Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02497g6.28ON37637619310.0
Kpol_1037.236.28ON37837911571e-158
TDEL0G044106.28ON38137811521e-157
YOL003C (PFA4)6.28ON37837811431e-156
ZYRO0C07546g6.28ON37737811391e-155
Suva_15.1726.28ON39837811291e-153
Skud_15.1596.28ON37937911201e-152
Smik_15.1676.28ON37837811011e-149
TPHA0J003906.28ON38037910891e-147
Ecym_30326.28ON37737810691e-144
NCAS0D021406.28ON37637810661e-144
NDAI0C026506.28ON38938910541e-142
SAKL0E01518g6.28ON37938110271e-138
KLTH0C10978g6.28ON3773799811e-131
ACL003C6.28ON3753779811e-131
KLLA0C06204g6.28ON3773789711e-129
Kwal_56.224596.28ON3833799581e-127
KNAG0F029306.28ON3863839091e-120
KAFR0A051306.28ON3964009081e-120
TBLA0B004806.28ON3774035362e-64
NCAS0E013003.12ON3271492001e-16
TPHA0P015603.12ON3311431931e-15
CAGL0D02508g3.12ON3321211894e-15
TDEL0A003103.12ON329841884e-15
KAFR0A085903.12ON3311241851e-14
Kwal_55.221263.12ON360971824e-14
KNAG0K025703.12ON3281301805e-14
Kpol_1014.293.12ON3261221797e-14
KLLA0E02069g3.12ON3251071743e-13
NDAI0G013403.12ON3351211753e-13
Suva_14.153.12ON3301211734e-13
Ecym_20143.12ON339601719e-13
SAKL0C13596g3.12ON333861709e-13
ZYRO0C03410g3.12ON3271521701e-12
KLTH0F19580g3.12ON3421291663e-12
YNL326C (PFA3)3.12ON3361211664e-12
TBLA0H001503.12ON3451231655e-12
Skud_14.153.12ON3361211646e-12
NDAI0J010008.286ON3392221567e-11
Smik_14.63.12ON3341251551e-10
Ecym_42828.286ON3401411551e-10
ZYRO0C04092g8.389ON366981541e-10
TDEL0F041308.286ON3281101522e-10
ZYRO0D06600g8.286ON330991513e-10
TPHA0C010708.286ON3331311513e-10
SAKL0H16434g8.286ON5551821524e-10
TBLA0D040408.286ON329411495e-10
KAFR0B053708.286ON329631487e-10
ADL197C3.12ON390551497e-10
Ecym_41788.389ON368711461e-09
NCAS0B035908.286ON329641452e-09
TDEL0F051308.389ON3591321442e-09
Smik_12.3068.389ON3591001442e-09
Skud_4.3878.286ON336481433e-09
KLTH0F08668g8.389ON358581443e-09
Skud_12.3218.389ON3561001433e-09
YLR246W (ERF2)8.389ON359501434e-09
NCAS0C029208.389ON374541434e-09
KLTH0G13112g8.286ON3492241416e-09
CAGL0B01991g8.286ON330401407e-09
SAKL0H13860g8.389ON352641408e-09
Suva_2.2898.286ON335411399e-09
YDR126W (SWF1)8.286ON336401391e-08
KNAG0A027108.389ON3541001391e-08
Suva_10.3428.389ON356591391e-08
TBLA0H009208.389ON360691391e-08
TPHA0C023608.389ON404591391e-08
Smik_4.3728.286ON335401372e-08
KLLA0F19690g8.286ON324941344e-08
Kpol_1033.168.286ON321581344e-08
AGL125C8.389ON367691336e-08
KAFR0H019808.389ON361651336e-08
CAGL0G08217g8.389ON326991319e-08
Kwal_23.33028.389ON353401301e-07
KLLA0D18370g8.389ON355581302e-07
NDAI0G022508.389ON389541283e-07
Kwal_56.236978.286ON338521255e-07
AGR065W8.286ON326471212e-06
KNAG0H031108.286ON331381151e-05
TBLA0E028305.579ON386851141e-05
NCAS0F013905.579ON374661122e-05
NDAI0H018905.579ON406661079e-05
KAFR0I011105.579ON370431042e-04
Kpol_1004.575.579ON3621221033e-04
KNAG0C028305.579ON354671015e-04
Kwal_47.183665.579ON356881015e-04
ZYRO0D13860g5.579ON3651231015e-04
SAKL0G06160g5.579ON36462980.001
KLTH0G04972g5.579ON36755970.002
Smik_4.7375.579ON378246960.002
NDAI0H008505.626ON78651960.003
Kpol_526.325.626ON777182950.004
TPHA0C003705.626ON759131940.005
TDEL0A044405.579ON36553930.006
Ecym_41145.579ON37257920.006
Skud_4.7345.579ON38039920.007
KLLA0D06149g5.579ON34985910.009
ZYRO0C11132g5.626ON759183900.015
YDR459C (PFA5)5.579ON37438880.019
Smik_4.5155.626ON76440880.025
Suva_2.6345.579ON388104870.026
KLTH0E02420g5.626ON73452870.039
KAFR0H005705.626ON75746870.040
CAGL0K06347g5.579ON35259850.046
Skud_4.5275.626ON76440850.058
Ecym_13305.626ON73947850.061
Suva_8.875.626ON730187840.080
CAGL0M08712g5.626ON76350840.088
AER388C5.626ON72439840.090
YDR264C (AKR1)5.626ON76440840.092
NCAS0C052805.626ON75746830.11
Suva_2.4325.626ON76340830.11
TBLA0J008305.626ON73952820.15
KNAG0C062305.626ON75297820.16
SAKL0A08756g2.506ON592138790.28
TDEL0A049205.626ON75046760.76
ABR203W5.579ON35954741.0
Skud_15.1995.626ON741165751.1
SAKL0G07326g5.626ON73754751.1
YOR034C (AKR2)5.626ON74943731.7
YDR205W (MSC2)8.413ON72450731.9
ACL040C7.281ON34230712.5
CAGL0J06094g2.92ON110873704.1
KNAG0B031405.626ON68240694.7
KLTH0E15818g3.131ON43853695.2
Suva_13.2652.473ON56142695.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02497g
         (376 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   748   0.0  
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   450   e-158
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   448   e-157
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   444   e-156
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   443   e-155
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   439   e-153
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   436   e-152
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   428   e-149
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   424   e-147
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   416   e-144
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   415   e-144
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     410   e-142
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   400   e-138
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   382   e-131
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   382   e-131
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   378   e-129
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   373   e-127
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   354   e-120
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   354   e-120
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   211   2e-64
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    82   1e-16
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    79   1e-15
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    77   4e-15
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    77   4e-15
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    76   1e-14
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    75   4e-14
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    74   5e-14
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    74   7e-14
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    72   3e-13
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      72   3e-13
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    71   4e-13
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    70   9e-13
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    70   9e-13
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    70   1e-12
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    69   3e-12
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    69   4e-12
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    68   5e-12
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    68   6e-12
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    65   7e-11
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    64   1e-10
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    64   1e-10
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    64   1e-10
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    63   2e-10
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    63   3e-10
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    63   3e-10
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    63   4e-10
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    62   5e-10
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    62   7e-10
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    62   7e-10
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    61   1e-09
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      60   2e-09
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    60   2e-09
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    60   2e-09
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    60   3e-09
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    60   3e-09
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    60   3e-09
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    60   4e-09
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     60   4e-09
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    59   6e-09
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    59   7e-09
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    59   8e-09
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    58   9e-09
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    58   1e-08
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    58   1e-08
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    58   1e-08
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    58   1e-08
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    58   1e-08
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    57   2e-08
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    56   4e-08
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    56   4e-08
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    56   6e-08
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    56   6e-08
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    55   9e-08
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    55   1e-07
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    55   2e-07
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     54   3e-07
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    53   5e-07
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    51   2e-06
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    49   1e-05
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    49   1e-05
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    48   2e-05
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    46   9e-05
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    45   2e-04
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    44   3e-04
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    44   5e-04
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    44   5e-04
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    44   5e-04
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    42   0.001
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    42   0.002
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    42   0.002
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    42   0.003
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    41   0.004
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    41   0.005
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    40   0.006
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    40   0.006
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    40   0.007
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    40   0.009
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    39   0.015
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    39   0.019
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    39   0.025
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    38   0.026
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    38   0.039
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    38   0.040
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    37   0.046
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    37   0.058
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    37   0.061
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    37   0.080
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    37   0.088
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    37   0.090
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    37   0.092
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    37   0.11 
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    37   0.11 
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    36   0.15 
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    36   0.16 
SAKL0A08756g Chr1 complement(770525..772303) [1779 bp, 592 aa] {...    35   0.28 
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    34   0.76 
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    33   1.0  
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    33   1.1  
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    33   1.1  
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    33   1.7  
YDR205W Chr4 (859346..861520) [2175 bp, 724 aa] {ON}  MSC2Member...    33   1.9  
ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON} S...    32   2.5  
CAGL0J06094g Chr10 (577719..581045) [3327 bp, 1108 aa] {ON} high...    32   4.1  
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    31   4.7  
KLTH0E15818g Chr5 complement(1404334..1405650) [1317 bp, 438 aa]...    31   5.2  
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    31   5.5  

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/376 (97%), Positives = 365/376 (97%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
           PPGKPPTNFKPSKNEW           PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLSRSEWLN 360
           EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLSRSEWLN
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLSRSEWLN 360

