Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02519g6.27ON31531515840.0
NCAS0H015106.27ON31330610851e-149
KNAG0M012406.27ON31430410751e-147
NDAI0F017406.27ON31330810261e-140
KAFR0G026506.27ON32130110181e-138
SAKL0E01474g6.27ON31130410001e-136
TBLA0E030606.27ON3193059941e-135
ZYRO0C07612g6.27ON3192869901e-134
KLTH0C11044g6.27ON3153069811e-133
Kwal_56.224546.27ON3153009711e-131
TDEL0G044206.27ON3223199721e-131
Kpol_1032.96.27ON3182739671e-131
YOL002C (IZH2)6.27ON3172809541e-129
Smik_15.1686.27ON3272789471e-128
Skud_15.1606.27ON3272789351e-126
KLLA0D01331g6.27ON3082969251e-124
Ecym_30316.27ON3282739231e-124
TPHA0M002906.27ON3273089141e-123
Suva_15.1736.27ON3272809131e-122
ACL002C6.27ON3293079091e-122
SAKL0C09218g3.90ON3143067443e-97
AFR337W3.90ON3172747192e-93
Kwal_56.227043.90ON3202827098e-92
YDR492W (IZH1)3.90ON3163057053e-91
ZYRO0B06556g3.90ON3182997044e-91
Suva_2.6683.90ON3153097034e-91
KLTH0C09504g3.90ON3192887011e-90
Smik_4.7693.90ON3163057001e-90
Skud_4.7663.90ON3163057002e-90
KLLA0C12441g3.90ON3152786992e-90
TDEL0D053403.90ON3163066941e-89
TPHA0A006403.90ON3273136932e-89
CAGL0G04631g3.90ON3162926792e-87
Kpol_1053.263.90ON3242736793e-87
Ecym_35883.90ON3052756652e-85
NDAI0A071603.90ON3302936463e-82
NCAS0I025703.90ON3142796322e-80
KAFR0A081303.90ON3192946176e-78
TBLA0B022903.90ON3263096039e-76
KNAG0K021603.90ON3232745784e-72
TBLA0B082553.90ON2962843902e-44
NCAS0C049203.90ON3262713626e-40
NDAI0G043003.90ON3182963285e-35
CAGL0I07491g3.90ON3012932373e-22
Suva_15.643.90ON3123111953e-16
Skud_15.533.90ON3123161873e-15
YOL101C (IZH4)3.90ON3123161742e-13
Smik_15.563.90ON3123181723e-13
KAFR0J006705.197ON5092291541e-10
TPHA0E031205.197ON5692401461e-09
AAL153C5.197ON4192851432e-09
TBLA0C060505.197ON4372421381e-08
KNAG0B051005.197ON5382441344e-08
Kpol_2002.945.197ON5772401311e-07
Skud_12.915.197ON5422341273e-07
TDEL0E043205.197ON4502051221e-06
KLTH0B03498g5.197ON5462441211e-06
KLLA0F15510g5.197ON6222771212e-06
YLR023C (IZH3)5.197ON5432421202e-06
Smik_12.865.197ON5422421159e-06
CAGL0D03322g5.197ON5452831141e-05
NDAI0I023305.197ON5782021122e-05
Suva_10.1045.197ON5411981095e-05
Ecym_71095.197ON5682401051e-04
NCAS0D026005.197ON5432751052e-04
SAKL0G12980g5.197ON5632531042e-04
Kwal_33.151225.197ON5661881014e-04
ZYRO0B10538g5.197ON531200930.004
KNAG0K006703.90ON321185870.019
KNAG0I004201.459ON108551850.051
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02519g
         (315 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   614   0.0  
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   422   e-149
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   418   e-147
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      399   e-140
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   396   e-138
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   389   e-136
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   387   e-135
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   385   e-134
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   382   e-133
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   378   e-131
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   379   e-131
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   377   e-131
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   372   e-129
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   369   e-128
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   364   e-126
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   360   e-124
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   360   e-124
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   356   e-123
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   356   e-122
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   354   e-122
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   291   3e-97
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   281   2e-93
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   277   8e-92
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   276   3e-91
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   275   4e-91
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   275   4e-91
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   274   1e-90
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   274   1e-90
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   274   2e-90
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   273   2e-90
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   271   1e-89
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   271   2e-89
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   266   2e-87
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   266   3e-87
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   260   2e-85
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   253   3e-82
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   248   2e-80
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   242   6e-78
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   236   9e-76
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   227   4e-72
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             154   2e-44
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   144   6e-40
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    130   5e-35
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    96   3e-22
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    80   3e-16
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    77   3e-15
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    72   2e-13
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    71   3e-13
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    64   1e-10
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    61   1e-09
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    60   2e-09
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    58   1e-08
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    56   4e-08
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    55   1e-07
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    54   3e-07
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    52   1e-06
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    51   1e-06
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    51   2e-06
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    51   2e-06
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    49   9e-06
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    49   1e-05
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     48   2e-05
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    47   5e-05
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    45   1e-04
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    45   2e-04
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    45   2e-04
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    44   4e-04
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    40   0.004
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    38   0.019
KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON...    37   0.051

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/315 (95%), Positives = 300/315 (95%)

Query: 1   MGDVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVR 60
           MGDVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVR
Sbjct: 1   MGDVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVR 60

Query: 61  ETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXF 120
           ETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVP               F
Sbjct: 61  ETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIF 120

Query: 121 FLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFG 180
           FLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFG
Sbjct: 121 FLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFG 180

Query: 181 IFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWT 240
           IFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWT
Sbjct: 181 IFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWT 240

Query: 241 RIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALL 300
           RIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALL
Sbjct: 241 RIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALL 300

Query: 301 GSYSLVHYRFMIDMY 315
           GSYSLVHYRFMIDMY
Sbjct: 301 GSYSLVHYRFMIDMY 315

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  422 bits (1085), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 205/306 (66%), Positives = 239/306 (78%), Gaps = 5/306 (1%)

Query: 6   QRKVATMVTTEEQPLIGTDGQIKLR---KKTVVRKLYTWEEIPEWQKDNEHIHTGYVRET 62
           Q++VA   T+        D  + ++   K T +RKLYTW+EIPEWQKDNEHI  GYVRET
Sbjct: 6   QQRVALTSTSTSTKTTIDDDNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRET 65

Query: 63  SSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFL 122
           +S   C  SLFY+HNET N+YSHL+P + FF T+ F+KY +                FFL
Sbjct: 66  NSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFL 125

Query: 123 GAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGN-PWFFGI 181
           GAF+CLILSSTFHC KSHSL++A FGNKLDYLGIV LIV SM+SIL+YGF+ N P+F+G 
Sbjct: 126 GAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYG- 184

Query: 182 FSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTR 241
           FSL+T++FG+ACA+VSLKD FRSREWRPYRA LFV FGLSAVLPIL G+  YGP ETWTR
Sbjct: 185 FSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTR 244

Query: 242 IQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLG 301
           IQLKWV+LEGVFYIFGAFLYGIRFPEK   G+FD+WGHSHQIFH+LVVVAA CHLKALLG
Sbjct: 245 IQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLG 304

Query: 302 SYSLVH 307
           SY LVH
Sbjct: 305 SYELVH 310

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  418 bits (1075), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 198/304 (65%), Positives = 234/304 (76%), Gaps = 2/304 (0%)

Query: 6   QRKVATMVTTEEQPLIGTD--GQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETS 63
             +V     T  +P++  D  G++K   K + +++YTW EIPEWQKDNEHI  GYVRET+
Sbjct: 2   SSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETN 61

Query: 64  SVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLG 123
           S ++C+ SLFYLHNE+VN+YSHLIPA+ FFS +F NKY V                FFLG
Sbjct: 62  SFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLG 121

Query: 124 AFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFS 183
           AF+CLILSSTFHC KSHSL+VA FGNKLDYLGIV LIV SM+SILYYGF+ +   F  FS
Sbjct: 122 AFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFS 181

Query: 184 LITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQ 243
            +T++FG AC VVSLKD FRSREWRPYRA LFV FGLSA+LPIL+G+F YG  E + RIQ
Sbjct: 182 FVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQ 241

Query: 244 LKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSY 303
           +KW+ILEGVFYI GAFLYGIRFPEK SPG +D+WGHSHQ+FHILVVVAALCHLK L+ SY
Sbjct: 242 IKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSY 301

Query: 304 SLVH 307
            LVH
Sbjct: 302 ELVH 305

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  399 bits (1026), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 196/308 (63%), Positives = 225/308 (73%), Gaps = 2/308 (0%)

Query: 4   VHQRKVATMVTTEEQPLIGTDG--QIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRE 61
           + +R   +  T  E  +  TD    I+  K+ VV KLY W+EIPEWQKDNEHI +GYVRE
Sbjct: 5   IQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRE 64

Query: 62  TSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFF 121
           T+S   C+ SLFY+HNE+ N+YSHL+P + FF T+  NKY +                FF
Sbjct: 65  TNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFF 124

Query: 122 LGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGI 181
            GAF CLILSS FHC KSHSL+VA  GNKLDYLGIV LIV SM+SI+Y+GF  NP FF  
Sbjct: 125 FGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFYF 184

Query: 182 FSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTR 241
           FS +T  FG ACA VSLKD FRSREWRPYRA LFV FGLSA+LPILAG F YG  ET+ R
Sbjct: 185 FSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIR 244

Query: 242 IQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLG 301
           IQLKW+ILEG FYIFGAFLYG+RFPEK  PGSFD+WGHSHQIFHILVVVAA CHL+ LL 
Sbjct: 245 IQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLS 304

Query: 302 SYSLVHYR 309
           SY +VH R
Sbjct: 305 SYEIVHSR 312

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  396 bits (1018), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/301 (63%), Positives = 224/301 (74%), Gaps = 2/301 (0%)

Query: 7   RKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVM 66
           RKV   + T  Q ++  +    +R    + +LY W EIP+WQKDNEHI +GYV+ET+S  
Sbjct: 11  RKVT--IDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFF 68

Query: 67  ECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFS 126
            CI SLFYLHNE+VN+YSHLIPA+ F  T   NK +VP               FFLGAF+
Sbjct: 69  SCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFT 128

Query: 127 CLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLIT 186
           CLILSSTFHC KSHSLR+A FGNKLDYLGIV LI  SM+S+LYYGF+  P  F +F+ IT
Sbjct: 129 CLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFIT 188

Query: 187 MTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKW 246
           ++FG ACA VSLKD FRSRE R YRA LFV FGLSAVLP++ GL+ YG   TW RIQLKW
Sbjct: 189 LSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKW 248

Query: 247 VILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLV 306
           V+LEGVFYIFGAFLYGIRFPEK +PG +D+WGHSHQ+FHILVV+AALCH KAL+ SY  V
Sbjct: 249 VLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHV 308

Query: 307 H 307
           H
Sbjct: 309 H 309

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 187/304 (61%), Positives = 228/304 (75%), Gaps = 7/304 (2%)

Query: 6   QRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSV 65
           Q K A +V  E      + G I  ++   VR+LY+WEEIP+WQKDNEHI  GYVRET+S 
Sbjct: 11  QIKRANIVKEETM----STGTINKKR---VRRLYSWEEIPDWQKDNEHIRHGYVRETNSF 63

