Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E02475g6.29ON1493149372480.0
YOL004W (SIN3)6.29ON1536129335160.0
KAFR0A051206.29ON1479130334480.0
NCAS0D021306.29ON1434124534150.0
KNAG0F029206.29ON1492127234130.0
TPHA0J004006.29ON1512140133990.0
ACL004W6.29ON1377131633340.0
KLTH0C10956g6.29ON1433134932370.0
ZYRO0C07524g6.29ON1670121432000.0
TDEL0G044006.29ON1490114731350.0
Kpol_1037.226.29ON1496118531240.0
Skud_15.1586.29ON155596328510.0
Suva_15.1716.29ON156195128390.0
SAKL0E01540g6.29ON141593027360.0
NDAI0C026606.29ON165785427040.0
Ecym_30336.29ON147499226860.0
TBLA0E031606.29ON173987926690.0
KLLA0C06182g6.29ON151993226600.0
Kwal_56.224626.29ON154194326200.0
Smik_15.1666.29ON15662647142e-75
CAGL0J11594g6.29ON9373275979e-63
TPHA0G026102.389ON32257754.5
KAFR0H016008.473ON107950755.6
YFR025C (HIS2)1.351ON33546736.4
KAFR0A04880na 1ON344122736.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E02475g
         (1493 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  2796   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1358   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1332   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1320   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1319   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1313   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1288   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1251   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1237   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1212   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1207   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1102   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1098   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1058   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1046   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1039   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1032   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1029   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1013   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...   279   2e-75
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   234   9e-63
TPHA0G02610 Chr7 complement(545411..546379) [969 bp, 322 aa] {ON...    33   4.5  
KAFR0H01600 Chr8 (296523..299762) [3240 bp, 1079 aa] {ON} Anc_8....    33   5.6  
YFR025C Chr6 complement(203743..204750) [1008 bp, 335 aa] {ON}  ...    33   6.4  
KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {O...    33   6.8  

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 2796 bits (7248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1372/1493 (91%), Positives = 1372/1493 (91%)

Query: 1    MSNQQGSVNHAIGSGAAETVNVTQNATSNVGINDNQKIDGNAEXXXXXXXXXXXXXXXER 60
            MSNQQGSVNHAIGSGAAETVNVTQNATSNVGINDNQKIDGNAE               ER
Sbjct: 1    MSNQQGSVNHAIGSGAAETVNVTQNATSNVGINDNQKIDGNAESSNSINNTSNNNNNNER 60

Query: 61   IILPSFSSLKTEDNRIDTSMNPIGPKSITTSSSTPASVGFSVASLDNPLPPATKKPEIKL 120
            IILPSFSSLKTEDNRIDTSMNPIGPKSITTSSSTPASVGFSVASLDNPLPPATKKPEIKL
Sbjct: 61   IILPSFSSLKTEDNRIDTSMNPIGPKSITTSSSTPASVGFSVASLDNPLPPATKKPEIKL 120

Query: 121  HPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSTGASETSTTQSPLVSGPAQTQG 180
            HP                                  GSTGASETSTTQSPLVSGPAQTQG
Sbjct: 121  HPLPQQQQPRIYTQQQPQQQQILQQDQQEILQNQRQGSTGASETSTTQSPLVSGPAQTQG 180

Query: 181  DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240
            DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK
Sbjct: 181  DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

Query: 241  GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQKSPSPSDXXXXXX 300
            GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQKSPSPSD      
Sbjct: 241  GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQKSPSPSDIQTNNQ 300

Query: 301  XXXXXXXEAQLQSQATPIPTQHDVGQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIY 360
                   EAQLQSQATPIPTQHDVGQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIY
Sbjct: 301  QTQAIAQEAQLQSQATPIPTQHDVGQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIY 360

Query: 361  KQFLEILQTYQREQKPIHEVYAQVTILFQNAXXXXXXXXXXXXXSSASGSEETXXXXXXX 420
            KQFLEILQTYQREQKPIHEVYAQVTILFQNA             SSASGSEET       
Sbjct: 361  KQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKKFLPDSSASGSEETQVQQQQH 420