Query: 361 DWGESLEDFGVDVDVE 376
           DWGESLEDFGVDVDVE
Sbjct: 361 DWGESLEDFGVDVDVE 376

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  450 bits (1157), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 217/379 (57%), Positives = 278/379 (73%), Gaps = 4/379 (1%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPVKLK+PW+GIAIP FLI+ I Y AHYFILLNFLS+ KQ+W++   TMIW+SYYLAIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PGKP +N+ P  N+W           PER+HHCKTC QCVLMMDHHCPWTMNCVGY NF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFLFWVIV TT L  FL +RI  +W  R+ PSYL+ KSE+IFLTI TP++ F+LLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           IS+L IRC  NQ+ +GR+QIE+WE +RLE+L  + +L P LI N+W   P L+    E++
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           AE +++ KR+  D LV+FPYDLG   N   +LG+P  WL+ +  P  DG+ F+KNE S+ 
Sbjct: 241 AEKIVS-KRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299

Query: 301 EDPNSLNDIILCLPWPPDSTKH-LNSTSEHTSNVQIISEEGEQVIRIRTPEKKL--SRSE 357
           E+ + L D IL LPWPPD  KH  N  +  T++++  +++GE VIR R+P  KL  SR++
Sbjct: 300 EEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 358 WLNDWGESLEDFGVDVDVE 376
           W NDWGE+LEDFGVD+DVE
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  448 bits (1152), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/378 (57%), Positives = 269/378 (71%), Gaps = 2/378 (0%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPVKLKWPWLGIAIP  L++ IGYC H+FIL NFLS  KQLW+Q    +IWLSYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PG+P  NF+  K EW           PER+HHCKTCNQCVLMMDHHCPWTMNCVG+NNF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFL WVIV T  L   L +RI  +W  R+ P Y++++SEL+FLTILTPL+AF+LLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           I+IL+ RCL NQIFNG SQIE+WE++RL+ L    +L+P+LIE  W IFP  R +  ES 
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           A  L   K L L+++VNFPYDL P+ NA QLLG P LWL+PF  P+ DG+ F KNE S  
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKK--LSRSEW 358
               S  D++L LPWPPD  +        +S+++ I+++GEQ+IR R  +    + R +W
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360

Query: 359 LNDWGESLEDFGVDVDVE 376
            NDWGE+LEDFGVDVD E
Sbjct: 361 QNDWGENLEDFGVDVDTE 378

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  444 bits (1143), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/378 (58%), Positives = 268/378 (70%), Gaps = 2/378 (0%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPVKL+WPWLGIAIP+FLI+ IGY AHYFIL NFLS+ KQ+ ++FC +MIWLSYYLAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PG+P  N+KP  + W           PERSHHCKTCNQCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFLFW+IV T+ L      RI+ IW  R  P Y + KSELIFLTI +PLN+F+LLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           I+IL +RCLFNQI NGRSQIESW+MDRLE+L    +L   LI+N W I+P  R+   +  
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           AE  L KKR   DELVNFPYD   + NA+  LG   LWL+P+  P  DG +F KN  S  
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPE--KKLSRSEW 358
           E  +SL D IL LPWPPD  K     +  +S +++ +E GEQ+IR R P+  +  SR +W
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360

Query: 359 LNDWGESLEDFGVDVDVE 376
            NDWGESL+DFGVDVD+E
Sbjct: 361 YNDWGESLDDFGVDVDME 378

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  443 bits (1139), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 219/378 (57%), Positives = 268/378 (70%), Gaps = 3/378 (0%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPV+LKWP+LGIAIP FLI+ IGY AHYFIL NFLS +KQ+W++F  TMIW SYYLAIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PG+P  NF+PSKN W           PER+HHCKTCNQCVL MDHHCPWT NCVGY NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFLFWVI  T  L   L  R + I  + +SP+YL+ KSELIFLTIL P++ FILLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           ISIL IRCL NQIF GR+QIE+WE +RLE L    +LLP L+ N W ++P LR   +E +
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           A  L  ++R+ LD LVNFPYD+ P+ N I+ LG+P  WL+PF  P+ DG+ F KN+ S  
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIR--TPEKKLSRSEW 358
           E+ N L D++L LPWPPD  K    + +  + V+    +GEQVIR R   P    SR++W
Sbjct: 301 EETN-LTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359

Query: 359 LNDWGESLEDFGVDVDVE 376
            N WGE+LEDFGVDVD E
Sbjct: 360 QNTWGENLEDFGVDVDAE 377

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  439 bits (1129), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/378 (56%), Positives = 264/378 (69%), Gaps = 2/378 (0%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           M VKLKWPWLGIAIP+FLI+ IGY AHYFIL NFLS+ KQ+ ++   +MIW+SYYLAIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PGKP   ++P+ N W           PERSHHCK CNQCVLMMDHHCPWTMNCVG+ N+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RF+FWVI  T  L      R+  IW  R  P YL+ KSEL+FLTILTPLN F+LLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           I IL +RCLFNQI NGRSQIESW+MDRLE+L    +L+  LIEN W I+P  R+  +E  
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           AE LL + ++  +E+VNFPY++  F NA   LG   LWL+P   P  DG  FQKN+ S  
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPE--KKLSRSEW 358
           E  +SL DI+L LPWPPD  K   +++     ++  +E GEQV+R R  +  +  +R +W
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380

Query: 359 LNDWGESLEDFGVDVDVE 376
            NDWGESL+DFGVDVD+E
Sbjct: 381 YNDWGESLDDFGVDVDME 398

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  436 bits (1120), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/379 (57%), Positives = 264/379 (69%), Gaps = 3/379 (0%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           M VKLKWPWLGIAIP+FLI+ IGY AHYFIL NFLS+ KQL ++   +MIW+SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
             G+P  N++PS   W           PERSHHCK CNQCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFLFWVIV T+ L      RI  IW  RS P YL+ KSELIFLTIL+PL+ F+LLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           I+IL +RCL NQI NGRSQIESW+MDRLE+L    KL+P LI+N W I+P  R+   E  
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 241 AEALLNKK-RLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESM 299
           A+ LL ++ R   DELV+FPY+  P  NAI  LG   LWL+P+  P  DG  F KN+ S 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 300 IEDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLS--RSE 357
            E  + L DIIL LPWPPD  K    ++ + S ++  +E GEQ++R R  +      R +
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360

Query: 358 WLNDWGESLEDFGVDVDVE 376
           W NDWGESL+DFGVDVD+E
Sbjct: 361 WYNDWGESLDDFGVDVDME 379

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  428 bits (1101), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 210/378 (55%), Positives = 263/378 (69%), Gaps = 2/378 (0%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           M VKL+WPWLGIAIP+ LI+ IGY AHYFIL NFL + KQ+ ++F  +MIW SYYLAIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PG+P  N++P+   W           PERSHHCKTCNQCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFLFW+I+ T+ L      RI  IW  R+ P YL+ KSEL FLTIL+PLN F+LLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           I++L +RCLFNQI NGRSQIESW+MDRLE+L    +L+  LI N W I+P  +    E  
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           AE LL ++R S + LVNFPY+     NAI  LG   LWL+P+  P  +G +F KN+ S  
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPE--KKLSRSEW 358
           E  + L DIIL LPWPPD  +    ++  TS ++  +E GEQV+R R  +  +  SR +W
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360

Query: 359 LNDWGESLEDFGVDVDVE 376
            NDWGESL+DFGVDVD+E
Sbjct: 361 FNDWGESLDDFGVDVDME 378

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  424 bits (1089), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 212/379 (55%), Positives = 272/379 (71%), Gaps = 3/379 (0%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPVK KWPW+GIAIP  LI+ IGY +HY+IL   LSL KQ +++F  TMIW+SYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PGKP  NFKP  +EW           PERSHHCKTCNQCVLMMDHHCPWTMNC+G+NNF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFL W++  T  L  +   RI  +W +R+ PSYL+ +SE+I L + TPLN FILLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           I++L  RCLFNQI NG++QIE WEMDRLE    + KLLP LI N+W ++P L++   + +
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           AE L+ KK +  D +VNFPYDLG F+N   L+G P  WL+PF GP  +G++F+KNE ++ 
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHT-SNVQIISEEGEQVIRIRTPEKK--LSRSE 357
           +  +SL    L LPWPPD  +H NS + +T SNV+ I+ +GEQV+R RT  K   LSR E
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 358 WLNDWGESLEDFGVDVDVE 376
           W N+WGE+LEDFGVDV++E
Sbjct: 361 WFNEWGENLEDFGVDVEME 379

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  416 bits (1069), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 204/378 (53%), Positives = 264/378 (69%), Gaps = 4/378 (1%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPVKLKWPWLGIAIP FLIA IGY A  F+L  FLS+++Q+W+QF  TMIWLSYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PG P   F+P K+EW           PER+HHCKTC QCVL+MDHHCP+TMNCVGYNNF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFLFW+I  TT L+I    R   +W  R S + L  K E+IFLTILTP NAF+LLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           ISIL  RC+ NQ+ NG +QIE+WEMDR+E++    +L+P L+ N+  ++PN  + H + +
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGH-KGE 239

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
            + +LN +++S ++LVNFPYD  P+RN I  +G    WL PF  P  +G+ F+KNE S  
Sbjct: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKK--LSRSEW 358
           E  ++L D +L LPWPPD  +  NS++     V+  +  GE +IR R+PE +  LSR+EW
Sbjct: 300 EHGSTLTDKLLSLPWPPDGERAPNSSNSRLK-VESSTRNGEHIIRKRSPEPRLNLSRTEW 358