Query: 66  MECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAF 125
           + C  SLFY+HNE+VNIY+HL+P + FF  + F+K  +                FFLGAF
Sbjct: 64  LGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAF 123

Query: 126 SCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLI 185
           +CLILSSTFHCLK+HSLR+A+ GNKLDYLGIV LIV+SM+SI+YYGF  +  FF  FS +
Sbjct: 124 TCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTL 183

Query: 186 TMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLK 245
           T+ FG ACA+ SL DTFRSREWRPYRAALFV FGLSAVLPI +G+  YG  ETW ++Q+K
Sbjct: 184 TLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVK 243

Query: 246 WVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSL 305
           WV+L GVFYI GA LY +R PE++SPG FD+WGHSHQIFHILVV+AALCHLKA+L SY L
Sbjct: 244 WVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYEL 303

Query: 306 VHYR 309
           VH +
Sbjct: 304 VHKK 307

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  387 bits (994), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 185/305 (60%), Positives = 227/305 (74%), Gaps = 1/305 (0%)

Query: 6   QRKVATMVTTEEQPLIGTDGQIKLRKK-TVVRKLYTWEEIPEWQKDNEHIHTGYVRETSS 64
           QR+  T  T E   L+  D Q +L    +  ++LYTW+EIP WQ DNE+I+TGYVRET+S
Sbjct: 6   QRRKLTSSTEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNS 65

Query: 65  VMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGA 124
           + E   SLFY+HNE+VNIY+HLIPA  F S + FN Y V                FF+GA
Sbjct: 66  MKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGA 125

Query: 125 FSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSL 184
           F+CL LSSTFHC KSHSL+++VFGNKLDYLGIV LI  S++S+LY+G+H +P+ F IFS 
Sbjct: 126 FTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIFYIFSG 185

Query: 185 ITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQL 244
           IT+ FG AC + SLKD FR+REWRPYRAALFV+FGLS VLPI+AG+ KYG  E + R+QL
Sbjct: 186 ITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQL 245

Query: 245 KWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYS 304
           KW+I EGV YIFGAFLYG RFPEK  PG  D+WG SHQIFH+LVV+AALCHL+ L+GSY 
Sbjct: 246 KWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYE 305

Query: 305 LVHYR 309
           LVH +
Sbjct: 306 LVHQK 310

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  385 bits (990), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 216/286 (75%), Gaps = 1/286 (0%)

Query: 27  IKLRKKTVVRKL-YTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSH 85
           IK+      +KL YTW EIP+WQKDNEHI  GYVRET+S+ EC++SL YLHNE++NIY+H
Sbjct: 30  IKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTH 89

Query: 86  LIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVA 145
            +P + F +T  F+K+ +                FF GAFSCLILSSTFHC KSHS RV+
Sbjct: 90  FLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVS 149

Query: 146 VFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSR 205
           VFGNKLDYLGIV LIV SM+SILYY FH +   F  F+LI   FG +C + S  DTFRSR
Sbjct: 150 VFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSR 209

Query: 206 EWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRF 265
           EWRPYRA LFV FGLSA+LPI+ G+ KYG  ETWTRIQ+KWVILEG+FYIFGAFLY IRF
Sbjct: 210 EWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRF 269

Query: 266 PEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYRFM 311
           PE+++PG+FD  GHSHQIFH+LVV+AALCHL AL+ SY LVH   +
Sbjct: 270 PERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLL 315

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  382 bits (981), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 223/306 (72%), Gaps = 9/306 (2%)

Query: 3   DVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRET 62
           ++H R V      EE   +  D  +K R K   R+LYTW+EIPEWQ+DNEHI  GY+ ET
Sbjct: 15  ELHHRMV------EENSSLLKDSNLKQRTK---RRLYTWDEIPEWQRDNEHIVGGYILET 65

Query: 63  SSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFL 122
            S  EC++SL YLHNE+VNIY+HL+P   F     FN+ V+                FFL
Sbjct: 66  KSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFL 125

Query: 123 GAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIF 182
           G F+CL++SS FHC K HSL VA+ GNKLDYLGIV L+V S+VSIL+YGFH    +F +F
Sbjct: 126 GGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLF 185

Query: 183 SLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRI 242
           S +TM FG ACA VSL + FRSREWRPYRA+LFV FGLSA+LP++AG   YG  ETWTRI
Sbjct: 186 SGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRI 245

Query: 243 QLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGS 302
           QL+WV+L GVFYI GA LYGIRFPE+M+PG FD+WGHSHQ+FHILVVVAALCHL+ALLG+
Sbjct: 246 QLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGA 305

Query: 303 YSLVHY 308
           Y L H+
Sbjct: 306 YKLFHH 311

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  378 bits (971), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 179/300 (59%), Positives = 220/300 (73%), Gaps = 3/300 (1%)

Query: 13  VTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSL 72
           V TEE   +    +I+ R +   R+LY W+EIPEWQKDNEHI  GY+ ET SV  C++SL
Sbjct: 19  VMTEETTTLLNGSRIEERTR---RRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSL 75

Query: 73  FYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSS 132
            YLHNE+VNIY+HLIP   F     FN+  +                FFLG F+CL++SS
Sbjct: 76  LYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSS 135

Query: 133 TFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAA 192
           TFHC K HSL VAV GNKLDYLGIV L+V SMVSIL+YGFH N  +F +FS +T+ FG A
Sbjct: 136 TFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLA 195

Query: 193 CAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGV 252
           C +VSL D FRSR+WRPYRAALFV FGLSA+ P++AG+  YG   TWTRIQLKWV LEGV
Sbjct: 196 CTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGV 255

Query: 253 FYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYRFMI 312
           FYI GA LYG+RFPE+++PG+FD+WG SHQ+FH+LVV+AA CHL+ALLG+Y  VH + +I
Sbjct: 256 FYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQMLI 315

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  379 bits (972), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 231/319 (72%), Gaps = 7/319 (2%)

Query: 1   MGDVHQRKVATMVTTEEQPLIG---TDGQIKLRKKTVV----RKLYTWEEIPEWQKDNEH 53
           M D  +++    +TT++   +    T G +K +K   +    RKLYTW+EIP WQ+DNEH
Sbjct: 1   MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEH 60

Query: 54  IHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXX 113
           I +GYV ET S+ +C  SLFYLHNE+VNIY+HL+P IAF   + F+K+ V          
Sbjct: 61  ILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLID 120

Query: 114 XXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFH 173
                 F L +F+CL LSS FHCLK+HS  VA FGNKLDYLGIV L+V SMVSI+YYGF 
Sbjct: 121 YVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF 180

Query: 174 GNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKY 233
             P  F +FS IT TFGAACAVVSLK+ FR+REWRPYRAA+FV FGLSAVLPI+ G+F Y
Sbjct: 181 ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYY 240

Query: 234 GPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAAL 293
           G +E + RIQ+KWV+L G+FYI GA LYG+RFPEK +PG +D+WGHSHQ+FH+LVVVAAL
Sbjct: 241 GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAAL 300

Query: 294 CHLKALLGSYSLVHYRFMI 312
           CHL  L+ SY+LVH +  I
Sbjct: 301 CHLYGLIKSYNLVHLKMAI 319

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  377 bits (967), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 175/273 (64%), Positives = 214/273 (78%)

Query: 37  KLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTI 96
           +L TWE +P+WQKDNEHI +GYV+ET+S+  C+ SL ++HNE+VNI+SHL+PA  F +TI
Sbjct: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99

Query: 97  FFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGI 156
            F+KYVV                F  GAF+CL++SS FHCLK+HS  V+ FGNKLDYLGI
Sbjct: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGI 159

Query: 157 VFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFV 216
           V LIV+SM SILYYGF+ N + +  FS IT TFG +CAVVSL + FR+REWRPYRAA+FV
Sbjct: 160 VVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219

Query: 217 IFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDL 276
            FGLSA+LPI AG   YG  ET  R+QLKWV+LEGVFYIFGA LYG+RFPE++ PG FD+
Sbjct: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279

Query: 277 WGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309
           WGHSHQ+FHILVVVAALCHL+ LLGSY++VH R
Sbjct: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTR 312

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  372 bits (954), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 173/280 (61%), Positives = 215/280 (76%)

Query: 30  RKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPA 89
           + K V+R+LY+W+EIPEWQ+DN+ I  GYV+ETSS +E  +SLFYLHNE+VNIYSHLIPA
Sbjct: 31  KAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPA 90

Query: 90  IAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGN 149
           + FF+ +  +K  +                F+ GAF+CLILSS+FHCLKSHSLR+A  GN
Sbjct: 91  LGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGN 150

Query: 150 KLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRP 209
           KLDYLGI  LIV SMVSILYYG+      F +F+LIT++FG AC++VSLKD FR REWRP
Sbjct: 151 KLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRP 210

Query: 210 YRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKM 269
           YRA LFV FGLS+++PI +GL+ Y  +E WT+IQL WV+L GV YI GA LYG+RFPEK+
Sbjct: 211 YRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKI 270

Query: 270 SPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309
            PG FD+WGHSHQ+FH LVV+AALCHL+ LL SY LVH +
Sbjct: 271 CPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIK 310

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  369 bits (947), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 170/278 (61%), Positives = 215/278 (77%)

Query: 32  KTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIA 91
           K V+++LY+W+EIPEWQ+DN+ I  GYVRETSS +E  +SLFYLHNE+VNIYSHL+PA+ 
Sbjct: 43  KKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALG 102

Query: 92  FFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKL 151
           FF+ +  +K  +                F+ GAF+CLILSS+FHCLKSHSLR+A  GNKL
Sbjct: 103 FFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162

Query: 152 DYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYR 211
           DYLGI  LIV SMVSIL+YG++     F +F+LIT++FG AC++VSLKD FR REWRPYR
Sbjct: 163 DYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYR 222

Query: 212 AALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSP 271
           A LFV FGLS+++PI +GL+ Y  +E WT+IQL WV+L GV YI GA LYG+RFPEK+ P
Sbjct: 223 AGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282

Query: 272 GSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309
           G FD+WGHSHQ+FH LVV+A+LCHL+ LL SY LVH +
Sbjct: 283 GKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIK 320

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  364 bits (935), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 213/278 (76%)

Query: 32  KTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIA 91
           K V+++LY+W+EIPEWQ+DN++I  GYVRET S +E  +SLFY+HNE+VNIYSHLIPA+ 
Sbjct: 43  KKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALG 102

Query: 92  FFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKL 151
           FF+ +  +K  +                F+ GAF+CLILSS+FHCLKSHSLR+A  GNKL
Sbjct: 103 FFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162

Query: 152 DYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYR 211
           DYLGI  LIV SM SILYYG++     F +F+LIT++FG AC++V+LKD FR REWRPYR
Sbjct: 163 DYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYR 222

Query: 212 AALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSP 271
           A LFV FGLS+++PI +GL+ Y  +E WT+IQL WV+L GV YI GA LYG+RFPEK+ P
Sbjct: 223 AGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282

Query: 272 GSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309
           G FD+WGHSHQ+FH LVV+A+ CHL+ LL SY LVH +
Sbjct: 283 GKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLK 320