Query: 421  XXSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSYXXXXXXXXXXXLPPIGSFSPPT 480
              SLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSY           LPPIGSFSPPT
Sbjct: 421  YQSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSYNTQQNQHQQQNLPPIGSFSPPT 480

Query: 481  NGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLS 540
            NGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLS
Sbjct: 481  NGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLS 540

Query: 541  QNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPSELVVRPEIDLD 600
            QNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPSELVVRPEIDLD
Sbjct: 541  QNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPSELVVRPEIDLD 600

Query: 601  PSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDEL 660
            PSL            NSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDEL
Sbjct: 601  PSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDEL 660

Query: 661  VDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTD 720
            VDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTD
Sbjct: 661  VDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTD 720

Query: 721  TFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIE 780
            TFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIE
Sbjct: 721  TFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIE 780

Query: 781  SNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA 840
            SNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA
Sbjct: 781  SNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA 840

Query: 841  LHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKL 900
            LHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKL
Sbjct: 841  LHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKL 900

Query: 901  LTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLY 960
            LTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLY
Sbjct: 901  LTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLY 960

Query: 961  SNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXXXXMDQIAEEIGE 1020
            SNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGF              MDQIAEEIGE
Sbjct: 961  SNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKGSGKMDQIAEEIGE 1020

Query: 1021 TEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSG 1080
            TEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSG
Sbjct: 1021 TEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSG 1080

Query: 1081 SLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQIND 1140
            SLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQIND
Sbjct: 1081 SLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQIND 1140

Query: 1141 EINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEE 1200
            EINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEE
Sbjct: 1141 EINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEE 1200

Query: 1201 SIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILY 1260
            SIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILY
Sbjct: 1201 SIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILY 1260

Query: 1261 RIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNP 1320
            RIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNP
Sbjct: 1261 RIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNP 1320

Query: 1321 TEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGG 1380
            TEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGG
Sbjct: 1321 TEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGG 1380

Query: 1381 SSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSNDDVNEKFNYILANGT 1440
            SSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSNDDVNEKFNYILANGT
Sbjct: 1381 SSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSNDDVNEKFNYILANGT 1440

Query: 1441 IDGYVRQSAAVVQETEKTYNDDSGRNTSSIKSIIGSATERTEKPLINGSPIID 1493
            IDGYVRQSAAVVQETEKTYNDDSGRNTSSIKSIIGSATERTEKPLINGSPIID
Sbjct: 1441 IDGYVRQSAAVVQETEKTYNDDSGRNTSSIKSIIGSATERTEKPLINGSPIID 1493

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1358 bits (3516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/1293 (54%), Positives = 879/1293 (67%), Gaps = 108/1293 (8%)

Query: 185  YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244
            YRPLNVKDALSYLEQVKFQF +RPDIYNLFLDIMKDFKSQ IDTPGVIERVS+LF+GYP 
Sbjct: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275

Query: 245  LIQGFNTFLPQGYRIECSNNPNDPIKVTTPM------------GSSTT---VLNTAPQ-- 287
            LIQGFNTFLPQGYRIECS+NP+DPI+VTTPM            G  TT    L + P+  
Sbjct: 276  LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESD 335

Query: 288  ----KSPS-----PSDXXXXXXXXXXXXXEAQLQS-------QATPIPTQHDVGQNFG-- 329
                + PS     PS                 L +       Q   +P    + Q+    
Sbjct: 336  GNGVQQPSNVPMVPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLV 395

Query: 330  ---SAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTI 386
                AKK  DVEFSQAI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT 
Sbjct: 396  PQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 455

Query: 387  LFQNAXXXXXXXXXXXXXSSASGSEETXXXXXXXXXSLSDKMGGNAEAANYAASG----- 441
            LFQNA             SSAS +++              +M   A+A   A +      
Sbjct: 456  LFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQAQAQAQAQAQVEQQK 515

