E+N +E E L   N+     D  IT   +    ++F++P
Sbjct: 127 RVREVNTIERELLEYFNW-----DVRITTHDLVDALSYFLVP 163

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query: 68  PNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSL--TAHRFLLTATTIA 125
           P   +  +  RL K+S ++   L++   Y+  L ++ P+ N+  +  T HR  L    +A
Sbjct: 45  PAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRSIIPS-NVYGIETTRHRIFLGCLILA 103

Query: 126 SKGLCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRI-IPRDNNIT 173
           +K L DS   N H+++   G +   E+N +E E L   ++ + I  D+ IT
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDLIT 154

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 63  HSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLT 120
           H +  P  S+  + TRL +Y+ +  S LL+A  Y++ L  + P  A  L S T+HR  L 
Sbjct: 53  HKRTLP--SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TSHRIFLA 109

Query: 121 ATTIASKGLCDSFCTNTHYSK-VGGVQCNE-LNVLE 154
              +++K   DS   N H++    G+ C E +N++E
Sbjct: 110 CLILSAKFHNDSSPQNKHWAAYTDGLFCLEDVNLME 145

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 48/88 (54%), Gaps = 5/88 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + TRL +Y+ +  S LL+A  Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TGHRIFLACLILSAKY 145

Query: 129 LCDSFCTNTHYSK-VGGVQC-NELNVLE 154
             DS   N H++    G+ C +++N++E
Sbjct: 146 HNDSSPQNKHWAAYTDGLFCLDDVNLME 173

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 5/106 (4%)

Query: 74  NYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKGLCD 131
           N+   L  +S ++   L++   Y+  L  + P   + + + T HR  L    +A+K L D
Sbjct: 55  NFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMET-TRHRIFLGCLILAAKTLND 113

Query: 132 SFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRIIPRDNNITFC 175
           S   N H++K   G +   E+N +E E L    + +    + +  C
Sbjct: 114 SSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNVTITTSELIKC 159

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+ ++ +RL +++ +  S LL    Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 87  SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMFLACLILSAKF 145

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRI 165
             DS   N H++K   G     ++N++E + ++ +N+ +
Sbjct: 146 HNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDL 184

>Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W
           (REAL)
          Length = 437

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 72/169 (42%), Gaps = 22/169 (13%)

Query: 3   PQDAQINTDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQI--NDSNIKENE--RKYG 58
           P    I+ D E+P I         P G+ +  + R +  ++++  N S I  N    K  
Sbjct: 248 PLLCGISGDVEVPHI---------PVGEALENLKRTIDLLLKLSNNKSCIGSNSGMEKKE 298

Query: 59  LTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLL---------SNVYPAFNL 109
              F+ K  P++S  ++  R+      E +V L A++ I++L           +     L
Sbjct: 299 YANFYMKSKPSLSSVDFLKRIQDKCKYEPTVYLVAMFLIEMLFLTRNKNGDDGLQLKRKL 358

Query: 110 NSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFL 158
                HR ++ A  +++K L D   ++ ++SKV G+    L  LE   L
Sbjct: 359 KEKEVHRVIIAAVRLSTKLLEDYVHSHEYFSKVCGISKRLLTKLEVSLL 407

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 8/112 (7%)

Query: 67  APNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA--FNLNSLTAHRFLLTATTI 124
           AP ++ F     L K+S ++   L++   Y+  L ++ P+  + + + T HR  L    +
Sbjct: 46  APPLTKF--INGLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLIL 102

Query: 125 ASKGLCDSFCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRI-IPRDNNIT 173
           A+K L DS   N H+++   G +   E+N +E E L   ++ + I  D+ IT
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDLIT 154

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 88  SVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGG--V 145
           +++ S VY + L   + P       T HR  L    IA+K L D+   N H+SK     +
Sbjct: 66  TLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIAAKTLNDNSPLNKHWSKHTNNLL 125

Query: 146 QCNELNVLENEFLRKVNYRI 165
              E+N++E E L  + +R+
Sbjct: 126 PNREINIIERELLSYLRWRV 145

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 51/97 (52%), Gaps = 5/97 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+ ++ +RL +++ +  S LL+   Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRIFLACLILSAKF 109