Query: 359 LNDWGESLEDFGVDVDVE 376
            NDWGE+L  FGVDVD +
Sbjct: 359 YNDWGENLAHFGVDVDAD 376

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  415 bits (1066), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 199/378 (52%), Positives = 262/378 (69%), Gaps = 4/378 (1%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPVKLK+PW+G+ IP  L + IGY AH F+L NF+S + QLW+Q   TM+W+SY LAI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PG+P  +FKP K EW           PER+HHCKTCNQCVLMMDHHCPWTMNCVG+ NF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFLFWV+V T  L   L  R   +W  +  PSYL+ K+E+ FL IL P++ F+L+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           +++L IRCL NQI  G++QIESWE++RLE L    KLLP L+ N+W I+PN +    +  
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 AEALLNKKR-LSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESM 299
           A+ L  + R +  + +V FPYDL  + NA+ +LG+P  WL+ F GP  DG+HF+KNE ++
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 300 IEDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLS-RSEW 358
            E+  ++ D++L LPWPPD  +  N   +  +NV+ I+E GEQVIR R  E   S R  W
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGR--NFIQQKGTNVESITENGEQVIRQRNFENDNSYRKTW 358

Query: 359 LNDWGESLEDFGVDVDVE 376
            NDWGE+LEDFGVDVDVE
Sbjct: 359 NNDWGENLEDFGVDVDVE 376

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  410 bits (1054), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 202/389 (51%), Positives = 271/389 (69%), Gaps = 15/389 (3%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           M +KLK+PWLG+AIPSF+I+ IGY +HYFIL NFLS++KQ+W+QF  +MIW+SY LAI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  PPGKPPTNFKP----SKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVG 116
            PGKPP N KP     + +W           PERSHHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 YNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAF 176
           Y NFPHFIRFL W+I+ T  L + L  R  ++W  R  PSY++ ++E+IFLTIL P++AF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 ILLTISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEH 236
           ILLTIS+L IRC  NQI  G +QIE WE++RLE L    KLLP++I  +W ++PN R + 
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 237 VESQAEALLN-KKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKN 295
            ++ A+ LL+ +K++  + +VNFPYD+  + N   ++G+   W++ F  P  +GL F+KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 296 EESMIEDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIR--------IR 347
           E S+ E  +S+ D++L LPWPPD  K  N  S   ++V+ +  +GEQV+R        I 
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPD--KGRNFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358

Query: 348 TPEKKLSRSEWLNDWGESLEDFGVDVDVE 376
           T  K +SR EW NDWGESL DFGVD++ E
Sbjct: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  400 bits (1027), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 206/381 (54%), Positives = 263/381 (69%), Gaps = 7/381 (1%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           M VKLKWPWLGIAIP FLI+ IGYCAHYFIL NFL  +KQLW++F   MIW+SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PGKP   F+PSK EW           PER+HHCK CNQCVL MDHHCPWTMNCVG+ NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
            HFIRFLFWVI  T+ L  +L  RI  +W  R  P+Y  ++SELIFLTILTP++AF+LLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFP-NLRNEHVES 239
           IS+L++RC  NQI  G +QIESWEMDR+E +    +L+P ++EN+  I P +L N+  + 
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQ--DD 238

Query: 240 QAEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESM 299
               LL++ RLSLDE+VNFPYDL P+ NA+  LG    W+ P+   + +G+ F+KNE S+
Sbjct: 239 DIRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSV 298

Query: 300 IEDPNSLNDIILCLPWPPDSTKHL--NSTSEHTSNVQIISEEGEQVIRIR--TPEKKLSR 355
            E    + D +L LPWPPD  +H      +   + V+  + +GE+V+R R   P   + R
Sbjct: 299 YEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPR 358

Query: 356 SEWLNDWGESLEDFGVDVDVE 376
            +W NDWGE+L DFGVD+D E
Sbjct: 359 KKWYNDWGENLADFGVDLDEE 379

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  382 bits (981), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 187/379 (49%), Positives = 251/379 (66%), Gaps = 6/379 (1%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPV+LKWPWLGIA+PSFLIA IGY +HYFIL NF S  +QLW++F  T+IW+SY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PG+PP NF+P  ++W           PER+HHCKTC QCVL MDHHCPWTMNCVG+NNF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFL WV++ T+ L + LT R    W  R++  ++ + SEL FL +  PLNAFILLT
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           +S+L+ RC+ NQ  NG +QIESWE DR+E L    +L+P LI+N+  +FP   +   E  
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFP--EDTFDEGA 237

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           A+ LL+ K+L L++++NFPYD+    N    +G    W  P   P+D+G  F  N+ S  
Sbjct: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEH-TSNVQIISEEGEQVIRIRTPEKKLS--RSE 357
           +   S+ D +L LPWPPD  +  +  S    S ++  S  GE  +R R+ + ++S  R+E
Sbjct: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 358 WLNDWGESLEDFGVDVDVE 376
           W NDWGE+L DFGVDVD E
Sbjct: 358 WHNDWGENLSDFGVDVDAE 376

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  382 bits (981), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 191/377 (50%), Positives = 247/377 (65%), Gaps = 3/377 (0%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           M V +KWPWLG+AIP FLI+  GY AH+F+L NFLS ++ LW+Q   +MIW+SY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PG+P   F+P + EW           PER+HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
                   W+I  T  L  +   RI   WV+R + + L  K ELIFLTILTPL+AFILLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           IS+L +RC+ NQI NGR+QIE+WEMDR+E L    +LLP L+ N+  I+P    E  E +
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPG-SLEGQEKE 239

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
            E  L+    S DE++NFPYD+ P+ N +  +G+P  WL PF GP+ DG+ FQKNE S  
Sbjct: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIR-TPEKKLSRSEWL 359
           ++  S+ D +L LPWPPD T+H        S+V+  ++ GEQV+R R  P     R+EW 
Sbjct: 300 DEATSIQDKLLALPWPPDDTRH-GIAFPSVSHVEKDTQGGEQVVRRRHVPIAVPPRNEWY 358

Query: 360 NDWGESLEDFGVDVDVE 376
           NDWGESLE FGVDV+VE
Sbjct: 359 NDWGESLEHFGVDVEVE 375

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  378 bits (971), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 184/378 (48%), Positives = 254/378 (67%), Gaps = 3/378 (0%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           M +KLK  WLG+AIP+FL+A IGY +HYFIL NFLS  +Q++YQ CQTMIW+SYYLAIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PG PP +FKPS  EW           PER+HHCKTCNQCVL MDHHCPWT+NCVG++NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFLFWVI  T  L   L  RI+ +W  R +  +    SE+IF+ I+TP++AF+LLT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           +S L+ RC++NQ  +G +QIESWEMDR+++L   ++LL  +I+ +    P +     + +
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAK-QHE 239

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
              LL+K+ ++ ++  NFPYD+ P+ N    +G   LWL+P+S P   G  F KNE    
Sbjct: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299

Query: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPE--KKLSRSEW 358
           +  +S+ D+++ LPWPPD   H +      S+++ I   GEQVIR ++ +   +L R+ W
Sbjct: 300 DPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSW 359

Query: 359 LNDWGESLEDFGVDVDVE 376
            NDWGE L DFGVD ++E
Sbjct: 360 YNDWGEDLSDFGVDTELE 377

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  373 bits (958), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 190/379 (50%), Positives = 252/379 (66%), Gaps = 6/379 (1%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPVKLKWPWLGIAIPS LIA IGY +HYFIL NFLSL +Q+W+Q C +MIW+SY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  PPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120
            PGKPPT F+P  ++W           PER+HHCKTC+QCVL+MDHHCPWTMNCVG+NNF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180
           PHF+RFL WVI+ T+ L   L  RI   W  R +  Y+  K EL+F+ I TPLNAF+ LT
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179

Query: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240
           I +L++RC  NQ   G +QIE WE +R+E      +L+P L+EN+  I+ +  +      
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGD--DILNSPN 237

Query: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300
           A+ L+N + L L+E+VNFPYDL    N    +G     + P+S P  +GL F KN+ S  
Sbjct: 238 AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSY 297

Query: 301 EDPNSLNDIILCLPWPPDSTKHL-NSTSEHTSNVQIISEEGEQVI--RIRTPEKKLSRSE 357
           +  +++ D +L LPWPPD  +      S+ +S +++ S  GE V+  R+R P   + R+E
Sbjct: 298 DTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357

Query: 358 WLNDWGESLEDFGVDVDVE 376
           W NDWGE+L DFGVDV+ E
Sbjct: 358 WYNDWGENLSDFGVDVESE 376

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  354 bits (909), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 187/383 (48%), Positives = 245/383 (63%), Gaps = 12/383 (3%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           MPV+LK PW GIAIP  LI  IGY AH+FIL N LS ++Q+ +QFC TMIW+SYY+AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  PPGKPP--TNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYN 118
            PGKPP  +  + +  +            PERSHHCKTC QCVLMMDHHCPWTMNC+G+ 
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKS----ELIFLTILTPLN 174
           NFP F+RFL WVI+ T+ L  +L  RI +IW  R+ P      S    EL+ L +LTP++
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 AFILLTISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRN 234
            F+L TI+ L +RC+ NQ+  G +QIESWEM+RL+ +    KLLPI+IE VW  FP+ + 
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 235 EHVESQAEALL---NKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLH 291
              E +AE LL    +  L    +VNFPYD+    N  Q LG+P L L+PFS  Q +G+ 
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 292 FQKNEESMIEDPNSLNDIILCLPWPPDSTKHL--NSTSEHTSNVQIISEEGEQVIRIRTP 349
           FQKN+ S  ED  S++D++LCL WPPD  + +      +    +    E+GE +IR R  
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360