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 177/296 (59%), Positives = 211/296 (71%), Gaps = 1/296 (0%)

Query: 13  VTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSL 72
           V TEE  LI      K   +   R++Y+W+EIP+WQKDNEHI  GYVRET S  E   SL
Sbjct: 8   VVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSL 67

Query: 73  FYLHNETVNIYSHLIPAIA-FFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILS 131
           FYLHNE+VNIY+HLIPA+A FF  +F   +V+                FF G  +CL +S
Sbjct: 68  FYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMS 127

Query: 132 STFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGA 191
           S FH +K HSL +A FGNKLDYLGIV LI  SM+SIL+YGFH +   F  F+ +T  FG 
Sbjct: 128 SMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGL 187

Query: 192 ACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEG 251
            C  +SLKD FRSREWRPYRA +FV+FGLSAV PI+AG   YG  ETW R+QL WVI EG
Sbjct: 188 ICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEG 247

Query: 252 VFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
           V YIFGAFLYG+RFPE+++PG FD+WGHSHQ+FH+LVVVAALCHLKAL+ SY LVH
Sbjct: 248 VLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLVH 303

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  360 bits (923), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 205/273 (75%)

Query: 37  KLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTI 96
           KL++W EIPEWQ+DNEHI  GYV+ET+S  E + SL YLHNE+VNIY+HLIP + FF  +
Sbjct: 47  KLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVL 106

Query: 97  FFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGI 156
           F NKYV+                FF+GAF+CL++S T+HCLKSHS  V++ GN+LDY+GI
Sbjct: 107 FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGI 166

Query: 157 VFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFV 216
           V LI  SM S+LYYGF+ +   F  FS +T+  G  C VV+L   FRSR WRPYRA++FV
Sbjct: 167 VILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFV 226

Query: 217 IFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDL 276
            FGLS++LPILA +  YG  ETW  +QL W+ILEGV YIFGAF+YGIRFPE M+PGSFD+
Sbjct: 227 AFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDI 286

Query: 277 WGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309
           WGHSHQ+FH+LVV+AALCH KA+  SY LVH+R
Sbjct: 287 WGHSHQLFHVLVVIAALCHFKAVTQSYELVHFR 319

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  356 bits (914), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 172/308 (55%), Positives = 216/308 (70%), Gaps = 10/308 (3%)

Query: 9   VATMVTTEEQPLIGTDGQIKLRKKTV------VRKLYT---WEEIPEWQKDNEHIHTGYV 59
           V++   TEE+  I  DG +K  KK V       R+L T   W+++P+WQKDNEHIH GYV
Sbjct: 16  VSSSAVTEEEYTIANDG-VKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYV 74

Query: 60  RETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXX 119
           +ET+S + C  SLF+LHNE+VNIYSH++P +     +  +  ++                
Sbjct: 75  KETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDL 134

Query: 120 FFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFF 179
           F  GAFSCLILSS FH LKSHSL VA++GNKLDYLGIV LIV SM+SILYYGF+  P+FF
Sbjct: 135 FLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFF 194

Query: 180 GIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETW 239
            +FS IT+ FG AC  VSL + FRSREWRPYRA LFV FGLSAV P+L G++ YG  +T+
Sbjct: 195 HLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTF 254

Query: 240 TRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKAL 299
            RIQLKW++ EG FYIFGAFLY +R+PE++ PG+FDLWGHSHQIFH+ VV+AA  H   L
Sbjct: 255 KRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGL 314

Query: 300 LGSYSLVH 307
           L +Y   H
Sbjct: 315 LSAYEYAH 322

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  356 bits (913), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 162/280 (57%), Positives = 213/280 (76%)

Query: 30  RKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPA 89
           + K V++++Y+W+EIPEWQ+DN++I  GYV+ETSS ++  +SLFY+HNE+VNIYSHLIPA
Sbjct: 41  KAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPA 100

Query: 90  IAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGN 149
           + F + +  +K  +                FF GAF+CLILSS+FHC KSHSL++A  GN
Sbjct: 101 VGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGN 160

Query: 150 KLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRP 209
           KLDYLGI  LIV SMVSILYYG++     F +F+LIT++FG AC++VSLKD FR REWRP
Sbjct: 161 KLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRP 220

Query: 210 YRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKM 269
           YRA LFV FGLS+++PI +GL+ Y  +E W +IQL WV+L G  YI GA LYG+RFPEK+
Sbjct: 221 YRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKV 280

Query: 270 SPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309
            PG FD+WGHSHQ+FH LVV+A+LCH++ +L SY LVH +
Sbjct: 281 YPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIK 320

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  354 bits (909), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 211/307 (68%), Gaps = 6/307 (1%)

Query: 6   QRKVATMVTTEEQPLIGTDGQIKLRKKTV-----VRKLYTWEEIPEWQKDNEHIHTGYVR 60
           +   A+  +T+E   +  DG +            V  L +W+++P+WQKDNEHI +GYVR
Sbjct: 16  ENDTASSYSTKETTFL-QDGTVAAAITATRAIREVSSLCSWDDLPDWQKDNEHILSGYVR 74

Query: 61  ETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPXXXXXXXXXXXXXXXF 120
           ET+S  +  RSLFYLHNE+VNIYSHLIP I F     FNKYVV                F
Sbjct: 75  ETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADYSTTTWKDYLMIDIF 134

Query: 121 FLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFG 180
            LGA  CL LS  +HC+KSHSL V+VFGNKLDY+GIV LI  SM+S +YYGF+ +   F 
Sbjct: 135 LLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGFYDSTAMFS 194

Query: 181 IFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWT 240
           +FS +T++   ACAVVSL   FRSREWR YRAA+F  FGLS +LP++   F YGP E ++
Sbjct: 195 LFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYS 254

Query: 241 RIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALL 300
           RIQLKW+ LEGV YI GA LYG+RFPEK+ PGSFD+WGHSHQ+FH+LVV+AALCHL+ALL
Sbjct: 255 RIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHLRALL 314

Query: 301 GSYSLVH 307
             Y  VH
Sbjct: 315 SCYKNVH 321

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  291 bits (744), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 198/306 (64%), Gaps = 12/306 (3%)

Query: 4   VHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETS 63
           V QR+  T   + E   I T    K RK+     L T+EE+P+WQKDNE I  GYVRET 
Sbjct: 7   VRQRRKTTQKASAES--IATA---KGRKR-----LCTFEELPDWQKDNELILDGYVRETR 56

Query: 64  SVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFF--NKYVVPXXXXXXXXXXXXXXXFF 121
           SV EC +SL Y HNETVNIY+HL+P + +   + F  +  ++P               F 
Sbjct: 57  SVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFL 116

Query: 122 LGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGI 181
           LGAF CL+ SS FHCLK HS   +   +K+DY+GI+ LI  SMVSILYYGFH + + F I
Sbjct: 117 LGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKI 176

Query: 182 FSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTR 241
           F+++T+  G+ CA   L D F S+ +R +RA+ FV FG S ++PI+ GL K+G +E+  R
Sbjct: 177 FTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHR 236

Query: 242 IQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLG 301
           +QLK+V LE VFYI GA  YG R PE   PG FDL GHSHQIFH++VV+ +LCHL+A++G
Sbjct: 237 VQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVG 296

Query: 302 SYSLVH 307
           SY  +H
Sbjct: 297 SYIFMH 302

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  281 bits (719), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 186/274 (67%), Gaps = 2/274 (0%)

Query: 32  KTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIA 91
           K  +RKLYT++E+P WQKDNE I +GYVRET+SV EC+R++ Y +NE++NIY+HLIP +A
Sbjct: 28  KKRIRKLYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTYFNNESINIYTHLIPGVA 87

Query: 92  FFST--IFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGN 149
           +     IF +  +                 + LGAF+CL  SS FHCLK HS   +   +
Sbjct: 88  YLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSSCFHCLKQHSEPHSRLWS 147

Query: 150 KLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRP 209
           K+DYLGI+  I  S +S+LYYG+H  P  F  FS +T+   +ACAV+ L D+F +  +RP
Sbjct: 148 KVDYLGILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSACAVLVLNDSFNTVAFRP 207

Query: 210 YRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKM 269
            RA LF+ FGLS V+P+LAG +++G  E   RIQLK+V+ E VFYI GA +YG R PE+ 
Sbjct: 208 LRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAVFYITGALVYGFRIPERF 267

Query: 270 SPGSFDLWGHSHQIFHILVVVAALCHLKALLGSY 303
           +PG FD+ GHSHQIFH+LVV+  LCH +A+ GSY
Sbjct: 268 APGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  277 bits (709), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 182/282 (64%), Gaps = 2/282 (0%)

Query: 28  KLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLI 87
           K  ++T    L  +EE+PEWQ+DNE I  GYVRET S+ +C+ SL Y HNET+NIY+HLI
Sbjct: 25  KSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNETLNIYTHLI 84

Query: 88  PAIAFFSTIFF--NKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVA 145
           P+  +   + F  + +++P               + LGAF CL+ S+ FHCLK HS   +
Sbjct: 85  PSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCLKQHSEAQS 144

Query: 146 VFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSR 205
              +K+DY+GI+ LI  S VS+LYYGFH   + F IF++  +  G+ CA   L D F ++
Sbjct: 145 NIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFVLNDRFNAK 204

Query: 206 EWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRF 265
            WR  RA  FV FG S ++PI+ GL K+G  E+  R+QL++V+LE  FYI GA +YG R 
Sbjct: 205 NWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGGAIIYGFRI 264

Query: 266 PEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
           PE + PG FD  GHSHQIFHILVV+ +LCH +AL+GSY  +H
Sbjct: 265 PETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMH 306

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  276 bits (705), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 133/305 (43%), Positives = 193/305 (63%), Gaps = 5/305 (1%)

Query: 5   HQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSS 64
           +Q  V    T     +    GQ    K+   + L+ ++E+PEWQKDN+ I TGYVRET S
Sbjct: 10  NQDSVCCKATRASIKVEAVSGQTVFEKQ---KLLHNFDELPEWQKDNDKILTGYVRETLS 66

Query: 65  VMECIRSLFYLHNETVNIYSHLIPAIAFF--STIFFNKYVVPXXXXXXXXXXXXXXXFFL 122
             +C+ SLFY +NETVNIY+HL+PAI +F  +    N +++P               F +
Sbjct: 67  WKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLM 126

Query: 123 GAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIF 182
           GAFSCL+ SS FHC+K HS + + F +KLDYLGI+ LI  SM+ I+Y+G+  +  +F +F
Sbjct: 127 GAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLF 186

Query: 183 SLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRI 242
           +++T+     C V  L D F +  +RP+RA  F++FG S +LP+  G FK+G      RI
Sbjct: 187 TIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRI 246

Query: 243 QLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGS 302
           ++ +V  E +FYI GA +YG R PE ++PG FD +G SHQIFHI+VV+ ++CHLKA++ S
Sbjct: 247 KVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDS 306

Query: 303 YSLVH 307
           Y L+H
Sbjct: 307 YKLMH 311

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  275 bits (704), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 134/299 (44%), Positives = 191/299 (63%), Gaps = 2/299 (0%)