Query: 129 LCDSFCTNTHYSKVGG--VQCNELNVLENEFLRKVNY 163
             DS   N H++K         ++N++E + ++ +N+
Sbjct: 110 HNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W
           (REAL)
          Length = 442

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 15/120 (12%)

Query: 49  NIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFN 108
           N KE E++Y    F+ K  P++S  ++  R+      E +V L A + +D    +Y   N
Sbjct: 298 NNKETEKEYA--NFYMKSKPSLSSVDFLKRIQDKCEYESTVYLVATFLMD---TIYLTRN 352

Query: 109 LNSLTA----------HRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFL 158
            N +            HR ++    +++K L D   ++ ++SKV GV    L+ LE   L
Sbjct: 353 DNDVLQLKLKLQEKEIHRMIIATVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEVSLL 412

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 8/94 (8%)

Query: 60  TRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLL--------SNVYPAFNLNS 111
           +RF  K  P++S  ++  R+      +  V LSA Y + +L        +++   F L  
Sbjct: 349 SRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERSAESNSLELKFKLQR 408

Query: 112 LTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGV 145
              HR ++    I++K L D   ++ ++SKV GV
Sbjct: 409 DGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + TRL +Y+ +    LL+ V Y++ L  + P  A  L S T HR  L    I++K 
Sbjct: 59  SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACLIISAKF 117

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLE 154
             DS   N H+++   G     ++N++E
Sbjct: 118 HNDSSPLNKHWTRYTDGLFSLEDINLME 145

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + TRL +Y+ +    LL+ V Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLE 154
             DS   N H+ K   G     ++N++E
Sbjct: 113 HNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 5/95 (5%)

Query: 75  YFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKGLCDS 132
           +  +L +Y+ +    LL  + Y++ L  + P  A  + S T HR  L    I++K   DS
Sbjct: 59  FICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPS-TLHRIFLACLIISAKNHNDS 117

Query: 133 FCTNTHYSKV--GGVQCNELNVLENEFLRKVNYRI 165
              N H++K   G     ++N++E   L  +N+ +
Sbjct: 118 SPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 63/139 (45%), Gaps = 17/139 (12%)

Query: 30  DLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSV 89
           ++V  +A     +I IND++++     +G T         +S+ ++   L ++S ++   
Sbjct: 18  EMVHFLAATTASVISINDTDVR-----HGST---------VSLVDFIKSLIRHSNVQTPT 63

Query: 90  LLSAVYYIDLLSNVYPAFNLN-SLTAHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQ 146
           L++   Y+  L ++ P        T HR  +    +A+K L DS   N H++    G   
Sbjct: 64  LMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKNLNDSSPLNKHWTNYTDGLFT 123

Query: 147 CNELNVLENEFLRKVNYRI 165
             ++N +E E L   ++ +
Sbjct: 124 LEDVNTIERELLSLFSWNL 142

>YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85p
           cyclin; recruits, activates, and targets Pho85p
           cyclin-dependent protein kinase to its substrate
          Length = 433

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 55/117 (47%), Gaps = 9/117 (7%)

Query: 49  NIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLL------SN 102
           N +  +++Y  + F+ K  P +S  ++  R+      + +V L A + ID L      +N
Sbjct: 289 NTRVEKKEY--SNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNN 346

Query: 103 VYP-AFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFL 158
           +     NL     HR ++ A  +++K L D   ++ ++SKV G+    L  LE   L
Sbjct: 347 ILQLKLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLL 403

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 64/132 (48%), Gaps = 14/132 (10%)

Query: 38  MLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYI 97
           ML F+I   +S IK       + + +S     +S+F     L   S ++ S L++   Y+
Sbjct: 30  MLTFLISKTNSMIK-------IKKTNSPKPVELSLF--VEELVASSKVQASTLMATAVYL 80

Query: 98  DLLSNVYPAFNLNSL--TAHRFLLTATTIASKGLCDSFCTNTHYSKV--GGVQCNELNVL 153
           D LS + P+ N+  +  T HR  L    ++SK L DS   N H++K   G +   E+N +
Sbjct: 81  DRLSRIIPS-NVCGIETTKHRMFLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSI 139