Query: 442  -----MNAQTGYY-EPVKGGVSYXXXXXXXXXXXLPPIGSFSPPTNGPFVDQTQQSANPE 495
                 +   +GYY  P   G+             LPPIGSFSPPTNG  V +  Q     
Sbjct: 516  QQQQFLYPASGYYGHPSNRGIP---------QQNLPPIGSFSPPTNGSTVHEAYQDQQHM 566

Query: 496  TQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVSNLR 555
                 M LPS++ +   +  Q I                          +N++ P+S+LR
Sbjct: 567  QPPHFMPLPSIVQHGPNMVHQGI--------------------------ANENPPLSDLR 600

Query: 556  TTVVEQNYHPETIYQQQGNAQQ--HMVDGGYVGTPSELVVRPEIDLDPSLXXXXXXXXXX 613
            T++ EQ Y P +I  QQ + Q    + +  Y   P    VRPEIDLDPS+          
Sbjct: 601  TSLTEQ-YAPSSIQHQQQHPQSISPIANTQYGDIP----VRPEIDLDPSIVPVVPEPTEP 655

Query: 614  XXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKE 673
              N+++L EE  FFE+ K+ IGNK +Y EFLKILNL+S D+L +D+LV+KV++Y+G+NKE
Sbjct: 656  IENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKE 715

Query: 674  LFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCW 733
            LF WFK FVGYQ+K K IENIVHEKH+LDLDLCEA+GPSYK+LPK+DTFMPCSGRDDMCW
Sbjct: 716  LFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCW 775

Query: 734  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIA 793
            EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ LETI 
Sbjct: 776  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIV 835

Query: 794  NKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIIL 853
            NKI NMT+ EKA F+LPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALH +PA++ P++L
Sbjct: 836  NKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVL 895

Query: 854  RRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGI 913
            +RLKQKDEEWRRAQREWNK+WR+LEQKV+FKSLDHLGLTFKQADKKLLTTKQLISEI+ I
Sbjct: 896  KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSI 955

Query: 914  KVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLR 973
            KVDQ +K+IHWLTPKPK+QLD+DFPD +I +DI+ L   F  +T  YSNPDKER+KD+L+
Sbjct: 956  KVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLK 1015

Query: 974  VFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXXXXMDQIAEEIGETEQDTSSSKKRPF 1033
             F+S FFSI  +++ ++L                      ++E  G  +  + +S+KRP+
Sbjct: 1016 YFISLFFSISFEKIEESL----------------YSHKQNVSESSGSDDGSSIASRKRPY 1059

Query: 1034 DNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGD 1093
              ++++ DILH+++ QK K + + DG      +   +      E+     E +  WL G+
Sbjct: 1060 QQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSEPPEEEPNTIEEEELIDEEAKNPWLTGN 1119

Query: 1094 VVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTT 1153
            +V+ AN +  + NR+I+NLFANTNIYIFFRH  T+YERL E+KQ+N+ + KEI +R   T
Sbjct: 1120 LVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVT 1179

Query: 1154 FAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKL 1213
            FAKDL L+S+QLSE+GLDF   DAY+Q+L LS+RLI GD+EHQWFEES+RQAYNN+AFKL
Sbjct: 1180 FAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKL 1239

Query: 1214 YTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTEN 1273
            YTIDKV QS VKHAHTL++D+KT+EIM LF   RN + T+ KDQI+YR+Q RSHMS+TEN
Sbjct: 1240 YTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTEN 1299

Query: 1274 MFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPF 1333
            MFRIE+ +   H SIQYIALDDLTLK  K+ E+ W YYVTSY+L +PTEG+PHE L++PF
Sbjct: 1300 MFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPF 1359

Query: 1334 LEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKY 1393
            LE++IEF Q+      +   +S  GIS S L I I    Y L ++ GS DV++R    KY
Sbjct: 1360 LERLIEFGQDIDGTEVDEE-FSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKY 1418

Query: 1394 PIVASDESRAANISEKTQEIRKVLSHYDGNSND 1426
            P +A+D ++   +S+K + I K L    G  N+
Sbjct: 1419 PTIANDNTQKGMVSQKKELISKFLDCAVGLRNN 1451