Query: 11  TMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIR 70
           T V     P+   +G+   ++    + LY + E+PEWQ+DN+ I TGY+RET SV++C+R
Sbjct: 5   TEVKRRRVPIGNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLKCVR 64

Query: 71  SLFYLHNETVNIYSHLIPAIAFFSTIF--FNKYVVPXXXXXXXXXXXXXXXFFLGAFSCL 128
           SLF  +NETVNIY+HL+ A+++F  +    +  +VP               + LGAF CL
Sbjct: 65  SLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCL 124

Query: 129 ILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMT 188
           + SS FH  K HS   +   +K+DY+GI+ LI  SM+S++YYGF  +  +F +F+++T+T
Sbjct: 125 MCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLT 184

Query: 189 FGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVI 248
              AC V  L D F  +++RP RA  F+ FGLS V P+ AG+ K+G      R+QLK++ 
Sbjct: 185 LATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLG 244

Query: 249 LEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
           LE +FYI GA +YG R PE M PG FD WGHSHQIFH+LVV+A+  HLKA++GSY   H
Sbjct: 245 LEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKH 303

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  275 bits (703), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 135/309 (43%), Positives = 195/309 (63%), Gaps = 8/309 (2%)

Query: 10  ATMVTTEEQPLIGTDGQIK---LRKKTVVRK---LYTWEEIPEWQKDNEHIHTGYVRETS 63
           AT    +E     T   IK   L+ K  +RK   L+ + E+P+WQ+DN+ I TGYVRET 
Sbjct: 5   ATRRRNQENVCCKTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETL 64

Query: 64  SVMECIRSLFYLHNETVNIYSHLIPAIAFF--STIFFNKYVVPXXXXXXXXXXXXXXXFF 121
           S  +C+ SLFY +NETVNIY+HL+PAI +F       N +++P               F 
Sbjct: 65  SWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFL 124

Query: 122 LGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGI 181
           +GAF CL+ SS FHC+K HS + + F +KLDYLGI+ LI  SM+ I+Y+G+  +  +F +
Sbjct: 125 MGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSL 184

Query: 182 FSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTR 241
           F+++T+     C +  L D F +  +RP+RA  F++FG S +LP+  GLFK+G      R
Sbjct: 185 FTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNR 244

Query: 242 IQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLG 301
           I++ +V  E +FYI GA +YG R PE ++PG FD +G SHQIFHI+VV+ ++CHLKA++ 
Sbjct: 245 IRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIID 304

Query: 302 SYSLVHYRF 310
           SY L+H  F
Sbjct: 305 SYKLMHSHF 313

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  274 bits (701), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 134/288 (46%), Positives = 183/288 (63%), Gaps = 6/288 (2%)

Query: 22  GTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVN 81
           GT G     K      L  +EE+P+WQ+DN+ I  GYVRET+S+ +C  SL Y HNETVN
Sbjct: 22  GTSGATAPGKN----GLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVN 77

Query: 82  IYSHLIPAIAFFSTIFF--NKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKS 139
           IY+HLIP+  +   + F  + +++P               F LGAF CL+ S+ FHCLK 
Sbjct: 78  IYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQ 137

Query: 140 HSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLK 199
           HS   +   +K+DY+GI+ LI  S VS+LYYGF+   + F +F++  +  G+ CA   L 
Sbjct: 138 HSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLN 197

Query: 200 DTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAF 259
           D F ++ WR  RA  FV FG S ++PI+ GL K+G  E+  R+QL++V+LE +FYI GA 
Sbjct: 198 DRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAV 257

Query: 260 LYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
           +YG R PE + PG FD  GHSHQIFHILVV+ +LCH +ALLGSY  +H
Sbjct: 258 IYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMH 305

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  274 bits (700), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 133/305 (43%), Positives = 193/305 (63%), Gaps = 5/305 (1%)

Query: 5   HQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSS 64
           +Q  V   VTT    +          KK   + L+ ++E+PEWQKDN+ I TGYVRET S
Sbjct: 10  NQESVCCSVTTGSIKVEAVSSTTVSEKK---KLLHNFDELPEWQKDNDKILTGYVRETLS 66

Query: 65  VMECIRSLFYLHNETVNIYSHLIPAIAFF--STIFFNKYVVPXXXXXXXXXXXXXXXFFL 122
             +C+ SLFY +NETVNIY+HL+PA+ +F  +    N +++P               F +
Sbjct: 67  WKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLM 126

Query: 123 GAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIF 182
           GAFSCL+ SS FHC+K HS + + F +KLDYLGI+ LI  SM+ I+Y+G+  +  +F +F
Sbjct: 127 GAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLF 186

Query: 183 SLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRI 242
           +++T+     C V  L + F +  +RP+RA  F++FG S +LP+  G FK+G      RI
Sbjct: 187 TIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRI 246

Query: 243 QLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGS 302
           ++ +V  E +FYI GA +YG R PE ++PG FD  G SHQIFHI+VV+ ++CHLKA++GS
Sbjct: 247 KVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGS 306

Query: 303 YSLVH 307
           Y L+H
Sbjct: 307 YKLMH 311

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  274 bits (700), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 191/305 (62%), Gaps = 5/305 (1%)

Query: 5   HQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSS 64
           +Q  V    TT    +     +    K+   + L+ ++E+PEWQKDN+ I TGYVRET S
Sbjct: 10  NQESVCCKATTASIKVEAVQSKTASEKE---KLLHNFDELPEWQKDNDKILTGYVRETLS 66

Query: 65  VMECIRSLFYLHNETVNIYSHLIPAIAFF--STIFFNKYVVPXXXXXXXXXXXXXXXFFL 122
             +C+RSLFY +NETVNIY+HL+PAI +F  +    N +++P               F +
Sbjct: 67  WKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVINIFLM 126

Query: 123 GAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIF 182
           GAFSCL+ SS FHCLK HS   + F +KLDYLGI+ LI  SM+ I+Y+G+  +  +F +F
Sbjct: 127 GAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLF 186

Query: 183 SLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRI 242
           + +T+     C V  L + F +  +RP+RA  F++FG S +LP+  G FK+G      RI
Sbjct: 187 TTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRI 246

Query: 243 QLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGS 302
           ++ +V  E +FYI GA +YG R PE ++PG FD  G SHQIFHI+VV+ +LCHLKA++ S
Sbjct: 247 KVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKAIIDS 306

Query: 303 YSLVH 307
           Y L+H
Sbjct: 307 YKLMH 311

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  273 bits (699), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 187/278 (67%), Gaps = 2/278 (0%)

Query: 32  KTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIA 91
            + +++LY + E+PEWQ+DN+ I TGY+RET SV EC++SLF  HNE++NIYSHL+P I 
Sbjct: 26  SSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLFLFHNESINIYSHLVPTIT 85

Query: 92  FFSTI--FFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGN 149
           +   +    + ++VP               F LG+  CL  SS FHCLK HS       +
Sbjct: 86  YLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCSSFFHCLKQHSESHCHIWS 145

Query: 150 KLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRP 209
           K+DY+GI+ +I  S++S+LYYGFH + + F  F++ T+  G  C V +L D F S+ +RP
Sbjct: 146 KVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGTICTVFALHDKFNSKTFRP 205

Query: 210 YRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKM 269
           +RA  +V FGLS ++PI+ G +K+G  E   R+QLK+V+LE +FYI GA +YG RFPE +
Sbjct: 206 FRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEAMFYIAGAVIYGFRFPEVL 265

Query: 270 SPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
           +PG FD  GHSHQIFHI+VV+ ++CH +A+LGSY  +H
Sbjct: 266 APGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMH 303

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  271 bits (694), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 134/306 (43%), Positives = 196/306 (64%), Gaps = 11/306 (3%)

Query: 4   VHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETS 63
           + QRK  T V   ++     DG +        +KLY + E+PEWQ+DN+ I TGYVRET 
Sbjct: 7   IRQRK--TTVQETQKARDSKDGIMG-------KKLYHFNELPEWQQDNDKILTGYVRETK 57

Query: 64  SVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFF--NKYVVPXXXXXXXXXXXXXXXFF 121
           SV+ C+ SL Y +NE+VNIY+HL+ A+A+F  + F  +  ++P               + 
Sbjct: 58  SVLRCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYL 117

Query: 122 LGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGI 181
           LGAF CL+ SS FHC K HS   +   +K+DY+GI+ LI  S++S+LYYG+  + ++F +
Sbjct: 118 LGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKL 177

Query: 182 FSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTR 241
           FS+IT+    AC+V  L D F + + RP RA+ F+ F  S+V+PI  G+FK+G TE + R
Sbjct: 178 FSVITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHR 237

Query: 242 IQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLG 301
           +QL++V  E  FY+ GA LYG R PE ++PG FD  G SHQ+FH+LVV+ + CHL+A++G
Sbjct: 238 VQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAVMG 297

Query: 302 SYSLVH 307
           SY  +H
Sbjct: 298 SYMFMH 303

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  271 bits (693), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 194/313 (61%), Gaps = 6/313 (1%)

Query: 1   MGDVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVV----RKLYTWEEIPEWQKDNEHIHT 56
           +  VH+ +  +   +  +  +  +G + L    +V    +KLY++ E+PEWQKDNE I  
Sbjct: 4   INTVHRGEEQSSKLSRRRFSVSKNGTVLLESTEIVETYSKKLYSFHELPEWQKDNELIIQ 63

Query: 57  GYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFF--NKYVVPXXXXXXXXXX 114
           GYVRET+S  +C  SL Y HNE++NIY+HLIP + +F  + F  +  VVP          
Sbjct: 64  GYVRETNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDY 123

Query: 115 XXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHG 174
                + LGAF CL+ SS FHCLK HS   + F +K+DY+GI+ LI  S++S+LYYG+  
Sbjct: 124 IVIDFYLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFD 183

Query: 175 NPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYG 234
           +  +F +F+LIT+     C V  L + F ++ +RP RA  FV+F  SAV+PI  GL K+ 
Sbjct: 184 HFIYFKVFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFD 243

Query: 235 PTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALC 294
             E   RIQL++V  E  FY+ GA LYG R PE  +PG FDL G SHQIFH++VV+ +L 
Sbjct: 244 YVEVINRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLF 303

Query: 295 HLKALLGSYSLVH 307
           HLKA++GSY  +H
Sbjct: 304 HLKAVIGSYEFMH 316

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  266 bits (679), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 133/292 (45%), Positives = 184/292 (63%), Gaps = 3/292 (1%)

Query: 23  TDGQIKLRKKTVVRKL-YTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVN 81
            DG I    +    KL + + E+PEWQKDN+ I  GYVRET+S   C++SL YL+NE+VN
Sbjct: 22  NDGSIHAHGEEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVN 81

Query: 82  IYSHLIPAIAFFSTIFF--NKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKS 139
           IY+HLIPA+ + S   +  N +++P               FFLGAF CL+ SS FHC+K 
Sbjct: 82  IYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQ 141

Query: 140 HSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLK 199
           HS       +KLDYLGI+ LI  S V ++YYG+  +   F IF+ IT+     C+V  L 
Sbjct: 142 HSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLT 201