Query: 350 EKKLSRSEWLNDWGESLEDFGVD 372
             + SR+ W N WGE+LE FGVD
Sbjct: 361 PIE-SRTTWENQWGETLEGFGVD 382

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  354 bits (908), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 201/400 (50%), Positives = 257/400 (64%), Gaps = 28/400 (7%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           M ++LKWPWLGIAIP+FLI+ IGY AHYFILL+ LS + QLW+QF  +MIWLSYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  PPGKPPTNFKPSKNE----WXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVG 116
            PG P       KNE                P R+HHCKTCN+C+LMMDHHCPWTMNCVG
Sbjct: 61  DPGSPSI---ADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVG 117

Query: 117 YNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAF 176
           + N+PHF+RFLFWVIV T  L   L  RI  IW +  S S L  + E++ LTILTP++AF
Sbjct: 118 FKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAF 177

Query: 177 ILLTISILMIRCLFNQIFNGRSQIESWEMDRLET--LARMSK---LLPILIENVWYIFPN 231
           ILLTI++L+IRC  NQIF+G SQIE WEM+RLE+   +R  K    L ILI NV+ IF  
Sbjct: 178 ILLTITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSI 237

Query: 232 LRNEHVESQAEALL---NKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDD 288
              E  + +   LL   +K+RL+   ++NFPYD+    NA  +LG    WL PF  P+ D
Sbjct: 238 ESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGD 297

Query: 289 GLHFQKNEESMIEDPNSLNDIILCLPWPPD--STKHLNSTSEHTSNVQIISEEGEQVIRI 346
           G+HF+ NE +  E  ++L D++L LPWPPD  ++K+  S  E T  V+   E GE V+R 
Sbjct: 298 GMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRN 356

Query: 347 RT----------PEKKLSRSEWLNDWGESLEDFGVDVDVE 376
           RT           E +LSR  W N+WGE+L+ FGVD++ E
Sbjct: 357 RTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  211 bits (536), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 145/403 (35%), Positives = 212/403 (52%), Gaps = 56/403 (13%)

Query: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60
           M ++   PW G+AIPS +I ++   +++ IL + L+  + +WY     MI  SYYLAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  PPGKPPTNFKPS------KNEWXXXXXXXXXXXPE----RSHHCKTCNQCVLMMDHHCPW 110
           PP   P+    S       NE             +    R+HHCKTCN CV+MMDHHCPW
Sbjct: 61  PPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHHCPW 120

Query: 111 TMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLY--YKSELIFLT 168
           TMNCVGY N+PHFIRFL WVI+ TT+L   L  + + ++++R+SP +LY   K ++I LT
Sbjct: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIIILT 180

Query: 169 ILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPI----LIEN 224
           +L P   F+ LT+ +L+++ L NQI+NG +QIE W+ + +E     SK   +     +  
Sbjct: 181 LLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQLLE 240

Query: 225 VWYIFPNLRNE-----HVESQAEALLNKKR--LSLDELVNFPYDLGPFRNAIQLLGT--P 275
               F N +        ++    +L N  R   S   ++NFPYDLG   N    +G+  P
Sbjct: 241 NLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300

Query: 276 PLWLYPFSGPQDDGLHFQKNEESMIEDPN----SLNDIILCLPWPPDSTKHLNSTSEHTS 331
             W  P+  P      + K  E  I D N    ++ D++LCLPWP      LN ++  T 
Sbjct: 301 LSWFNPWYTPLTAS--YNKINEFAIWDDNETHDNIKDMLLCLPWP------LNYSNNST- 351

Query: 332 NVQIISEEGEQVIRIRTPEKKLSRSEWLNDWGESLEDFGVDVD 374
                 ++GE V++              ND+GE+L+DFGVD D
Sbjct: 352 -----FQDGELVVK-------------SNDYGETLQDFGVDYD 376

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 78/149 (52%), Gaps = 8/149 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC TC++C+L MDHHCPW   C+G+ N  +F++FL +    +  +  F +  +H 
Sbjct: 109 PDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCTAYSIVVLFFTSCELHY 168

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCL-FNQIFNGRSQIESWEMD 206
            +  +       Y+ ELI L +LT     I++T+S++        Q+   ++ IE + M 
Sbjct: 169 WFSGKQ------YEDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKNQTTIEMYGMK 222

Query: 207 RLE-TLARMSKLLPILIENVWYIFPNLRN 234
           R +  L  +  L    ++N++ +    RN
Sbjct: 223 REKRDLELLRGLEDAEVDNIFDLGSRRRN 251

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 73/143 (51%), Gaps = 10/143 (6%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+RSHHC TCN+CVL MDHHCPW   C+G+ N   FI+FL +       +AI  + ++++
Sbjct: 118 PDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYNTTYAYVIAILTSKQMYN 177

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEM-- 205
            W    S    +    L+FL IL  + +  L   +   +      + N ++ IE + M  
Sbjct: 178 -WFDDGSYENEFVNMYLLFLWILALVVSLALSCFAGFSVY----MVMNNKTTIEMYAMRK 232

Query: 206 --DRLETLARMSKLLPILIENVW 226
             D LE   R    +P  +EN++
Sbjct: 233 YRDDLELYNRNPNRVPS-VENIF 254

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 7/121 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC TCN CVL MDHHCPW   CVGY N   FI+FL +  V +  + I  +  I++
Sbjct: 114 PDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYSILVLILSSMEIYT 173

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCL-FNQIFNGRSQIESWEMD 206
            W         +++ ELI  T+L+     ++++ISI +      +Q+   ++ IE + + 
Sbjct: 174 -WFKGE-----FFEVELINFTLLSLWLLALVVSISITIFTVFSISQVCQNQTTIELYSLR 227

Query: 207 R 207
           R
Sbjct: 228 R 228

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 77.0 bits (188), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%), Gaps = 6/84 (7%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC  CN+C+L MDHHCPW  +CVG+ N  +FI+FL +  +   ++ IF T +++ 
Sbjct: 116 PDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATLYAFNVLIFDTIQLY- 174

Query: 148 IWVHRSSPSYLYYKSELIFLTILT 171
           IW H+       Y+ +LI L + +
Sbjct: 175 IWFHQGD-----YERQLIDLVLFS 193

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 66/124 (53%), Gaps = 7/124 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC +CN+C+L MDHHCPW   C+G+ N  +FI+FLF+    + S+ +   T I  
Sbjct: 114 PDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYCT--SYSIIVLFVTSIQI 171

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCL-FNQIFNGRSQIESWEMD 206
               RS+     Y+ E I   +LT     I++ IS+++       Q+   ++ IE +   
Sbjct: 172 YHWFRSTS----YEYEFIDFKLLTVWLLAIVIFISLVLFTGFSVFQLLGNQTTIELYAYR 227

Query: 207 RLET 210
           R + 
Sbjct: 228 RYKA 231

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 52/97 (53%), Gaps = 6/97 (6%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC  CN+C L MDHHCPW  +CVGY N  +FI FL +     + L  FLT     
Sbjct: 141 PDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYT-TAYSILVFFLTGADLL 199

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISIL 184
           +W          Y  ELI L +L      +++TIS+L
Sbjct: 200 MWFRSQG-----YNQELINLPLLIVWILSLVITISML 231

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 67/130 (51%), Gaps = 11/130 (8%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIF---LTTR 144
           P+R HHC +C++C+L MDHHCPW   CVG+ N   FI+FL +    TT+ AIF   +T+ 
Sbjct: 111 PDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLY----TTAYAIFVLSMTSV 166

Query: 145 IHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWE 204
               W +            L+FL I + L  FI +T   L      +Q+   ++ IE + 
Sbjct: 167 QLYRWFYNDKFQEELISGYLLFLWIFS-LVVFIAMT---LFSAFSVSQVLKNQTTIEMYG 222

Query: 205 MDRLETLARM 214
           + R    AR+
Sbjct: 223 VQRWRNQARI 232

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 66/122 (54%), Gaps = 9/122 (7%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC  C++C+L MDHHCPW   CVG+ N  +F++FL +  V    +  + + +I+ 
Sbjct: 114 PDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVYAILVMTYTSFQIYD 173

Query: 148 IWVHRSSPSYLYYKSELIFLTILTP--LNAFILLTISILMIRCLFNQIFNGRSQIESWEM 205
            W          Y++E+I + +L    L+  + LT++      ++ Q  N R+ IE + +
Sbjct: 174 -WFKNE-----LYETEIIKIRLLMVWILSVAVFLTVTCFTGFSIY-QTINNRTTIEMYTL 226

Query: 206 DR 207
            +
Sbjct: 227 RK 228

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 14/107 (13%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC  CN+C L MDHHCPW  +CVG+ N   F++FL +  V +  + +  + +++S
Sbjct: 113 PDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVLLMTSAQLYS 172

Query: 148 IWVHRSSPSYLYYKSELI--------FLTILTPLNAFILLTISILMI 186
            W  +     + YKSEL+         L+++  +  F   T +I ++
Sbjct: 173 -WFRQ-----MKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLV 213

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 63/121 (52%), Gaps = 7/121 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC TCN+C+L MDHHCPW   C+G+ N   FI+FL +  +    +A+ L +    
Sbjct: 117 PDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTI-YAFVALGLISYQFV 175