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1332 bits (3448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/1303 (54%), Positives = 879/1303 (67%), Gaps = 136/1303 (10%)

Query: 181  DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240
            D  SYRPLNVKDALSYLEQVK QF++RPDIYN FLDIMKDFKSQTIDTPGVIERVS+LF+
Sbjct: 206  DDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFR 265

Query: 241  GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQKSPSPSDXXXXXX 300
            GYP+LIQGFNTFLP GYRI+C +NPNDPIKVTTP+GSST    T   +  + +       
Sbjct: 266  GYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQAL 325

Query: 301  XXXXXXXEAQLQSQATPIPTQHDVGQNFGSA------------KKPADVEFSQAITYVNK 348
                   +AQ+     PI +  +   N  +A            KKPADVEFSQAI YVNK
Sbjct: 326  SQNNMMQQAQI-----PIGSISN-NANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNK 379

Query: 349  IKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAXXXXXXXXXXXXXSSAS 408
            IK RFADQPDIYK FLEILQTYQREQKPI+EVYAQVTILFQNA             SS  
Sbjct: 380  IKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKFLPDSSKE 439

Query: 409  GSEETXXXXXXXXXSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSYXXXXXXXXXX 468
                             ++  G+      A   M AQ                       
Sbjct: 440  QQYTGQLPQQIPNQEQLEEFSGSYARPPNAPLDMVAQQS--------------------- 478

Query: 469  XLPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISD 528
             LPPIGSFSPP N   +    QS  P     +M+LPSM+              H ++I D
Sbjct: 479  -LPPIGSFSPPANTG-ISMHDQSQRPH----MMALPSMLQ-------------HEQII-D 518

Query: 529  SHDHNSQQQVLSQNIHSNDDIPVSNLRTT------VVEQNYHPETIYQQQGNAQQHMVDG 582
             ++H  +  V +Q I SND+IPVS++R        V +   +P     +   A Q  +  
Sbjct: 519  MNNH-PKPAVSTQGI-SNDEIPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQ 576

Query: 583  G-------------------------YVGTPSELVVRPEIDLDPSLXXXXXXXXXXXXNS 617
                                      YV  P    VRPEIDLDPS+            ++
Sbjct: 577  QQEIQQQQLMLQQQQEQELLEQQQQQYVEAP----VRPEIDLDPSIVPVVPEPTEPIESN 632

Query: 618  LNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDW 677
              L+EET+FF++ KK I NKQIY EFLK+LNLFS DL++VD+LV+KVEYYIG++KELF+W
Sbjct: 633  FTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEW 692

Query: 678  FKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLN 737
            F+ FVGYQ  PK IENIVHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRDDMCWEVLN
Sbjct: 693  FRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLN 752

Query: 738  DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIA 797
            DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLE I NKI+
Sbjct: 753  DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKIS 812

Query: 798  NMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLK 857
            NM++ EK  F+L PGLGHTS+TIYKKVIRKVYDKERGFEIIDALH +PAI+ PI+L+RLK
Sbjct: 813  NMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLK 872

Query: 858  QKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQ 917
            QKDEEWRRAQREWNK+WR+LEQKVYFKSLDHLGLTFKQADKKLLT KQLISEI+ IKVDQ
Sbjct: 873  QKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQ 932

Query: 918  NSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVS 977
            N+KRIHWLTPKPK+QL++D  D++ILFDI++L   F  +++ YS  DKER+ D L+ F+S
Sbjct: 933  NNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFIS 992

Query: 978  QFFSIPLKEVSDALERRGFXXXXXXXXXXXXXXMDQIAEEIGETE--QDTSSSKKRPF-D 1034
             FFS+PL E+++AL++R                    +E++ ++     T + KKR   D
Sbjct: 993  LFFSVPLNEINNALDKRNNQKN---------------SEKVTDSALPDGTENQKKRSIHD 1037

Query: 1035 NDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGS---LSEH------ 1085
             +L+MSDILH+TK QK K++    GS S  E+     N+ TI D  S   L+E       
Sbjct: 1038 IELSMSDILHRTKYQKMKLSNR--GSDSQEEN-----NIDTIIDEESDERLAEEADLIRQ 1090