Query: 200 DTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAF 259
           D F + E+RP RA+ F +FG S ++P+ AG  K+G      RI L ++ LE +FYI GA 
Sbjct: 202 DKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAI 261

Query: 260 LYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYRFM 311
           +YG RFPE ++PG FD +G SHQIFHI+VV+ ++CHL A++ SY L+H  F+
Sbjct: 262 IYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSNFL 313

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  266 bits (679), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 183/273 (67%), Gaps = 2/273 (0%)

Query: 37  KLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTI 96
           KL  + E+P+WQKDNE I TGYVRET+S+ +C+RSL   +NE++NIYSHLI AI++F  +
Sbjct: 40  KLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVL 99

Query: 97  FF--NKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYL 154
            F  +   +P               + LGAF+CLI SS FHC+K HS   +   +K+DY+
Sbjct: 100 LFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYI 159

Query: 155 GIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAAL 214
           GI+ LI  S++S+LYYG+  +  +F +F++IT+     C +  L   F S+ +RP RA  
Sbjct: 160 GIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGF 219

Query: 215 FVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSF 274
           F++F +SAV+PI AG  K+G TE   RIQL++V  E  FY+ GA LYG R PE + PG+F
Sbjct: 220 FILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNF 279

Query: 275 DLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
           DL G SHQIFHI+V++ ++ HLKA+LGSY+ +H
Sbjct: 280 DLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMH 312

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  260 bits (665), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 181/275 (65%), Gaps = 2/275 (0%)

Query: 31  KKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAI 90
           KK   R+LY+++E+PEWQKDNE I  GYVRET+S +EC++S+ Y +NE+VNIY+HL+P++
Sbjct: 15  KKNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSV 74

Query: 91  AFF--STIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFG 148
            +F    +F +  V P               +  G F CL+ S+ FHCLK HS       
Sbjct: 75  TYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIW 134

Query: 149 NKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWR 208
           +K+DY+GI+  I +S+VSILYYGF+ +       S++T+T G  C    L D F + ++R
Sbjct: 135 SKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYR 194

Query: 209 PYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEK 268
             RA  F +FG S V+P+L G++++G  E   RIQLK+V+   +FYIFGA +YG R PE 
Sbjct: 195 LLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEA 254

Query: 269 MSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSY 303
           ++PG FD  GHSHQIFH+LVV+ ++CH +A++GSY
Sbjct: 255 LAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  253 bits (646), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 128/293 (43%), Positives = 185/293 (63%), Gaps = 8/293 (2%)

Query: 24  DGQIKLRKKTVVRK----LYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNET 79
           D     + KT  RK    L  ++E+PEWQKDN+ I TGYVRET+S + C +SLFYL+NET
Sbjct: 35  DNDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNNET 94

Query: 80  VNIYSHLIPAIAFF----STIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFH 135
           +NIY+HLIP+I +     + IF N   +P               F LGAF+CL+LSS FH
Sbjct: 95  INIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSCFH 154

Query: 136 CLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAV 195
           CLK HS +     +KLDY+GI+ LI  S++ ILY+G+     +F  F+++T +F   C++
Sbjct: 155 CLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVCSI 214

Query: 196 VSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYI 255
           + L + F    +RP RA LF++F  + ++P++ G + +G      RI L +V+LE +FYI
Sbjct: 215 IVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIFYI 274

Query: 256 FGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHY 308
            G  LYG R PE   PG+FD++G SHQIFHI VV+ ++CH  A++ SY L+H+
Sbjct: 275 IGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMHH 327

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  248 bits (632), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 177/279 (63%), Gaps = 2/279 (0%)

Query: 31  KKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAI 90
           K+   R+L+ + E+PEWQ+DN+ I TGYVRET S  +C++SL Y +NET+NIY+HLIPA+
Sbjct: 32  KRNWKRRLFNFNELPEWQRDNDKILTGYVRETKSFKQCLQSLLYWNNETINIYTHLIPAL 91

Query: 91  AFF--STIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFG 148
            +   S    N  VVP               F +GAF CLILSS FHCLK HS R     
Sbjct: 92  FYLTISVTLINYVVVPHFPTTSIMDYFVINVFLMGAFVCLILSSCFHCLKQHSSRQCTLW 151

Query: 149 NKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWR 208
           +KLDY+GI+ LI  S++ ++Y+G+  + ++   F ++T +F   C++  L + F    +R
Sbjct: 152 SKLDYMGIIILISCSLIPMIYFGYFDHLYYVNFFIILTFSFATLCSICVLNEKFNVPHYR 211

Query: 209 PYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEK 268
           P+RA +F++F  S  +PIL G + +G    + R+ LK+V  E +FYI GA LYG R PE 
Sbjct: 212 PFRAIVFMLFSFSGFIPILTGFYLFGFHGVFERVALKFVAWEALFYITGATLYGFRIPEC 271

Query: 269 MSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
             PG FD  G SHQIFHILVV+ ++CH +A++ SY L+H
Sbjct: 272 FKPGDFDFLGSSHQIFHILVVLGSICHFRAVIKSYILMH 310

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  242 bits (617), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 183/294 (62%), Gaps = 10/294 (3%)

Query: 23  TDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNI 82
           +D  IK+ K    R LY + E+P WQ+DN+ I  GYVRET+S  +CI SLFYL+NE++NI
Sbjct: 28  SDSSIKIEK----RILYHFHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNESINI 83

Query: 83  YSHLIPAIAFFST-----IFFNKYV-VPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHC 136
           YSHLIP++ + +      I  ++++ +P               F +GAF CL+ S  FH 
Sbjct: 84  YSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFINIFLVGAFLCLLGSGCFHL 143

Query: 137 LKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVV 196
           LK HS     F +++DY+GI+ LI  SM+ +LYYGF  +   F  F  +T+ F + C+++
Sbjct: 144 LKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVCSII 203

Query: 197 SLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIF 256
            + +TF   ++R  RA +F  FG S ++P++ G  K+G +  + RI LK++  E VFY+ 
Sbjct: 204 VMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVFYLV 263

Query: 257 GAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYRF 310
           GA LYG R PE + PG FDL+G SHQ+FH  VV+ ++ H KA++ SY L+H R+
Sbjct: 264 GATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKAVIESYILMHSRY 317

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  236 bits (603), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 177/309 (57%), Gaps = 3/309 (0%)

Query: 2   GDVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRE 61
            + H     T   ++    I +     +++K     LYT+EE+P WQ+DNE I TGY+RE
Sbjct: 7   ANAHSSSPLTHHRSKSISSILSQAAEDVKQKITDTLLYTYEELPSWQQDNEMILTGYIRE 66

Query: 62  TSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFF---NKYVVPXXXXXXXXXXXXXX 118
           T+S   C+RSL + HNET+NIYSH I A  +   + F   N   +P              
Sbjct: 67  TNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLVFFFTNLIYLPSFPTTTLHDYLVLD 126

Query: 119 XFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWF 178
            + LGA +CL LSS FHCLK HS   +   +K+DY+GI+ LI  S +S+LY+G+  +  +
Sbjct: 127 IYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFNY 186

Query: 179 FGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTET 238
           F  F++ T      C V    + F +R+W+  RA  F+ F  S ++P++ G+  +G  E 
Sbjct: 187 FKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPEV 246

Query: 239 WTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKA 298
           W R+QL  + LE + Y+ GA LYG R PE  +PG FD  G+SHQ FHI VV+ +L HL+A
Sbjct: 247 WQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLRA 306

Query: 299 LLGSYSLVH 307
           L+GSY  +H
Sbjct: 307 LVGSYYFMH 315

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  227 bits (578), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 120/274 (43%), Positives = 171/274 (62%), Gaps = 3/274 (1%)

Query: 37  KLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFS-- 94
           +L  +EE+P WQ+DN+ I TGYVRET SV  C+ SL Y +NE+VN+YSHL+PA+ + +  
Sbjct: 46  RLCRYEELPAWQQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGA 105

Query: 95  TIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYL 154
           T+  +++ VP               F +GA +CL+ SS FHCLK HS R     +++DY+
Sbjct: 106 TLALSQWGVPRFPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYM 165

Query: 155 GIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACA-VVSLKDTFRSREWRPYRAA 213
           GI+ LI  S + ++Y+G+        +F+ +T+  G AC+ VV     F S  ++  RAA
Sbjct: 166 GIILLIACSTIPMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAA 225

Query: 214 LFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGS 273
            F+ F  + ++P+  G  K+G      RI LK+V  E VFYI GA LYG R PE   PG 
Sbjct: 226 FFIAFAFNGLIPMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGK 285

Query: 274 FDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
            DLWG+SHQ+FH++VV  +LCHLKA+L SYSL+H
Sbjct: 286 VDLWGNSHQMFHVMVVFGSLCHLKAVLESYSLMH 319

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  154 bits (390), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 146/284 (51%), Gaps = 28/284 (9%)

Query: 37  KLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTI 96
           +L  + ++P+WQKDN  I   YVRET+S+ + + S+F  H+E++NI++HLIPA+  ++  
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPAL-LYAKF 65

Query: 97  FFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGI 156
            +N                    + +    C +LSS FH  K  S++   F  KLDY+GI
Sbjct: 66  TYNA------ITTLEQVSYPIVFYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 157 VFLIVASMVSILYYGFHGNPWFFGIFSLITMT--FGAACAVVSLKDTFRSRE-------- 206
             LI A++VS+   GF+ + +     + +T T    A   ++++K   +  E        
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGT 179

Query: 207 -----------WRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYI 255
                       +  RA LF   GLS ++P++ GL+ YGP   + +I +  VI   + YI
Sbjct: 180 LSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYI 239

Query: 256 FGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKAL 299
            G  +Y  + PEK  PG FDL G SHQ+FHI +V   +CH  A+
Sbjct: 240 VGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  144 bits (362), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 147/271 (54%), Gaps = 7/271 (2%)

Query: 42  EEIPEWQKD--NEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFF- 98
           +E+P+WQK   N  I  GYVRET+S+++C+ ++ Y +N+TVNI  + + +  +F+ + F 
Sbjct: 45  KELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFF 104

Query: 99  -NKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIV 157
            + Y++P               +  GAF    L+S F+ L+SHSL       KL +L  +
Sbjct: 105 TDLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFI 164

Query: 158 FLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVI 217
             I  S+++ LYY F  N ++F   ++ T+   +  A+ +L + F  R+ R  R  + + 
Sbjct: 165 NYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFL-RKNRSQRNMVSIT 223

Query: 218 FGLS-AVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDL 276
           F +S  +LP  + +FK+       R++ K ++LE   Y+F   L  ++ PE+ S   FD 
Sbjct: 224 FIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-FDF 282

Query: 277 WGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
            G+S  I+HI +++ +L H K LL SY  +H
Sbjct: 283 IGNSENIYHICIILGSLLHFKMLLNSYFFMH 313

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  130 bits (328), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 151/296 (51%), Gaps = 14/296 (4%)

Query: 23  TDGQIKLRKKTVVRKL-----YTWEEIPEWQK--DNEHIHTGYVRETSSVMECIRSLFYL 75
            D     ++ TV+ KL     Y  +E+PEWQ+  ++  + TG+++ET+S  +C+ S  Y 
Sbjct: 13  NDNYPTSKRYTVISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYW 72