Query: 154 ENEFLRKVNYRI 165
           E E L   N+ I
Sbjct: 140 ERELLSYFNWDI 151

>ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {ON}
           weakly similar to uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 428

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 48/119 (40%), Gaps = 8/119 (6%)

Query: 44  QINDSNIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLL--- 100
           Q  D     N R +   +F  K  P ++   + TR+        +V L++ + +  L   
Sbjct: 273 QAQDQQDVPNPRDWDFNQFSMKSMPTVTYQEFITRIQTKCTYSPAVFLASAFLLQTLCLM 332

Query: 101 -----SNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLE 154
                  +     L     HR ++    IA+K + D   ++ ++SKV G+    L+ LE
Sbjct: 333 RNDNNGELCLRHRLQDSQIHRLVIACVRIATKIMEDHVHSHQYFSKVCGISKRLLSRLE 391

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 14/121 (11%)

Query: 83  SLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKV 142
           +L+  +VLL  +  I + SNVY   +    T HR  L    +++K L DS   N H++K 
Sbjct: 66  TLMATTVLLEKLKKI-IPSNVYGIES----TRHRIFLGCLILSAKSLNDSSPLNKHWAKY 120

Query: 143 --GGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPESIESDLAPSLRQ 200
               +   E+N +E E L   NY     D N++  + E+  +     E I+ D+    RQ
Sbjct: 121 TESYIHLREVNTIERELL---NY----FDWNVSISQEELFSSLSYFLEPIKQDMMMKQRQ 173

Query: 201 G 201
            
Sbjct: 174 N 174

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query: 71  SVFNYFTRLTKYS-LLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGL 129
           S+  + TRL +Y+ +   ++L +AVY   L   +         TAHR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 130 CDSFCTNTHYSKV--GGVQCNELNVLENEFLR------KVNYRIIPRD 169
            DS   N H++K   G     ++N++E + LR      +V +R + RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 64/138 (46%), Gaps = 13/138 (9%)

Query: 30  DLVILIARMLQFIIQINDS---NIKENE-RKYGLTRFHSKIAPNISVFNYFTRLTKYSLL 85
           D +   +  ++ +++++D     I +N+  K     F+ K  P++S  ++  R+      
Sbjct: 264 DALANFSETIELLLKLSDDEKCTISKNDVEKKEYANFYMKSKPSLSSVDFLRRIQDKCEY 323

Query: 86  EHSVLLSAVYYIDLLSNVYPAFNLNSLT---------AHRFLLTATTIASKGLCDSFCTN 136
           E +V L A + +D L       N N+L           HR ++ +  +++K L D   ++
Sbjct: 324 EPAVYLVATFLMDTLFLTRNERNNNALQLKLKLQEKEVHRVIIASVRLSTKLLEDFVHSH 383

Query: 137 THYSKVGGVQCNELNVLE 154
            ++SKV GV    L+ LE
Sbjct: 384 EYFSKVCGVSKRLLSKLE 401

>NDAI0I00860 Chr9 complement(197860..199491) [1632 bp, 543 aa] {ON}
           Anc_6.236 YGL134W
          Length = 543

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 35/173 (20%), Positives = 73/173 (42%), Gaps = 19/173 (10%)

Query: 1   MTPQDAQINTDEEIPTI------KLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENE 54
           ++  ++   TDE+   +      K   DF++ P  + +  +       ++++ ++I+ENE
Sbjct: 339 LSSHNSNGTTDEDTSLLSADALNKYSNDFIEIPPQEALNNLKETFSIFLKLSKNDIQENE 398

Query: 55  RKYGLT-----RFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLL--------S 101
                T      F  K  P+++   Y  R+      +  + L A Y +  L        +
Sbjct: 399 AASDSTMIRYSNFKMKSLPSLTFELYLDRIHTKCEYDSHIYLIATYLLQTLFLERDSTSN 458

Query: 102 NVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLE 154
           ++     L S   HR ++    I++K L D   ++ ++ KV G+    L+ LE
Sbjct: 459 SLKLKMKLESTETHRLIIATIRISTKLLEDHVHSHEYFCKVCGISKKLLSKLE 511