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCL-FNQIFNGRSQIESWEMD 206
            W    +    Y    + F  ++  L AF+ ++IS+L        Q+   R+ IE + + 
Sbjct: 176 NWYKNQN----YMNEYIDFTLLIVGLLAFV-ISISVLAFSSFSIYQVLKNRTTIEMYGIR 230

Query: 207 R 207
           R
Sbjct: 231 R 231

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC +C+ C+L MDHHCPW   C G+ N   FI+FL +       + I+    + +
Sbjct: 114 PDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTFYAFLVLIYSCYELGT 173

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCL-FNQIFNGRSQIESWEMD 206
            W H  S     +  ELI   +L      I + IS+L        Q+ N ++ IE + M 
Sbjct: 174 -WFHSGS-----FNQELIDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQTTIELYGMR 227

Query: 207 R 207
           R
Sbjct: 228 R 228

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 41/60 (68%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+RSHHC +CN+C L  DHHCPW  +C+G+NN   F++FL +  + + S+ I  T +I S
Sbjct: 118 PDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIFIAATLQIVS 177

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 70.1 bits (170), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 55/86 (63%), Gaps = 10/86 (11%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTT--SLAIFLTTRI 145
           P+RSHHC +CN+C L MDHHCPW  +C+G+ N   FI+FL +    TT  ++ +F+TT +
Sbjct: 113 PDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY----TTWYAVFVFMTTGL 168

Query: 146 HSIWVHRSSPSYLYYKSELIFLTILT 171
             +W    +     Y+ ELI L+++T
Sbjct: 169 Q-LWKWLDNK---MYEKELIDLSLMT 190

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 76/152 (50%), Gaps = 17/152 (11%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC  C++C+L MDHHCPW   C+G+NN   FI++L +    T S+ IFL + I  
Sbjct: 115 PDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYAT--TYSIVIFLFSSIQL 172

Query: 148 I-WVHRSSPSYLYYKSELIFLTILTP--LNAFILLTISILMIRCLFNQIFNGRSQIESWE 204
           + W +        Y+ ELI   +L+   L   + +++S      ++ Q+   ++ +E   
Sbjct: 173 LHWFNTKQ-----YEVELIDFHLLSVWLLGVAVSVSLSFFTGFSIY-QVTKNQTTVE--- 223

Query: 205 MDRLETLARMSKLLPILIENVWYIFPNLRNEH 236
              +    R  + L IL +    I PN  N +
Sbjct: 224 ---MHIYRRYREELEILADTCGSINPNRDNAY 252

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 66/129 (51%), Gaps = 9/129 (6%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTT-SLAIFLTTRIH 146
           P+R HHC  C +C L MDHHCPW  +CVGY N  +F++FL   I GT  S+ IFL +   
Sbjct: 114 PDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFL---IYGTVFSILIFLLSGTE 170

Query: 147 SIWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRC-LFNQIFNGRSQIESWEM 205
            +   ++      Y  E+I L +L      + ++IS+L         I   ++ IE +E 
Sbjct: 171 LLLWFKNQR----YNQEMIQLPLLVVWILSVAISISMLAFTSYTVYLITKNQTTIEMYEW 226

Query: 206 DRLETLARM 214
             L+  A +
Sbjct: 227 SNLKAEANI 235

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC +C+ C+L MDHHCPW   C G+ N   FI+FL +  +    + I+    + +
Sbjct: 114 PDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFLVLIYTCYELGT 173

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCL-FNQIFNGRSQIESWEMD 206
            W +  S     +  ELI   +L      + + IS+L   C    Q+   ++ IE   M 
Sbjct: 174 -WFNSGS-----FNRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQTTIEVHGMR 227

Query: 207 R 207
           R
Sbjct: 228 R 228

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 7/123 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC +C++C+L MDHHCPW   C+G+ N  +FI FL +  +  T + +  +     
Sbjct: 114 PDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFVCLISS---KE 170

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCL-FNQIFNGRSQIESWEMD 206
           +W   S   Y+   +ELI + +L      ++ ++S+ +       Q+   R+ IE +   
Sbjct: 171 LWNWFSQEKYV---TELINIHLLLLFIVSLITSVSMTLFTAYSIYQVLINRTTIELYAYR 227

Query: 207 RLE 209
           R +
Sbjct: 228 RYK 230

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 57/121 (47%), Gaps = 7/121 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC +C+ C+L MDHHCPW   C G+ N   FI+FL +       L +  T     
Sbjct: 114 PDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTTF-YAFLVLIDTCYELG 172

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCL-FNQIFNGRSQIESWEMD 206
            W +  S     +  ELI L +L      I + IS+L        Q+ N ++ IE   M 
Sbjct: 173 TWFNSGS-----FSRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQTTIELHSMR 227

Query: 207 R 207
           R
Sbjct: 228 R 228

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 86/222 (38%), Gaps = 46/222 (20%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P RS HC+ CN C+L+ DHHC W  NC+G  N+ +F  FL    +  T   I    R+  
Sbjct: 147 PARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI----RLFL 202

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEMDR 207
           ++    +PS       ++ L IL    A I    + L ++     + +G +  E  +   
Sbjct: 203 MYCQGHAPS----SRNILTLLILCGSFAVICAGFTFLQLQ----LVKDGMTTNEQDKWFT 254

Query: 208 LETLARMSKLLPILIENVWYIFPNLRNEHVESQAEALLNKKRLSLDELVNFPYDLGPFRN 267
           L+   R  KL+    EN W+I     +  +   A+ +                       
Sbjct: 255 LQEYMRDGKLIRTKDENKWFIANPNDDATITINADTI----------------------- 291

Query: 268 AIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMIEDPNSLNDI 309
                       Y  +    +G H   +E +++EDP  + ++
Sbjct: 292 -----------FYSTNAYDHEGYHLSSDEYTIVEDPRQITNL 322

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 15/125 (12%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P+R HHC +C+ CVL MDHHCPW   C G+ N   FI+FL +       + I+    + +
Sbjct: 114 PDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTTCYAFLVLIYTCYELGT 173

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFN-----QIFNGRSQIES 202
            W +  S     +  ELI   +L       LL +++ +    F      Q+   ++ IE 
Sbjct: 174 -WFNSGS-----FNRELIDFQLL----GVALLAVAVFITVLAFTVFSIYQVCKNQTTIEV 223

Query: 203 WEMDR 207
             M R
Sbjct: 224 HGMRR 228

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 73/141 (51%), Gaps = 12/141 (8%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
             RS HC  C +C+L+ DHHC W  NC+G  N+ +F  FL    +   S+  + T R+ S
Sbjct: 141 AARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL----LSNCSMLSYATIRLSS 196

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEMDR 207
           +     +PS L ++S   FL+++  +  F +++IS   ++  F  + +G +  E  +   
Sbjct: 197 V-----APSGL-WRSNKSFLSLMILVCCFAVISISFTYMQ--FALVRDGMTTNEKDKWYT 248

Query: 208 LETLARMSKLLPILIENVWYI 228
           +  L R  +LL +  +  +YI
Sbjct: 249 IHKLMRNEQLLKLNNDCKFYI 269

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 52/98 (53%), Gaps = 3/98 (3%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P R+ HC TC  C+L  DHHC W  NC+G  N+ +FI FL   I+  +S+ +     IH 
Sbjct: 189 PPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAIL--SSIFLIANCSIH- 245

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILM 185
           I+ HR+ PS +     L+    L  +   +LL   ILM
Sbjct: 246 IYHHRNLPSKVPVTILLLIYGGLAIIYPMLLLIYHILM 283

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 7/110 (6%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P RS HC  C +CVL+ DHHC W  NC+G  N+  F  FL   +V   SL+      +  
Sbjct: 146 PARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFL---VVNVISLSYGF---LRV 199

Query: 148 IWVH-RSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNG 196
           +W+     PS + Y   ++  TIL    A I    + L ++ + + +  G
Sbjct: 200 LWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTG 249

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (53%), Gaps = 7/99 (7%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P RS HC  CNQCVL +DHHC W  NCVG  N+ +F  FL   ++ + S++      I S
Sbjct: 143 PARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFL---VLNSLSMS---YAFIRS 196

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMI 186
           + +    P+  Y +S L F  +LT   A I +  + L +
Sbjct: 197 MSIVGLKPNIKYPRSILAF-NLLTGCFALICIVFTYLQL 234

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 60/131 (45%), Gaps = 11/131 (8%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P RS HC  C  C+L+ DHHC W  NC+G  N+ +F  FL   ++ T SL+      +H 
Sbjct: 147 PARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFL---LLNTISLSYAFLRLLHI 203

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEMDR 207
                  P        ++ L ILT   + I      L ++    Q+ NG +  E+ +   
Sbjct: 204 TLSKPDVPK----SKNILALCILTGSFSVICGVFFYLQMK----QVNNGMTTNETDKWYA 255

Query: 208 LETLARMSKLL 218
           ++ L R  KL+
Sbjct: 256 VQELMREGKLI 266

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (43%), Gaps = 19/182 (10%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P RS HC  CN+C+LM+DHHC W  NC+G  N+ +F  FL    +   +L  +   R+ S
Sbjct: 140 PARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL----LSNVTLLSYSFLRLTS 195

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEMDR 207
           I +   + +       ++ LTILT     I+           FN + +G +  E  +   
Sbjct: 196 IQLMSQTENIK--TKPMLVLTILTGCFDIIVAVFGYTQ----FNLVHDGMTTNEQDKWFT 249