Query: 1086 --RKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEIN 1143
              ++ WL+GD++D  N +  + +R  +NLFANTNIY+F RH  TLYERL E+K++N E+ 
Sbjct: 1091 DAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVT 1150

Query: 1144 KEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIR 1203
            KEI +R+   FA+DLGL+STQL  +GLDF   D+Y++LL LSKRLIE DIEHQWFEES+R
Sbjct: 1151 KEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLR 1210

Query: 1204 QAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQ 1263
            QAYNNRAFKLYT+DKVVQ+ VKH HTL++D KT+E+M LFE  R ++ T+ KDQILYR+Q
Sbjct: 1211 QAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQ 1270

Query: 1264 CRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEG 1323
             RSHMS+TE MFRIEY ++ R+  IQYIALDDLTLK   + EE W YYVTSYSL +PTEG
Sbjct: 1271 ARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEG 1330

Query: 1324 VPHENLEVPFLEKVIEFDQ----EYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQG 1379
            + HE+L++PFL+K++EFDQ       ++N +N  YS  G+S S   I I    Y L +Q 
Sbjct: 1331 IDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSPEGVSNSMYKIKIHPGNYALDIQT 1390

Query: 1380 GSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDG 1422
            GS D++SR ++ KYP+  +++  +  +++K   +   L   +G
Sbjct: 1391 GSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNG 1433

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1320 bits (3415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1245 (55%), Positives = 862/1245 (69%), Gaps = 69/1245 (5%)

Query: 183  MSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGY 242
            ++YRPLNVKDALSYLEQVK+QF  RPDIYN FLDIMKDFKSQ+IDTPGVIERVS+LF+GY
Sbjct: 205  LAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGY 264

Query: 243  PNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAP-QKSPSPSDXXXXXXX 301
            P L+QGFNTFLPQGYRIEC+ +P+ PI+VTTPMG+ST  L+  P  ++PS S+       
Sbjct: 265  PMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTST--LSGGPAMEAPSSSESNLQQQQ 322

Query: 302  XXXXXXEAQLQSQATPIPTQHDVGQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYK 361
                     L +            Q    + K A+VEFSQAI YVNKIK RFADQPDIYK
Sbjct: 323  HHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYK 382

Query: 362  QFLEILQTYQREQKPIHEVYAQVTILFQNAXXXXXXXXXXXXXSSASGSEETXXXXXXXX 421
            +FLEILQTYQREQKPI+EVY+QVT+LFQ+A             SS + S           
Sbjct: 383  RFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTS----------T 432

Query: 422  XSLSDKMGGNAEAANYAASGMNAQTGY---YEPVKGGVSYXXXXXXXXXXXLPPIGSFSP 478
              L    G    AA    +  + Q GY   Y P   G              LPPIGSF+P
Sbjct: 433  SELPQNAGIQQRAAIPTPNPKHQQYGYPNNYYPNGTGTQ----------QNLPPIGSFAP 482

Query: 479  PTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQV 538
            P NG     +++ A      G   LPSM+ N +A++    +Q    L+            
Sbjct: 483  P-NG---TASREYAPGNQFVGPGGLPSMIPNDQALQ----QQQQPGLVHG---------- 524

Query: 539  LSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTP----SELVVR 594
                 ++N+ IPVSNLR+ + +Q Y      Q Q    Q  ++           +E  +R
Sbjct: 525  -----YTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIR 579

Query: 595  PEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDL 654
            PEIDLDPS+             +++L+EETNFFE+ KK IG KQ+Y EFLKILNL+S DL
Sbjct: 580  PEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDL 639

Query: 655  LTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYK 714
            LT DEL  KVEYY+G+N+ELF WFK FVG+Q+KP  IENIVHEKHKLDLDLCEA GPSYK
Sbjct: 640  LTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYK 699

Query: 715  KLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE 774
            KLPKTDTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHE
Sbjct: 700  KLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHE 759

Query: 775  YDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERG 834
            YD+ IESNLRTIQTLETIANKI NMT+ EK  F+LPPGLGHTS TIYKKVIRKVYDK+RG
Sbjct: 760  YDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRG 819