Query: 76  HNETVNIYSHLIPAIAFFSTIFF--NKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSST 133
           HN ++NI  + I A  +F  +FF  + Y++P               + L A    ++ + 
Sbjct: 73  HNSSINISLNGIAATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTI 132

Query: 134 FHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGA-- 191
           F+ +KSHS + A    KL+ +G++  I +S+V++LYY +    ++F  F+++T+      
Sbjct: 133 FYIMKSHSKQQAFLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLF 192

Query: 192 ACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEG 251
            C+++S  D+F           L     L  ++P L  + ++G  +   RI L  +ILE 
Sbjct: 193 TCSIIS--DSFNKMTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEI 250

Query: 252 VFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVH 307
             Y FG  +   + PE+    SFD  G+S  ++ + ++V +  H K L+ SY L+H
Sbjct: 251 FIYAFGLTIRTSQLPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMH 305

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 95.9 bits (237), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 138/293 (47%), Gaps = 18/293 (6%)

Query: 29  LRKKTVVRKLYTWEEIPEWQKD--NEHIHTGYVRETSSV-MECIRSLFYLHNETVNIYSH 85
           + KKTV  K+ T E++P W +   N  I TGY   T++  + C++ L   +N++++IY +
Sbjct: 1   MEKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMN 60

Query: 86  LIPAIAFFSTIFF--NKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSLR 143
           L+  +     + F  +  ++P               F +   +     +    LK HS  
Sbjct: 61  LVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEY 120

Query: 144 VAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFR 203
                N+   L +V L+  S+V++LYY F  + + F +F + T    +  ++V + D ++
Sbjct: 121 QGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK 180

Query: 204 SREWRPYRAALFVIFG-LSAVLPILAGLFKYGPTETWTRIQLKWVIL--EGVFYIFGAFL 260
               R  + +  VIFG LS  LPI   + K+G  +++ + ++ + +L  E V Y   A L
Sbjct: 181 ----RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAML 236

Query: 261 YGIRFPE-KMSPGSFDLW-----GHSHQIFHILVVVAALCHLKALLGSYSLVH 307
              R PE  +S      W     G+S Q+  ++ + A + H   ++ +Y +VH
Sbjct: 237 QLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 79.7 bits (195), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 139/311 (44%), Gaps = 33/311 (10%)

Query: 6   QRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSV 65
           + K AT   ++    + ++  ++ ++    +K + + ++ +WQK          +  SS 
Sbjct: 13  EPKTATEKYSDATGAVTSNADVETKE---TKKGFPFHDLAKWQKQ--------YKNKSSR 61

Query: 66  MECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNK-YVVPXXXXXXXXXXXXXXXFFL-G 123
            E + +L YL          L    +F   IFF   Y++P               F+L  
Sbjct: 62  SESLVALIYL----------LGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLN 111

Query: 124 AFSCLILSSTFHCLKSHSLRVAV-FGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIF 182
            F   ++   +H +K+ SL+  +    K  YL  + L+++S ++ILYY F+   +FF IF
Sbjct: 112 VFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIF 171

Query: 183 SLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAV---LPILAGLFKYGPTETW 239
           +L+    G A   V L D   S  ++ +   +F I  +S V   LP+L  +  +   E  
Sbjct: 172 TLLMTFIGLAAYFVILTDKLNS--YKRFNKTVFFI-SVSVVCCSLPLLTAIITFDGLENL 228

Query: 240 -TRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGS--FDLWGHSHQIFHILVVVAALCHL 296
             RI+L  +  E V  +  + +Y  RFPE +   +   + W HS   FH+L+   A  H 
Sbjct: 229 KDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHF 288

Query: 297 KALLGSYSLVH 307
             L+ SY L+H
Sbjct: 289 FILIQSYILMH 299

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 76.6 bits (187), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 136/316 (43%), Gaps = 29/316 (9%)

Query: 1   MGDVHQRKVATMVTTEEQPLIG--TDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGY 58
           +  V Q       TTE+    G  T+  +    K + +K + + ++ +WQ+         
Sbjct: 4   LTTVEQSPAKCKTTTEKGNGTGETTNSNVDAETKEI-KKGFPFHDLAKWQQQ-------- 54

Query: 59  VRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNK-YVVPXXXXXXXXXXXXX 117
            R  SS  E + +L YL          L    +F   IFF   Y++P             
Sbjct: 55  YRNKSSRNESLVALIYL----------LGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIV 104

Query: 118 XXFFL-GAFSCLILSSTFHCLKSHSLRVAVFG-NKLDYLGIVFLIVASMVSILYYGFHGN 175
             F+L   F   ++   +H +K+ SL+  +    K  YL  + L+++S ++ILYY F+  
Sbjct: 105 FNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDY 164

Query: 176 PWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFV-IFGLSAVLPILAGLFKYG 234
            +FF IF+L+    G       L D   S + R  +   F+ +  +   LP+L  +  + 
Sbjct: 165 VFFFKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFD 223

Query: 235 PTETWT-RIQLKWVILEGVFYIFGAFLYGIRFPEKM--SPGSFDLWGHSHQIFHILVVVA 291
             E    RI++K +  E V  +  + +Y  RFPE +       + W HS  +FH+++   
Sbjct: 224 GLENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGT 283

Query: 292 ALCHLKALLGSYSLVH 307
           A  H   L+ SY L+H
Sbjct: 284 AFYHFFILIQSYILMH 299

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 135/316 (42%), Gaps = 29/316 (9%)

Query: 1   MGDVHQRKVATMVTTEEQ--PLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGY 58
           +  + Q  V    TTE++     GTD       K   +K + + ++ + QK         
Sbjct: 4   LTTIEQSPVKCETTTEKESNDTRGTDSNENAETKET-KKGFPFHDLAKLQKQ-------- 54

Query: 59  VRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNK-YVVPXXXXXXXXXXXXX 117
            +  SS  E + +L YL          L   ++F   IFF   Y++P             
Sbjct: 55  YKNKSSRNESLVALIYL----------LGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIV 104

Query: 118 XXFFL-GAFSCLILSSTFHCLKSHSLRVAVFG-NKLDYLGIVFLIVASMVSILYYGFHGN 175
             F+L   F   ++   +H +K+ SL+  +    K  YL  + L+++S ++ILYY F+  
Sbjct: 105 FNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDY 164

Query: 176 PWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFV-IFGLSAVLPILAGLFKYG 234
            +FF IF+L+    G       L D   S + R  +   F+ +  +   LP+L  +  + 
Sbjct: 165 VFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFD 223

Query: 235 PTETWT-RIQLKWVILEGVFYIFGAFLYGIRFPEKM--SPGSFDLWGHSHQIFHILVVVA 291
             E    RI++  +  E V  +  + +Y  RFPE +       + W HS  +FH+L+   
Sbjct: 224 GLENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGT 283

Query: 292 ALCHLKALLGSYSLVH 307
           A  H   L+ SY L+H
Sbjct: 284 AFYHFFILIQSYILMH 299

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 70.9 bits (172), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 134/318 (42%), Gaps = 38/318 (11%)

Query: 9   VATMVTTEEQPLIGTDGQIKLRKKTV------------VRKLYTWEEIPEWQKDNEHIHT 56
           +A++ T E+ P        K    T              +K + + ++ +WQ+       
Sbjct: 1   MASLTTVEQSPAKCNTTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQEQ------ 54

Query: 57  GYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNK-YVVPXXXXXXXXXXX 115
              +  SS  E + +L YL          L   ++F   IFF   Y++P           
Sbjct: 55  --YKNKSSRNESVVALIYL----------LGSMLSFCLLIFFTDFYLIPLFPTTTTMTDY 102

Query: 116 XXXXFFL-GAFSCLILSSTFHCLKSHSLRVAV-FGNKLDYLGIVFLIVASMVSILYYGFH 173
               F+L   F   ++   +H +K+ SL+  +    K  YL  + L+++S ++ILYY F+
Sbjct: 103 IVFNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFY 162

Query: 174 GNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFV-IFGLSAVLPILAGLFK 232
              +FF IF+L+    G       L D   S + R  +   F+ +  +   LP+L  +  
Sbjct: 163 DYVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIIT 221

Query: 233 YGPTETWT-RIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSF--DLWGHSHQIFHILVV 289
           +   E    RI++  +  E V  +  + +Y  RFPE    G    + W HS  +FH+++ 
Sbjct: 222 FDGLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIIS 281

Query: 290 VAALCHLKALLGSYSLVH 307
            AA  H   L+ SY L+H
Sbjct: 282 GAAFYHFFILIQSYILMH 299

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 94/229 (41%), Gaps = 4/229 (1%)

Query: 43  EIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFN--K 100
           ++P   ++N +I   Y R   S  + + S+F LHNE  NI+SHL+ AI F   +F +   
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 101 YVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHS-LRVAVFGNKLDYLGIVFL 159
            ++                F   +  C++ S+ +H     S L++      +DY GI  L
Sbjct: 256 SIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISIL 315

Query: 160 IVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFG 219
           I +S++SI +   +  P     +   +   G     ++    F S E RP R   F++  
Sbjct: 316 ITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILLS 375

Query: 220 LSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEK 268
                 +L  +F          + L       V+Y+ G   YG   PE+
Sbjct: 376 SCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 107/240 (44%), Gaps = 23/240 (9%)

Query: 43  EIPEWQKDNEHIHTGYVRETSSVMECIRSLFY---LHNETVNIYSHLIPA--IAFFSTIF 97
           E+P   ++N++I  GY R      + I S+F    +HNET NI++H++ A  + +  T+ 
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 98  FNKYVVPXXXXXXXXXXXXXXXFFLGA-FSCLILSSTFHCLK-SHSLRVAVFGNKLDYLG 155
           F K  +                 FLGA   C+  S  +H    + S+R+      +DY G
Sbjct: 307 FQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDYTG 366

Query: 156 IVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALF 215
           I  LI AS++S  Y   +  P     + +++  F      ++    F S E RP R   F
Sbjct: 367 ITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARPLRIKFF 426

Query: 216 VIF----GLSAV-LPILAGLFKYGPTETW--TRIQLKWVILEGVFYIFGAFLYGIRFPEK 268
           V+     GLS V L  L GL +      W  + +  K VI    +YI G F YG   PE+
Sbjct: 427 VLLAAVGGLSFVNLVCLEGLSR----AIWLFSPVTNKSVI----YYIIGVFFYGSFIPER 478

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 120/285 (42%), Gaps = 36/285 (12%)

Query: 2   GDVHQRKVA-TMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHI---HTG 57
           G  H+   A T    EEQPL   +     R + + R L+ WE +P   ++N +I   H  
Sbjct: 72  GSAHKWAGAVTCSGAEEQPLHWAES----RARGLARHLHYWE-LPYAWRENRYIIYGHRF 126

Query: 58  YVRETSSVMECIRSLFYLHNETVNIYSHLIPA--IAFFSTIFFNKYVVPXXXXXXXXXXX 115
           Y     S++  + + +  HNET+NI+SHL+ A  +A+     + +  V            
Sbjct: 127 YHSHRKSLLSVLNA-YGWHNETINIWSHLVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKW 185