Query: 208 LETLARMSKLLPILIENVWYIFPNL------RNEHVESQAEALLNKKRLSLDELVNFPYD 261
           ++   R   L  +  +   Y F  L      R++  E  +    NKK++ L E  N   D
Sbjct: 250 VQEFMRDGNL--VRDKKGHYYFRILDESSSDRDQKEEEDSYRSNNKKKMLL-ENANTRID 306

Query: 262 LG 263
            G
Sbjct: 307 YG 308

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLF 128
           P RS HC  C+QC+L+ DHHC W  NC+G  NF +F  FLF
Sbjct: 145 PARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLF 185

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLF--WVIVGTTSLAIFLTTRI 145
           P RS HC  CN+CVL+ DHHC W  NC+G  N+ +F  FL    +++G   L I L T  
Sbjct: 145 PARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIILLTAY 204

Query: 146 HSI 148
             I
Sbjct: 205 SDI 207

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL-------FWVIVGTT 135
           P+R HHC  C++C L  DHHC W   C+GYNN   F+ FL       FW+ + TT
Sbjct: 179 PDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWICIITT 233

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 39/71 (54%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P R+ HC TCN C++  DHHC W  NCVG  N+ +F+ F++  ++    L I  + R+  
Sbjct: 197 PLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTIILLVINCSVRLSK 256

Query: 148 IWVHRSSPSYL 158
                 +PS L
Sbjct: 257 GSPTAKTPSLL 267

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTS-----LAIFLT 142
           P RS HC  C++CVL+ DHHC W  NCVG  N+ +F  FL       T      L IF T
Sbjct: 145 PARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFIRLLTIFYT 204

Query: 143 TRIH 146
           T ++
Sbjct: 205 TNVY 208

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 58/132 (43%), Gaps = 8/132 (6%)

Query: 54  YYLAIYTPPGKPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMN 113
           YY +I  P   P +N  P                P R+ HC TC  CV+  DHHC W  N
Sbjct: 157 YYSSISLP--TPKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNN 214

Query: 114 CVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPL 173
           CVG  N+ +FI FL    +GT    +FL     SI + R S S +     L+    L+ L
Sbjct: 215 CVGQRNYRYFIIFL----IGTVLAELFLIANC-SIHIARRS-SQVPVTILLLVYACLSIL 268

Query: 174 NAFILLTISILM 185
              ILL   + M
Sbjct: 269 YPAILLGYHVFM 280

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 7/100 (7%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P RS HC TCN CV++ DHHC W  NC+G  N+  F+ FL   ++  +S+ +     IH 
Sbjct: 183 PPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVI--SSIILLANCAIH- 239

Query: 148 IWVHRSSPSYLYYKSELIFLTI--LTPLNAFILLTISILM 185
             + R S    +Y   ++ L    LT     IL T  + M
Sbjct: 240 --IARESGGPGHYPVAILLLCYAGLTLWYPAILFTYHVFM 277

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 29/48 (60%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTT 135
           P RS HC  CN+C+L+ DHHC W  NC+G  N+  F  FL   IV  +
Sbjct: 144 PARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMS 191

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRI 145
           P R+ HC TC  CVL  DHHC W  NC+G  N+ +F+ FL    + TT   +    R+
Sbjct: 186 PPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATTLCIVGCGIRV 243

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P R+ HC TCN CV++ DHHC W  NCVG  N+  F+ FL   I      ++FL T   +
Sbjct: 183 PPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFS----SVFLLTNC-A 237

Query: 148 IWVHRSSPSYLYYKSELIFLTI--LTPLNAFILLTISILM 185
           I + R S     Y   L+ L    LT     IL T  I M
Sbjct: 238 IHIARESDGPRNYPVALLLLIYAGLTIWYPAILFTYHIFM 277

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSL 137
           P RS HC TCN CV++ DHHC W  NC+G  N+  F+ FL   I+ +  L
Sbjct: 183 PPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVIL 232

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFL 141
           P RS HC  C  CVLM DHHC W  NCVG  N+ +F+ FL      +T  +IFL
Sbjct: 192 PPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFL----TSSTLTSIFL 241

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 91/224 (40%), Gaps = 39/224 (17%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL----FWVIVGTTSLAIFLTTR 144
            R+ HC  C+QCV + DHHC W  NC+G  N+ +F  FL    F    G   L +FL   
Sbjct: 142 ARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFLRL-LFLQRF 200

Query: 145 IHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWE 204
           +HS               +L+ L+IL      IL   S       + Q    R  + + E
Sbjct: 201 VHS--------------RQLLILSILLGCFGVILAVFS-------YFQFVLVRDGMTTNE 239

Query: 205 MDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQAEALLNKKRLSLDELVNFPYDLGP 264
            ++   +  M +   ++ ++    +  L  +  E  AE+L N +  S           GP
Sbjct: 240 ENKWLVIHDMIRARQMVTDDTGKYYFRLLADCQEDSAESLTNPRHSS----------QGP 289

Query: 265 FRNAIQL-LGTPPLWLYPFSGPQDDGLHFQKNEESMIEDPNSLN 307
             N   L   +P +++Y  + P D+  +  KN + ++      N
Sbjct: 290 --NEFHLNDSSPDIYVYYSTNPYDNATYDVKNPKEILSTAAITN 331

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 25/40 (62%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           P RS HC  CN C+ + DHHC W  NCVG  N+ +F  FL
Sbjct: 144 PARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL 183

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGT----TSLAIFLTT 143
           P R+ HC TC  C++  DHHC W  NC+G  N+ +F  FL   ++ T     + AI ++ 
Sbjct: 180 PPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATAFIIANCAIRVSR 239

Query: 144 RIHS 147
            +H+
Sbjct: 240 SVHA 243

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 26/41 (63%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLF 128
             RS HC  CN+CVL+ DHHC W  NC+G  N+  F  FLF
Sbjct: 144 AARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF 184

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           P RS HC  CN+CVL+ DHHC W  NC+G  N+  F  FL
Sbjct: 144 PARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P R+ HC+ C  CV   DHHC W  NCVG  N+ +F+ FL       T   +F+++ IH 
Sbjct: 194 PPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFL--TATCATCTVLFVSSAIHL 251

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIR 187
               R+ P  L   S +     L  L   + +T +    R
Sbjct: 252 SHETRAVPIVLVAYSGIALWYPLVLLVYHVCMTATGQTTR 291

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIH 146
           P RS HC TCN CV++ DHHC W  NC+G  N+  F+ FL   I   +S+ + +   +H
Sbjct: 183 PPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIF--SSILLLVNCAVH 239

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P R+ HC  C  C+ + DHHC W  NCVG  N+ +FI FL   I+  +S+ I +   IH 
Sbjct: 198 PPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAIL--SSIFIIINCSIHV 255

Query: 148 IWVHRSSPS 156
             + R+S +
Sbjct: 256 ARIRRASNA 264

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIH 146
           P RS HC  C+ CV+ +DHHC W  NCVG  N+ +F+ FL   I+  T + + + T IH
Sbjct: 204 PPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIM--TVIFLLINTGIH 260

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           P RS HC  CN+C+L+ DHHC W  NC+G  N+  F  FL
Sbjct: 144 PARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFL 183

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 14/94 (14%)

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLF--WVIVGTTSLAIFLTTRIHS 147
           RS HC  C +C+ + DHHC W  NCVGY N+ +F  FL    +++   SL +    RI +
Sbjct: 139 RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASLRLLTLFRITA 198

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTI 181
                       +K +  FL++     AF L+ I
Sbjct: 199 ------------FKKDKFFLSLFLLTTAFSLIAI 220

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRI 145
           P RS HC  C++C+L+ DHHC W  NC+G  N+  F  F    I G +   I+  TR+
Sbjct: 143 PARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLF----IGGNSLTMIYCFTRL 196

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P R+ HC  C+ C+L  DHHC W  NC+G  N  +F+ FLF  ++ +    I+L T    
Sbjct: 195 PPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSS----IWLLTCCAL 250

Query: 148 IWVHRSSPS 156
              H  SPS
Sbjct: 251 KLRHAGSPS 259

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSL----AIFLTT 143
           P R+ HC  C  CV+  DHHC W  NCVG  N+ +F+ FL    + +  L    AI L  
Sbjct: 186 PPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFLLANCAIHLAR 245

Query: 144 RIHSI 148
           R  SI
Sbjct: 246 RRRSI 250

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 5/99 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHS 147
           P R+ HC  C  CVL  DHHC W  NCVG  N+ +F+ FL      +++LA  L     +
Sbjct: 168 PPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLL-----SSTLACALLIANCA 222

Query: 148 IWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMI 186
           + +HR+    +      + + +L  + A +L    ++++
Sbjct: 223 LHLHRALHEGIRVSHRPLPVAVLLCVYAAVLCVYPVILL 261

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 25/40 (62%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           P R+ HC  C  C+L  DHHC W  NC+G  N+ +F+ FL
Sbjct: 181 PPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFL 220

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRI 145
           P RS HC  C+ CVL  DHHC W  NC+G  N+  F+ FL    +    L +  + R+
Sbjct: 182 PPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLILLSSFRL 239

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFL 141
           P RS HC  C  C++  DHHC W  NC+G  N+  F+ FL    +  T  +IFL
Sbjct: 225 PPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFL----LSGTFTSIFL 274

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL----FWVIVGTTSL 137
           RS HC  C +C  + DHHC W  NC+G  N+ +F  FL    F  + G T L
Sbjct: 141 RSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFTRL 192