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYP--AFNLNSLTAHRFLLTATTIASKG 128
           S+  + T L +Y+ +    LL+ V Y++ L  + P  A  L S T HR  L    +++K 
Sbjct: 54  SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 129 LCDSFCTNTHYSKV--GGVQCNELNVLE 154
             DS   N H+ K   G     ++N++E
Sbjct: 113 HNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON}
           Anc_5.347 YHR071W
          Length = 199

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 94  VYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVL 153
           +Y   L +   P F   +  + R  L+   +A K L D+  T   ++ + G+  N+L ++
Sbjct: 93  IYDGQLWNGKLPDF---ARCSKRIFLSCLILAHKYLNDNSFTMKTWNMISGLSQNDLCLM 149

Query: 154 ENEFLRKVNYRIIPRDNNIT 173
           E   L K++YR++  + ++T
Sbjct: 150 ERWGLEKLDYRLLVAEEDLT 169

>TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.236
           YGL134W
          Length = 605

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 80/170 (47%), Gaps = 27/170 (15%)

Query: 2   TPQDAQINTDEE-IPTIKLPRDFLKCPKGDLVILIAR---MLQFII-QINDSNIKENER- 55
           T +D++ + +E+  PTI +  D +     D+++ + +    L FI  + + + + E  + 
Sbjct: 410 TSEDSKTSVEEQKCPTINMLTDII-----DILLKLTKNNNELHFISPEASKTEVYEQSKE 464

Query: 56  KYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHS------VLLSAVYYI-----DLLSNVY 104
           KY +  F  K  P ++  N+  R+    L + +      VLL +++ +     +L+   Y
Sbjct: 465 KYDV--FKMKSTPTVTYQNFIERIQSKCLFDETIYLGTIVLLQSLFLVREKETNLIKLKY 522

Query: 105 PAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLE 154
           P   L     HR L+ +  ++SK L D   ++ + SKV GV    L  LE
Sbjct: 523 P---LEESYVHRLLIASIRVSSKVLQDFVHSHEYISKVFGVSKRLLTKLE 569

>SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly
           similar to uniprot|Q6B153 Saccharomyces cerevisiae
           YPL219W PCL8 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) to phosphorylate and
           regulate glycogen synthase also activates Pho85p for
           Glc8p phosphorylation
          Length = 501

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLL-------SNVYPAFNLNSLTA 114
           F  K +P++S   Y  R+    +    V L+A Y +  L       S +  +F L     
Sbjct: 368 FIMKSSPSLSYEEYLERIHSKLMFSPVVYLTATYLLHELTLTRQQDSKLALSFPLKITQI 427

Query: 115 HRFLLTATTIASKGLCDSFCTNTHYSKVGGV 145
           HR ++ +  +A+K L D   ++ ++SKV GV
Sbjct: 428 HRIIIASIRLAAKLLEDFVHSHAYFSKVCGV 458

>KNAG0B01960 Chr2 complement(376106..376789) [684 bp, 227 aa] {ON}
           Anc_5.347 YHR071W
          Length = 227

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 87  HSVLLSAVYYIDLLS----NVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKV 142
           H+  L++ Y+  L+     +  P F   +  A R  L    +A K L D+  +   +SK+
Sbjct: 98  HTTSLASFYFTRLMQAEKFDALPEF---AQCAKRVFLICLILAHKFLTDNTFSAETWSKI 154

Query: 143 GGVQCNELNVLENEFLRKVNYRIIPRDNNIT 173
            G+    L+ +E   L+K++Y +      +T
Sbjct: 155 SGLPKKTLSDMERWVLKKLDYNLFVEAETMT 185

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 71  SVFNYFTRLTKYSLLEHSVLLSAVYYID-LLSNVYPAFNLNSLT--AHRFLLTATTIASK 127
           S+ N+   +TK + +   +LL A  Y D L+ +   A N+        R LL    +A K
Sbjct: 72  SIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEFAYCGKRLLLVCIILAHK 131

Query: 128 GLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNIT 173
              D   +   +++V G+    + ++E   L+++NY +   +  +T
Sbjct: 132 FSNDITFSMRVWTQVSGLPTRSIAIMERWCLKQLNYGLTVTNEAMT 177

>TBLA0A02100 Chr1 complement(508272..509996) [1725 bp, 574 aa] {ON}
           Anc_6.236 YGL134W
          Length = 574