Query: 116 XXXXFFLGAFSCLILSSTFHCLKSHS-LRVAVFGNKLDYLGIVFLIVASMVSILYYGFHG 174
               F      C+  S  +H       L++      +DY GI  L+ AS+V+ +    +G
Sbjct: 186 AIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRFVCVDYTGITLLVTASVVTTVAVTLYG 245

Query: 175 --NPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFK 232
              P  +  + + ++  G A  V++    F   E RP R A++V  GL+A+     GL  
Sbjct: 246 LSRPLMYA-YMVASIGLGTAAGVMNWSPHFDRPEARPLRIAVYV--GLAAL-----GLVS 297

Query: 233 YGPTETWTRIQLKW---------VILEGVFYIFGAFLYGIRFPEK 268
           +     W  +Q++W         V    V+Y  G   Y    PE+
Sbjct: 298 F--VHVW--MQVRWASAHLMAPLVYKSLVWYGIGVVFYATLVPER 338

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 100/242 (41%), Gaps = 28/242 (11%)

Query: 43  EIPEWQKDNEHIHTGYVRETSSVMECIRSL---FYLHNETVNIYSHLIPAIAFFSTIFFN 99
           ++P   ++N +I  GY R   S ++C+ S+   +  HNET+NI+SHL     F + ++  
Sbjct: 118 QLPFPWRENRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSHL---GGFLTLLYIA 173

Query: 100 KYVVPXXXXXXXXXXXXXXX-----FFLGAFSCLILS---STFHCLKSHSLRVAVFGNKL 151
            +V P                    F +    C++ S    TF    S++LR       +
Sbjct: 174 VFVYPNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC--V 231

Query: 152 DYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYR 211
           DY GI  LI AS+++  Y      P +  I+  +++  G     ++    F   E RP R
Sbjct: 232 DYTGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLR 291

Query: 212 AALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVIL-----EGVFYIFGAFLYGIRFP 266
              FV       L  +  +F      T +     W++        ++Y+ G F YG   P
Sbjct: 292 IKFFVTLSAMGCLSFVHLIF------TTSLRHACWLLAPIISKSTIWYVIGVFFYGSFIP 345

Query: 267 EK 268
           EK
Sbjct: 346 EK 347

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 101/244 (41%), Gaps = 18/244 (7%)

Query: 36  RKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYL--HNETVNIYSHLIPAIAFF 93
            KL  + E+P   ++N +I   Y    S+V   + ++ +   HNET NI+SH +    FF
Sbjct: 214 EKLLHYYELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWHNETSNIWSHFL---GFF 270

Query: 94  STIFFNKYVVPXXXXXXXXXXXXXXXF-----FLGAFSCLILSSTFHCLKSHS-LRVAVF 147
             ++   Y  P               F        A  CLI S+ +H     + L++   
Sbjct: 271 YVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRR 330

Query: 148 GNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREW 207
              +DY GI  LI AS+++  +   + +     ++  I++T G     ++    F + E 
Sbjct: 331 FACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPEA 390

Query: 208 RPYRAALFVIFGLSAVLPILAGLFKYGPTETWT-RIQLKWVILEG--VFYIFGAFLYGIR 264
           RP R   F++     VL  +   +     E+W   + L   I     V+Y+ G   YG  
Sbjct: 391 RPLRIRFFMLLAAMGVLSFINASY----LESWAYAVDLLSPITNKSIVWYLVGVVFYGSF 446

Query: 265 FPEK 268
            PE+
Sbjct: 447 IPER 450

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 103/240 (42%), Gaps = 24/240 (10%)

Query: 43  EIPEWQKDNEHIHTGY--VRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFN- 99
           ++P   ++N +I  GY    + S ++  + + +  HNET NI+SHL+ AI F   + F  
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 100 -KYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLK-SHSLRVAVFGNKLDYLGIV 157
            K  +                F L    C++ S  +H    + S+++      +DY GI 
Sbjct: 315 PKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGIT 374

Query: 158 FLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVI 217
            LI AS+++  +   + +     ++  +++ FG     ++    F S E RP R   F++
Sbjct: 375 ILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFIL 434

Query: 218 F----GLS----AVLPILA-GLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEK 268
                GL+    A L  +A   + Y P    T   + W       Y+ G F YG   PE+
Sbjct: 435 LAALGGLAFFHVAYLEGMAYAAWLYSPV---TSKSIVW-------YLIGVFFYGSFIPER 484

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 96/234 (41%), Gaps = 12/234 (5%)

Query: 43  EIPEWQKDNEHIHTGY--VRETSSVMECIRSLFYLHNETVNIYSHLIPA--IAFFSTIFF 98
           ++P   ++N +I  GY      S  +  I + +  HNET NI+SHL+ A  I + +   F
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYDF 278

Query: 99  NKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHS-LRVAVFGNKLDYLGIV 157
            +  V                F   A  C++ S  +H     S LR+      +DY GI 
Sbjct: 279 PQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGIT 338

Query: 158 FLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVI 217
            LI AS+++  +   +   W    +  I++  G     ++    F   E RP R   F++
Sbjct: 339 ILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFIL 398

Query: 218 FGLSAVLPILAGLFK---YGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEK 268
                VL  L  +F    Y  +  +  +  K V    V+Y+ G   YG   PE+
Sbjct: 399 LATMGVLSFLHLIFLTDIYYASRLFGPVTYKSV----VWYLVGVVFYGSFIPER 448

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 81/205 (39%), Gaps = 22/205 (10%)

Query: 76  HNETVNIYSHLIPA--IAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSST 133
           HNET NI++HL  A  + + +   F +  V                F   A  C++ S  
Sbjct: 171 HNETANIWTHLGGALYVLWLAVYDFPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVF 230

Query: 134 FH------CLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITM 187
            H      CL   S    V     DY GI  LI AS+++  +   +  PW    +  ++ 
Sbjct: 231 GHTFNGTCCLALRSKFACV-----DYSGITMLITASILTTEFVTMYNYPWSLRFYLAVST 285

Query: 188 TFGAACAVVSLKDTFRSREWRPYRAALFVIF----GLSAVLPILAGLFKYGPTETWTRIQ 243
             G    +++    F   E RP R   F++     GLS +   L G +KY    +W    
Sbjct: 286 VLGIFGVIMNWSPKFDRPEARPLRIKFFILLAAMGGLSFMQLGLLGGWKYA---SWLMAP 342

Query: 244 LKWVILEGVFYIFGAFLYGIRFPEK 268
           +    L  V+Y+ G   YG   PE+
Sbjct: 343 VTHKSL--VWYLLGVAFYGSFVPER 365

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 99/244 (40%), Gaps = 27/244 (11%)

Query: 43  EIPEWQKDNEHIHTGYVRETSSVMECIRSLFYL---HNETVNIYSHLIPAIAFFSTIF-- 97
           E+P   ++N  I  GY R  +S  + + S+F     HNETVNI++HL  A+ F   IF  
Sbjct: 219 ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKG 277

Query: 98  FNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHC------LKSHSLRVAVFGNKL 151
           F++  V                F      C + S  +H       LK  S    V     
Sbjct: 278 FSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACV----- 332

Query: 152 DYLGIVFLIVASMVSILYYGFHGNP-----WFFGIFSLITMTFGAACAVVSLKDTFRSRE 206
           DY GI  L+ AS+++  +    G+      W    F+  +   GA    ++    F   E
Sbjct: 333 DYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPE 392

Query: 207 WRPYRAALFVIFGLSAVLPIL-AGLFKYGPTETWTRIQLKWVILEGV-FYIFGAFLYGIR 264
            RP R A +++         L + LF    T   +   +K V ++ + +YI G   YG  
Sbjct: 393 SRPLRIAFYLLLASFGFFSYLHSRLFN---TAVDSSDLIKPVFMKSLAWYIIGVVFYGTF 449

Query: 265 FPEK 268
            PE+
Sbjct: 450 IPER 453

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 109/277 (39%), Gaps = 19/277 (6%)

Query: 43  EIPEWQKDNEHIHTGYVRETSSVMECIR--SLFYLHNETVNIYSHLIPAI--AFFSTIFF 98
           E+P   ++N +I  GY    S V   +   + +  HNET+NI+SHL  A+  A+   I  
Sbjct: 303 ELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYGWHNETLNIWSHLFGAVYLAYLLFIQL 362

Query: 99  NKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLK-SHSLRVAVFGNKLDYLGIV 157
               V                F +    CL+ SS +H L  +  L +      +DY GI 
Sbjct: 363 PTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDYTGIT 422

Query: 158 FLIVASM-----VSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRA 212
            LI AS+     VS+             ++  +++  G   + ++    F   E RP+R 
Sbjct: 423 VLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRFDRPESRPFRI 482

Query: 213 ALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPG 272
           A +V+     ++  L      G   +    +  W     ++Y+ G   YG   PE+    
Sbjct: 483 AFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWN-RSLIWYLIGVVFYGSFIPER---- 537

Query: 273 SFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309
               W    ++ + +   A LC    +L  +  VH+R
Sbjct: 538 ----WRTDVELDYTIPTDAELCSNLDILTKHKHVHFR 570

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 98/242 (40%), Gaps = 28/242 (11%)

Query: 43  EIPEWQKDNEHIHTGY--VRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFF------- 93
           ++P   ++N +I  GY      S  +  I + +  HNET NI+SHL+ AI          
Sbjct: 220 QLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDF 279

Query: 94  --STIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHS-LRVAVFGNK 150
             S ++ N  V P               F   A  C++ S  +H     S L++      
Sbjct: 280 PQSEVWRNSQVPPQARWIVFM-------FLAAALKCMLSSVFWHTFNGTSFLKLRSKFAC 332

Query: 151 LDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPY 210
           +DY GI  LI AS+++  +   +   W    +  I++  G     ++    F   E RP 
Sbjct: 333 VDYSGITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPL 392

Query: 211 RAALFVIFGLSAVLPILAGLF----KYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFP 266
           R   F++     VL  L  +F     Y  T  ++ +  K V    V+Y+ G   YG   P
Sbjct: 393 RIRFFILLATMGVLSFLHLIFLTDLHYAAT-LFSPVTYKSV----VWYLVGVVFYGSFIP 447

Query: 267 EK 268
           E+
Sbjct: 448 ER 449

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 98/242 (40%), Gaps = 28/242 (11%)

Query: 43  EIPEWQKDNEHIHTGY--VRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFF------- 93
           ++P   ++N +I  GY      S  +  I + +  HNET NI+SHL+ A+          
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYDF 278

Query: 94  --STIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHS-LRVAVFGNK 150
             S ++ N  V P               F   A  C++ S  +H     S L++      
Sbjct: 279 PQSEVWKNPKVPPQARWIVFM-------FLAAALKCMLSSVFWHTFNGTSFLKLRSKFAC 331

Query: 151 LDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPY 210
           +DY GI  LI AS+++  +   +   W    +  I++  G     ++    F   E RP 
Sbjct: 332 VDYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPL 391

Query: 211 RAALFVIFGLSAVLPILAGLF----KYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFP 266
           R   F++     VL  L  +F    +Y     ++ +  K V    V+Y+ G   YG   P
Sbjct: 392 RIRFFILLATMGVLSFLHLIFLTDLRYA-ARLFSPVTYKSV----VWYLVGVAFYGSFIP 446