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGT 134
           P RS HC  C +CV + DHHC W  NCVG  N+      LF++ +G 
Sbjct: 134 PARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYG-----LFYLALGA 175

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           RS HC  C +C+ + DHHC W   C+G  NF +F  FL
Sbjct: 149 RSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFL 186

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSI 148
           ER+HH      CV   DH+C W    +G +N+  F++F+ +  +  + + + + + IH I
Sbjct: 132 ERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWVSIVSYIHMI 191

Query: 149 WVHRSSPSYLYYKSELIFLTILTPL 173
              R +  + ++ + LI + +   L
Sbjct: 192 IRKRPNQPHHHFNTNLIIILVFAIL 216

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%)

Query: 64  KPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHF 123
           KPP  ++  KN +             RSHH K   +C+L  DH+C W    +  NN+  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 124 IRFLFW 129
           ++++ W
Sbjct: 162 LQYVGW 167

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%)

Query: 64  KPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHF 123
           KPP  ++   N +            ER HH +    C+   DH+C W    +G NN+  F
Sbjct: 101 KPPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLF 160

Query: 124 IRFLFW 129
           I+++F+
Sbjct: 161 IQYVFY 166

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIV 132
           RSHH    N C+   DH+C W    +G +N+  F+ FLF+  V
Sbjct: 129 RSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFLFYCTV 171

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 6/122 (4%)

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIW 149
           R+HH K    C+   DHHC W    +G +N+  F +F+F+    +  L IF  + +  I 
Sbjct: 134 RTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYF---SCLLLIFWISIVSYIK 190

Query: 150 VHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEMDRLE 209
                P +  YK +   + IL     F ++T+S+ +    F   F  R+ +E   + R +
Sbjct: 191 RIVDYP-HTGYKLDPNLIVILILSVPFSIMTLSLFLSHVYFT--FMNRTSLEIINIKRNK 247

Query: 210 TL 211
            L
Sbjct: 248 KL 249

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%)

Query: 64  KPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHF 123
           KPP  ++  +N +             R+HH      CV   DH+C W    +G  N+  F
Sbjct: 110 KPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLF 169

Query: 124 IRFLFWV 130
           I+FL ++
Sbjct: 170 IQFLVYM 176

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 36/88 (40%), Gaps = 4/88 (4%)

Query: 64  KPPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHF 123
           KPP  ++     +             R+HH  T   C+   DH+C W    VG  N+  F
Sbjct: 109 KPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLF 168

Query: 124 IRFLFW----VIVGTTSLAIFLTTRIHS 147
           ++F F+     I    S+A FL   I S
Sbjct: 169 VQFAFYFWLFTIYMIASIASFLRRIIKS 196

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 13/123 (10%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL----FWVIVGTTSLAIFLTTR 144
           ER+HH +    CV   DH C +  + +G +N+  F+++      W+ +  TS+  ++ + 
Sbjct: 136 ERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIWTSIVAYIRSI 195

Query: 145 IHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWE 204
                 +R   S+L     LI + ILT L  F +   S+L+ +   N I   ++ IE  E
Sbjct: 196 TRD---YRGHGSHL--NGNLIAILILTTL--FWITVTSLLLTQ--LNCIVKNKTSIEVME 246

Query: 205 MDR 207
             R
Sbjct: 247 RRR 249

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIR----FLFWVIVGTTSLAIFLTTR 144
           ER+HH  T   CV   DH+C W    VG  N+  FI+    F F+ ++    +  +L   
Sbjct: 136 ERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMYFFFYFVIVLIPVCKYLKDI 195

Query: 145 IH 146
           IH
Sbjct: 196 IH 197

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 7/55 (12%)

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFW-------VIVGTTSL 137
           R+HH  T   C+   DH+C W    VG  N+  F++F F+       VIV T S 
Sbjct: 142 RTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFVIVSTASF 196

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/246 (19%), Positives = 86/246 (34%), Gaps = 31/246 (12%)

Query: 65  PPTNFKPSKNEWXXXXXXXXXXXPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFI 124
           PP  ++   N +            ERSHH      C+   DH+C W    +G +N+  F+
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 125 RFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISIL 184
           +F  +       + + +   I +I  H  + +              +PLNA + LT++  
Sbjct: 176 QFTGYFSSLLLIMWVSICVFIRNITQHHHNHN--------------SPLNANVFLTLAFA 221

Query: 185 MIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQAEAL 244
           +   LF           S     +  + +    L  ++++    F   +     S+A  L
Sbjct: 222 IFGWLFTT---------SMLASNIFYMCQNKTYLEAIMDSKRKNFGTRKIFCYYSEANKL 272

Query: 245 LNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPL-WLYPFSGP-------QDDGLHFQKNE 296
                    E  +F      F N    +G   L WL PF  P        D G  F+  E
Sbjct: 273 RFVVEFERTEFHSFWSKKTIFANIKDFMGPNMLMWLIPFGKPLSFSCKSNDKGRPFRSGE 332

Query: 297 ESMIED 302
            + + +
Sbjct: 333 RTTLAE 338

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 24/51 (47%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLA 138
           P RS +    N  V   DH CPW  N VG  N  +FI F+  V  G  + A
Sbjct: 482 PLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEAGIITFA 532

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 71/182 (39%), Gaps = 15/182 (8%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGT---TSLAIFLTTR 144
           P RS +    +  V   DH CPW  N +G  N   F+ F+  +++G    T LA+     
Sbjct: 487 PLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVIGIWEYTYLAMEYFDE 546

Query: 145 IHSIWVHRSSPSYLYYKSELIFLTILTPLNAFIL---LTISILMIRCLFNQIFNGRSQIE 201
           +  ++  + +  +L    EL           FI+   L  SI +   +F Q F     + 
Sbjct: 547 LEDLY--KDASCFLLGDDELCAGLTYGTFTFFIMIWSLFQSIWVSILIFVQTFQMFKGVT 604

Query: 202 SWEMDRLETLARMSKLLPILIENVWYIFP-------NLRNEHVESQAEALLNKKRLSLDE 254
           S+E  ++   +R+    P  + + +   P       +  N   ++ A  L  + R    E
Sbjct: 605 SYEFSKIVKGSRVRNPKPSRVNDTFNTTPDGYTSGNDAENSATDAAASTLQPESRTGTLE 664

Query: 255 LV 256
            +
Sbjct: 665 TI 666

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 14/131 (10%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGT---TSLAIFLTTR 144
           P RS +    N  V   DH+CPW  N VG  N   F+ F+  +  G    TSL +    +
Sbjct: 472 PLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILSMETGIGLFTSLCLEYFDQ 531

Query: 145 IHSIWVHRSSPSYLYYKSELI-------FLTILTPLNAFILLTISILMIRCLFNQIFNGR 197
           +  ++        L    EL        F  ++   +AF  L +S+L    +F Q+F   
Sbjct: 532 LEDLYDDDKLKCLLLGDDELCAGFTHDRFSFLIMAWSAFQFLWVSLL----IFVQVFQVT 587

Query: 198 SQIESWEMDRL 208
             + S+E +++
Sbjct: 588 KGVTSYEFNKI 598

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFL 141
           ER+HH      CV   DH C W    +G +N+  FI+F+ ++ +   SL +F+
Sbjct: 136 ERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAI--LSLFVFV 186

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIR----FLFWVIVGTTSLAIFL 141
           ERSHH +    CV   DH+C W    +G  N+  F++    F  +++  + ++A+F+
Sbjct: 136 ERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTASLTIALFM 192

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           ER+HH      CV   DH+C W    +G +N+  F++F+
Sbjct: 141 ERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFV 179

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 37/85 (43%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSI 148
            R+HH      CV   DH+C W    +G  N+  F++F F++ +    L I + T++  +
Sbjct: 137 SRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVLILMISIATQMRQM 196

Query: 149 WVHRSSPSYLYYKSELIFLTILTPL 173
               +   Y  +      L +  PL
Sbjct: 197 KGSANGNVYAVFALACCALLMAGPL 221

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 72/183 (39%), Gaps = 28/183 (15%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTR--- 144
           P RS      N  V   DH+CPW  N +G  N   F+  +  V +    L  +L      
Sbjct: 472 PLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEI-LMLLFNYLCMEYFD 530

Query: 145 ----IHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT--------ISILMIRCLFNQ 192
               +H    +   P     ++E + L       AF+           + +L+I  LF Q
Sbjct: 531 ELEDVHKHADNGGEPKCTILRNENLCLGFTYDRFAFLTFVWVVFHSVWVGLLVIVQLF-Q 589

Query: 193 IFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFP--------NLRNEHVESQAEAL 244
           +F G   + ++E  +L   +R+++  P+L    +   P         + N ++E   EA 
Sbjct: 590 VFQG---VTNYEFSKLMKESRINRTDPVLFNEFFGTAPEELLTVNGEIDNTNLERSNEAS 646

Query: 245 LNK 247
           LN+
Sbjct: 647 LNQ 649

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRF 126
           ER+HH      C+   DH+C W    +G +N+  F++F
Sbjct: 140 ERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQF 177

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 20/40 (50%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           P RS +    N  V   DH+CPW  N VG  N   FI F+
Sbjct: 480 PLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 43/104 (41%), Gaps = 16/104 (15%)

Query: 89  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSI 148
           ER+HH      CV   DH+C W    +G +N+  F++F+ +       + + +   I  I
Sbjct: 146 ERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVTYFSSLLLLMWLSICVYIRDI 205