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 43/105 (40%), Gaps = 11/105 (10%)

Query: 49  NIKENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFN 108
           N  EN+       F  K  P +S   +  R+    +    V LSA Y + +L       N
Sbjct: 426 NTDENDE---FNNFKMKSTPTLSFGEFIKRIQSKCMFGPIVYLSASYLLQILLLTRDGEN 482

Query: 109 --------LNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGV 145
                   L+    HR ++    IA+K + DS  ++ + SKV GV
Sbjct: 483 GALKLKIILHENEIHRLIIATIRIATKLIEDSVHSHLYMSKVCGV 527

>KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 527

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 52/104 (50%), Gaps = 13/104 (12%)

Query: 62  FHSKIAPNISVFNYFTRL-TKYSL-----LEHSVLLSAVYYIDLLSNVYPA-FNL-NSLT 113
           F  K AP +S+  Y  R+ +K S      L  S LL  V Y D+  +     F+L N +T
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLL--VTYCDIKFDTGSGKFHLENPIT 449

Query: 114 ---AHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLE 154
               HR L+    +A+K L D   +++++SKV G+    L+ LE
Sbjct: 450 ESMTHRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLE 493

>Kpol_339.10 s339 (17261..17833) [573 bp, 190 aa] {ON}
           (17261..17833) [573 nt, 191 aa]
          Length = 190

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 116 RFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNIT 173
           R    +  IA K + DS  +   +S V G+    L ++E   LRK++Y +    NN T
Sbjct: 124 RIFFVSLIIAQKFIEDSKLSMASWSLVSGISQRSLCIMEKWCLRKLDYSLNVEINNTT 181

>CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 547

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 45/101 (44%), Gaps = 8/101 (7%)

Query: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLL--------SNVYPAFNLNSLT 113
           F  K  P++S   +  R+         + L+A Y + +L        SN+     L    
Sbjct: 414 FTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQILFLTRDNPDSNIRVRLKLRENE 473

Query: 114 AHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLE 154
            HR +++   +++K + D   ++ ++SKV GV    L+ LE
Sbjct: 474 IHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLE 514

>TPHA0C04640 Chr3 complement(1004694..1005833) [1140 bp, 379 aa]
           {ON} Anc_2.333 YDL107W
          Length = 379

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (47%), Gaps = 14/119 (11%)

Query: 16  TIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNI-SVFN 74
           TIKL  D L    GD  +     ++FI ++ D+     E    L R H +  P+I     
Sbjct: 159 TIKLTGDLL-MKAGDDKLAEKNYMKFI-KMQDNTALAGEVYGYLGRIHLR-KPDIHKAEE 215

Query: 75  YFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSF 133
           YF +  KYS LE++V   + YY   LS +Y   + N L A  +L  +   A++G  ++F
Sbjct: 216 YFRKSIKYSRLENAVF--SYYY---LSQIY--IDTNPLRARSYLEVS---ATQGFKEAF 264

>ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|Q04636 Saccharomyces
           cerevisiae YML069W POB3 facilitates RNA Polymerase II
           transcription elongation
          Length = 574

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 52/107 (48%), Gaps = 17/107 (15%)

Query: 113 TAHRFLLTATTIA----SKGLCDSF-----CTNTHYSKVGGVQCNELNVLENEFLRKVNY 163
           T   FLL AT ++    S+G C  F       N    ++ G   ++ N+++N+F R+ N 
Sbjct: 41  TKQPFLLPATELSTVQWSRG-CRGFELKVNTKNQGVVQLDGFAPDDFNLIKNDFHRRFNV 99

Query: 164 RIIPRDNNI---TFCKMEVQKNFFILPESIESDLAPSLRQGYSSISN 207
           ++ P+++++    + K ++ +N  +       +  PS    Y+ I+N
Sbjct: 100 QVEPKEHSLRGWNWGKADLARNEMVFA----LNGRPSFEVPYARINN 142

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,939,425
Number of extensions: 1710591
Number of successful extensions: 5813
Number of sequences better than 10.0: 126
Number of HSP's gapped: 5928
Number of HSP's successfully gapped: 135
Length of query: 342
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 232
Effective length of database: 40,868,139
Effective search space: 9481408248
Effective search space used: 9481408248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)