Query: 267 EK 268
           E+
Sbjct: 447 ER 448

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 107/283 (37%), Gaps = 21/283 (7%)

Query: 35  VRKLYTWEEIPEWQKDNEHIHTGY--VRETSSVMECIRSLFYLHNETVNIYSHLIPAIAF 92
           VR L+ +E    W ++N  I  GY         +  I + +  HNET NI++HL+  +  
Sbjct: 211 VRHLHYYELPFPW-RENRCIINGYRFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYI 269

Query: 93  FSTIF--FNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHSL-RVAVFGN 149
              +F  F    V                F + A  CL  S  +H     SL R+     
Sbjct: 270 LYLMFYQFPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFA 329

Query: 150 KLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRP 209
            +DY GI  LI AS+++  +   +  PW    +  ++   G     ++    F   E RP
Sbjct: 330 CVDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARP 389

Query: 210 YRAALFVIFGLSAVLPILAGLFKYGPT-ETW--TRIQLKWVILEGVFYIFGAFLYGIRFP 266
            R   F++     +L  L   F    +  TW  + I  K V    V+Y+ G   YG   P
Sbjct: 390 LRIKFFILLASMGILSFLHLTFITSLSHSTWLLSPITKKSV----VWYLVGVVFYGSFIP 445

Query: 267 EKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309
           E+        W    Q  H +     L     ++     +H+R
Sbjct: 446 ER--------WRTDIQYDHTIPTSHELSTNVDIINKEKHIHFR 480

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 84/202 (41%), Gaps = 16/202 (7%)

Query: 76  HNETVNIYSHLIPAI--AFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSST 133
           HNE+ NI++HL+ AI   + S   F    +                F   A  CL+ S  
Sbjct: 289 HNESSNIWTHLLGAIYLIYLSIYDFPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVF 348

Query: 134 FHCLKSHS-LRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAA 192
           +H     S L++      +DY GI  LI AS+++  +   + + +   I+  I+++ G  
Sbjct: 349 WHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMF 408

Query: 193 CAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLF----KYGPTETW--TRIQLKW 246
              ++    F   E RP R   F++     VL  L   +    +Y    TW  T +  K 
Sbjct: 409 GVFMNWSPKFDRPEARPLRIKFFILLASMGVLSFLHLTYLTNLQYA---TWLLTPVTNKS 465

Query: 247 VILEGVFYIFGAFLYGIRFPEK 268
           +    V+Y+ G   YG   PE+
Sbjct: 466 I----VWYLVGVVFYGSFIPER 483

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 78/198 (39%), Gaps = 8/198 (4%)

Query: 76  HNETVNIYSHLIPA--IAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSST 133
           HNET NI++HL+ A  I + +   F    V                F   A  C++ S  
Sbjct: 254 HNETSNIWTHLLGAMYIVYLAVYDFPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVF 313

Query: 134 FHCLKSHS-LRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAA 192
           +H     S L +      +DY GI  LI AS+++  +   +   W    +  I++  G  
Sbjct: 314 WHTFNGTSFLGLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVF 373

Query: 193 CAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEG- 251
              ++    F   E RP R   F++     VL  L  +F    T+    I L   +    
Sbjct: 374 GVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFL---TDLHYAIWLFSPVTNKS 430

Query: 252 -VFYIFGAFLYGIRFPEK 268
            V+Y+ G   YG   PE+
Sbjct: 431 VVWYLVGVVFYGSFIPER 448

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 100/240 (41%), Gaps = 23/240 (9%)

Query: 43  EIPEWQKDNEHI---HTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAI--------A 91
           E+P+  ++N +I   H  Y     S++  I +++  HNET+NI+SH+  AI         
Sbjct: 244 ELPQPWRENPYIIYGHRFYHSHKKSLLS-ILNVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 92  FFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKSHS-LRVAVFGNK 150
           F ++  FN   VP               F L    C++ S  +H       L +    + 
Sbjct: 303 FPNSDVFNSTQVP------KVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSC 356

Query: 151 LDYLGIVFLIVAS-MVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRP 209
           +DY GI  LI AS M +  +  +   P    ++  I++  G   A  +    F   + R 
Sbjct: 357 VDYTGITILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRI 416

Query: 210 YRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEG-VFYIFGAFLYGIRFPEK 268
           +R A +VI     ++  +          + +R+ +  +I +  V+Y+ G   Y    PE+
Sbjct: 417 FRVAFYVILAGLGLISFVH--LTVHSDWSSSRLMITPLINKSIVWYLIGVVFYATLVPER 474

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 109/275 (39%), Gaps = 25/275 (9%)

Query: 13  VTTEEQPLIGTDGQIK----LRKKTVVRKLYTWEEIPEWQ-----KDNEHIHTGYVRETS 63
           V TE QPL     ++K         V  ++   E +  +Q     ++N +I   Y R   
Sbjct: 181 VVTEYQPLTKPSEEVKNLICSYNHEVAYEIGKTEHLNYYQLPFPWRENRYIIYNY-RFYD 239

Query: 64  SVMECIRSLFYL---HNETVNIYSHLIPAI--AFFSTIFFNKYVVPXXXXXXXXXXXXXX 118
           S  + + S+F     HNET NI++HLI  +   + +   F +  +               
Sbjct: 240 SHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYDFPRSEIFLSDKIPTTAKLIVY 299

Query: 119 XFFLGAFSCLILSSTFHCLK-SHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPW 177
            F   A  CL  S  +H    + +L++      +DY GI  LI AS+++  +   + +  
Sbjct: 300 LFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGISILITASILTTEFVTLYSSYR 359

Query: 178 FFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLF----KY 233
              ++  I+++ G     ++    F   E RP R   FV+     VL  L   F    KY
Sbjct: 360 AMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFVLLASMGVLSFLHLTFLTDWKY 419

Query: 234 GPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEK 268
               TW    +    +  V+Y  G   YG   PE+
Sbjct: 420 A---TWLLAPVTNKSI--VWYCIGVVFYGSFIPER 449

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 105/253 (41%), Gaps = 20/253 (7%)

Query: 32  KTVVRKLYTWEEIPEWQKDNEHIHTGYV---RETSSVMECIRSLFYLHNETVNIYSHLIP 88
           KT + +   + E+P   ++N  I  GY      T S++  I + +  HNET NI++HL  
Sbjct: 225 KTGLSRHLHYYELPFPWRENRFIIHGYRFYHSHTKSLLS-ILNWYGWHNETTNIWTHLFG 283

Query: 89  A--IAFFSTIFFNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLK-SHSLRVA 145
           +  IA+ +   F +  V                F    F CL+ S T+H    +  L + 
Sbjct: 284 SLYIAYLAFYEFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLR 343

Query: 146 VFGNKLDYLGIVFLIVASMVSILYYGFHGN------PWFFGIFSLITMTFGAAC--AVVS 197
                +DY GI  LI AS+++  +   +GN      P  F +   + ++    C    ++
Sbjct: 344 SKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFMN 403

Query: 198 LKDTFRSREWRPYRAALFVIFGLSAVLPILA-GLFKYGPTETWTRIQLKWVILEGV-FYI 255
               F   E RP R A +++      L  L   L       +W    ++ V+ + V +Y+
Sbjct: 404 WSPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWL---IRPVLDKSVCWYL 460

Query: 256 FGAFLYGIRFPEK 268
            G   YG   PE+
Sbjct: 461 IGVIFYGSFIPER 473

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 75/188 (39%), Gaps = 12/188 (6%)

Query: 43  EIPEWQKDNEHIHTGYVRETSSVMECIRSLFYL---HNETVNIYSHLIPAIAFFSTIF-- 97
           E+P   ++N  I  GY R  +S  + + S+F     HNETVNI++HL  A+     +F  
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 98  FNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSSTFHCLKS-HSLRVAVFGNKLDYLGI 156
           F++  V                F L    C + S  +H       L+       +DY GI
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICHLQQRSNCACVDYTGI 357

Query: 157 VFLIVASMVSILYYGFHGNP-----WFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYR 211
             L+ AS+++  +    G       W    F+  +   G     ++    F   E RP R
Sbjct: 358 TILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESRPLR 417

Query: 212 AALFVIFG 219
            A +++  
Sbjct: 418 IAFYLLLA 425

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 78/200 (39%), Gaps = 12/200 (6%)

Query: 76  HNETVNIYSHLIPAIAFFSTIF--FNKYVVPXXXXXXXXXXXXXXXFFLGAFSCLILSST 133
           HNET NI++HL+  +      F  F    +                F   A  C+  S  
Sbjct: 244 HNETSNIWTHLLGGLYLIYLAFYHFPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVF 303

Query: 134 FHCLK-SHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAA 192
           +H    +H LR+      +DY GI  LI AS++++ +   +        + + ++  G  
Sbjct: 304 WHTFNGTHLLRLRSKFACVDYTGITILITASILTVEFVTMYDYKISLLFYMICSLALGII 363

Query: 193 CAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLF----KYGPTETWTRIQLKWVI 248
              ++    F   E RP R   F++         +  +F    +Y   +  T +  K V 
Sbjct: 364 GVSMNWSPKFDRPEARPLRIKFFILLATVGCSSFIRLVFLTNWRYA-ADLLTPLTNKSV- 421

Query: 249 LEGVFYIFGAFLYGIRFPEK 268
              V+Y+ G F YG   PE+
Sbjct: 422 ---VWYLIGVFFYGSFIPER 438

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 84/185 (45%), Gaps = 5/185 (2%)

Query: 130 LSSTFHCLKSHSLR--VAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITM 187
           L++ F C   H ++      G+ L  + ++     S V++LYY ++ N ++F + +L T 
Sbjct: 137 LATAFQCAACHMVQCFTTTAGSVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTA 196

Query: 188 TFG---AACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQL 244
            +    AA  V S       R+W   R  L V   +   +P++ GL ++G  +   R+  
Sbjct: 197 NWTLVVAAVTVTSTASNSPKRQWWSRRTLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDW 256

Query: 245 KWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYS 304
           + ++ E   Y+     YG    + +    F +  H+  + H+ +++ A   ++A     +
Sbjct: 257 RLLLAELAVYLISGVFYGGTEKDTLPKLPFYVAFHTASLIHLQLLLNAFHLMRAGTNKPT 316

Query: 305 LVHYR 309
           LV ++
Sbjct: 317 LVSFK 321

>KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON}
           Anc_1.459 YJR035W
          Length = 1085

 Score = 37.4 bits (85), Expect = 0.051,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 30/51 (58%)

Query: 29  LRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNET 79
           ++K++V RK   W ++PEW+K +  I T  + +T  V   I SL + + +T
Sbjct: 268 IKKRSVDRKYDKWPDLPEWRKPHPDIPTARLNDTFKVPGEIHSLLFNYQKT 318

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,906,528
Number of extensions: 1224695
Number of successful extensions: 3788
Number of sequences better than 10.0: 74
Number of HSP's gapped: 3777
Number of HSP's successfully gapped: 74
Length of query: 315
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 206
Effective length of database: 40,982,805
Effective search space: 8442457830
Effective search space used: 8442457830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 66 (30.0 bits)