Query: 149 -WVHRSSPSYLYYKSELIFLTILTPLNAFILLTISILMIRCLFN 191
              HR                   PLN  ++LT+++ +   L N
Sbjct: 206 TQRHRGHNP---------------PLNVNVILTLALALFGWLMN 234

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAI 139
           P RS   +     ++  DH CPW  N VG  N   FI FL  ++ G +   I
Sbjct: 462 PLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVSCFFI 513

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVG 133
           P RS      N  V   DH+CPW  N +G  N   FI F+  V +G
Sbjct: 471 PLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEIG 516

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSI 148
           R+ H      CV   DH+C W    +G+ N+  F++F+F+  V    + I ++  I  I
Sbjct: 126 RTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAVLLMIVWITISVYIRDI 184

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 19/40 (47%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           P RS      N  V   DH+CPW  N VG  N   FI F+
Sbjct: 480 PLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGT 134
           P RS +    N  +   DH+CPW  N +G+ N   F+ F+ ++ +G 
Sbjct: 464 PLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGV 510

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 75/187 (40%), Gaps = 28/187 (14%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFL------ 141
           P RS +       V   +H+CPW  N +G  N   F+ F F V      + +F+      
Sbjct: 439 PLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSV---QYEMFLFMWLCLEY 495

Query: 142 ---TTRIHSIWVHRSSPSYLY---------YKSELIFLTILTPLNAFILLTISILMIRCL 189
              T  I+      +  ++L          Y     FL I   +N F+ L   +L+++C 
Sbjct: 496 FKKTNHIYEQVEEYAKCTFLKNETLCKGSNYDPSTFFLFIWISMN-FVWLG-GMLIVQCF 553

Query: 190 FNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRN-EHVESQAEALLNKK 248
             QIF G +  E + + + E  A    L+P   EN  +  PN +N + V     A     
Sbjct: 554 --QIFKGITSPELYALIKEERKAEALNLIP--FENPIFSIPNGKNRDTVPEDPNATTVTH 609

Query: 249 RLSLDEL 255
            +S+D L
Sbjct: 610 TISIDSL 616

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSL 137
           P RS +    +  +L  DH+CPW  N VG  N   FI F+  + +G  S 
Sbjct: 464 PLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSF 513

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRF 126
           P R+ + +  +  +L  DH+CPW  N +G+ N   FI F
Sbjct: 456 PLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 19/40 (47%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           P RS      N  V   DH+CPW  N VG  N   FI F+
Sbjct: 480 PLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 21/46 (45%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVG 133
           P RSH        V   DH CPW  N +G  N  +F+ F+    VG
Sbjct: 465 PLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVG 510

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 19/40 (47%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           P RS      N  V   DH+CPW  N VG  N   F+ F+
Sbjct: 479 PLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 23/52 (44%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAI 139
           P RS         V   DH+CPW  N +G  N   FI F+F+  V   S  I
Sbjct: 476 PLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVTIWSFVI 527

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 40/97 (41%), Gaps = 13/97 (13%)

Query: 50  IWLSYYLAIYTPPG--KPPTNFKPSKNEWXXXXXXXX-----------XXXPERSHHCKT 96
           + L ++  +Y+ PG  +P T+F   +N+                       P R      
Sbjct: 417 VHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQRKPLRCKFSSF 476

Query: 97  CNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVG 133
            ++ VL  DH+CPW  N VG  N   F+ ++  V +G
Sbjct: 477 HSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSVGLG 513

>SAKL0A08756g Chr1 complement(770525..772303) [1779 bp, 592 aa] {ON}
           similar to uniprot|P36106 Saccharomyces cerevisiae
           YKL005C BYE1 Negative regulator of transcription
           elongation contains a TFIIS-like domain and a PHD finger
           multicopy suppressor of temperature-sensitive ess1
           mutations probably binds RNA polymerase II large subunit
          Length = 592

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 57/138 (41%), Gaps = 18/138 (13%)

Query: 215 SKLLPILIENVWYIFPNLRNEHVESQAEALLNKK-------RLSLDELVNFPYDLGPFRN 267
           SKL     E V  +F NL++    S  E ++N+K       R+S++ELVN P DL  FR 
Sbjct: 264 SKLSKHYAEKVRILFSNLKDRKNNSLKEHVVNRKISLHKLVRMSVNELVN-P-DLQLFRE 321

Query: 268 AIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMIEDPNSLN--DII----LCLPWPPDSTK 321
            +       L L     P+    H     + +IEDPN     D I      +    DS K
Sbjct: 322 KVDKDALDQLVLEQPDKPKYVKTH---RGDELIEDPNDYQPEDAIFNKDFTISHQDDSKK 378

Query: 322 HLNSTSEHTSNVQIISEE 339
                   +SN   IS E
Sbjct: 379 QKQEPDSTSSNDYTISSE 396

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 20/46 (43%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVG 133
           P RS         +   DH+CPW  N VG  N   F+ F+  + V 
Sbjct: 470 PLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVA 515

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTT 143
           R+HH      CV  +DH+C W    +G  N+  F +FL   ++   +L IF++ 
Sbjct: 132 RTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLM--HALIIFVSV 183

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 61/165 (36%), Gaps = 17/165 (10%)

Query: 90  RSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGT-------TSLAIFLT 142
           RS +       V   DH+CPW  N +G  N  H +   F + V          SLA F  
Sbjct: 452 RSKYSVFSGALVARFDHYCPWIYNDIGLKN--HKLSLFFAMTVQYHMFLFMWLSLAYFKK 509

Query: 143 TRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLTISI------LMIRCLFNQIFNG 196
           T      V   +         L   +   P   F+ + IS+       M+   F QI  G
Sbjct: 510 TNHIYEQVDEYAKCTFLKNETLCKGSNYDPSTFFLFIWISVNFVWLGAMLSVQFFQILKG 569

Query: 197 RSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQA 241
            +  E + + + E  A    L+P   EN  Y   N ++  + S++
Sbjct: 570 ITTPELFTLIKEERRAETFNLIP--FENPIYSIQNTKDSDIRSES 612

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 3/54 (5%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWVIVGTTSLAIFL 141
           P RS         V   DH CPW  N +G  N      FLF+++   T + +FL
Sbjct: 460 PIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHK---TFLFFILCLETCIFVFL 510

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 19/43 (44%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLFWV 130
           P RS +       V   DH+CPW  N VG  N   F+ F   V
Sbjct: 456 PLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTV 498

>YDR205W Chr4 (859346..861520) [2175 bp, 724 aa] {ON}  MSC2Member of
           the cation diffusion facilitator family, localizes to
           the endoplasmic reticulum and nucleus; mutations affect
           the cellular distribution of zinc and also confer
           defects in meiotic recombination between homologous
           chromatids
          Length = 724

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 12  IAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYTP 61
           I +P+F+ +S    AHYF  +N+ S RK  +Y     + +LS   AI+ P
Sbjct: 62  IFLPTFVASSFNLFAHYFNFINYSSRRK--YYVLFTAIYFLSILTAIFHP 109

>ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL175C
           (AIR2) and YIL079C (AIR1)
          Length = 342

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 3/30 (10%)

Query: 97  CNQCVLMMDH---HCPWTMNCVGYNNFPHF 123
           C+ C LM DH   HCP TM C   N+  H+
Sbjct: 87  CSYCGLMDDHYSQHCPRTMRCSHCNDSGHY 116

>CAGL0J06094g Chr10 (577719..581045) [3327 bp, 1108 aa] {ON} highly
           similar to uniprot|P53893 Saccharomyces cerevisiae
           YNL163c translation elongation factor eEF4
          Length = 1108

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 143 TRIHSIWVHRSSPSYLYYK-SELIFLTILTPLNAFILLTISILMIRCLFNQIFNGRSQIE 201
           T +   W  +  P  +  K   LI    LTP+ A+I L  +I  +  +    F G  Q++
Sbjct: 139 TVLRQCWTEKLKPVLVLNKIDRLITELQLTPMEAYIHLNKTIEQVNSVIGSFFAGERQLD 198

Query: 202 --SWEMDRLETLA 212
             SW  +RLET A
Sbjct: 199 DLSWR-ERLETNA 210

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 18/40 (45%)

Query: 88  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127
           P R    K   Q V   DH+C W  N VG  N   +I FL
Sbjct: 413 PVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFL 452

>KLTH0E15818g Chr5 complement(1404334..1405650) [1317 bp, 438 aa]
           {ON} weakly similar to uniprot|P38277 Saccharomyces
           cerevisiae YBR138C Cytoplasmic protein of unknown
           function potentially phosphorylated by Cdc28p
          Length = 438

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 306 LNDIIL-CLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLSRSE 357
           L+D +L  LP PP   KH N+T  H + VQ+   +  + I I  P+++ S +E
Sbjct: 104 LDDQVLTSLPIPPPKEKHYNATESHVNEVQMRIHKDNRRISI-APKRQHSEAE 155

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 7/42 (16%)

Query: 277 LWLYPFSGPQDDGLHFQK-------NEESMIEDPNSLNDIIL 311
           LW Y F   +DDG HF K       N+ S +  PN   DI +
Sbjct: 479 LWSYMFERKRDDGYHFTKKQYYSLINDSSYLRKPNFPTDIFV 520

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,587,447
Number of extensions: 1770624
Number of successful extensions: 5070
Number of sequences better than 10.0: 134
Number of HSP's gapped: 5116
Number of HSP's successfully gapped: 134
Length of query: 376
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 265
Effective length of database: 40,753,473
Effective search space: 10799670345
Effective search space used: 10799670345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 66 (30.0 bits)