Query: 835  FEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFK 894
            FEIID LH  PA++VP++L+RLKQKDEEWRRAQREWNK+WR+LEQKVY+KSLDHLGLTFK
Sbjct: 820  FEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK 879

Query: 895  QADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFT 954
            QADKKLLTTKQL+SEI+ IKVDQ +KRIHWLTPKPK+QL++ F D DI  DI+ L  VF 
Sbjct: 880  QADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFI 939

Query: 955  INTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDAL-ERRGFXXXXXXXXXXXXXXMDQ 1013
             +++ YSNP+KER+KD LRVFVS FFSIPL +V++AL +R  +              +D 
Sbjct: 940  NHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKESSRNIDS 999

Query: 1014 IAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQK----TKMNKEMDGSKSPSEDLGT 1069
                   +    S+SKKRP + D+ ++DIL K K QK     K + E +  +   E++  
Sbjct: 1000 TT----SSSSSGSNSKKRPLNIDIPLADILRKHKYQKIRKQAKESNEENAQEEDDENIVG 1055

Query: 1070 DRNVGTIEDSGS---LSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLV 1126
            D N    E   +   L E ++ WL+G+++++A+    + NR ++N+FANTNIY+FFR   
Sbjct: 1056 DSNEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWT 1115

Query: 1127 TLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSK 1186
             +YERL E+KQIN+++ KE+ SRR++ FAKDL LISTQL ++GLDF   ++YQ+LL LSK
Sbjct: 1116 VIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSK 1175

Query: 1187 RLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQ 1246
            RLI+ DIEHQWFEES+RQA+NN+AFKLYT+DKV+QS VKHAHT++ D KTSEIM+LFE  
Sbjct: 1176 RLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKD 1235

Query: 1247 RNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEE 1306
            R  + T+ K+QILYR+Q R+HM++TENMFRIE+  EK H  IQYIAL+DLT+K  KS E+
Sbjct: 1236 RLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEK 1295

Query: 1307 AWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHI 1366
             W YYVTSYSL +PTEGVP + L++PFLEK +E + +   DN +    S  G+S S L I
Sbjct: 1296 NWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEGDNKS----SPEGVSSSKLKI 1351

Query: 1367 DIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQ 1411
             ID + Y L ++ GS D++SR ++  YP  + +  +  +I + T+
Sbjct: 1352 KIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKSIDQMTK 1396

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1319 bits (3413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/1272 (54%), Positives = 851/1272 (66%), Gaps = 81/1272 (6%)

Query: 185  YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244
            YRPLNVKDALSYLEQVK QF++RP IYN FLDIMKDFKSQ IDTPGVIERVS+LFKG+P 
Sbjct: 218  YRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPA 277

Query: 245  LIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQKSPSPSDXXXXXXXXXX 304
            LIQGFNTFLPQGYRIECS+NPN+PIKVTTPMG    V  +       P+           
Sbjct: 278  LIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQQPAIGQLPTTQSPI 337

Query: 305  XXXEAQLQSQATPIPTQHDVGQNFGSA---------KKPADVEFSQAITYVNKIKTRFAD 355
                   QS    +P+          +         KK  DVEFSQAI+YVNKIK RF+D
Sbjct: 338  QASLPPPQSAHLHLPSTVAAATTVQQSANVHAENEPKKANDVEFSQAISYVNKIKNRFSD 397

Query: 356  QPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAXXXXXXXXXXXXXSSASGSEETXX 415
            QPDIYK FLEILQTYQREQKPI+EVYAQVT+LF NA             SSAS  ++   
Sbjct: 398  QPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKFLPDSSASNEQQPKQ 457

Query: 416  XXXXXXXSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSYXXXXXXXXXXXLPPIGS 475
                               A+ A   M   TG Y P +                LPPIGS
Sbjct: 458  SPYSPQV---------YSGADMARGYMYNNTGVYYPPQ---------VNQPQSNLPPIGS 499

Query: 476  FSPPTNGPFVDQTQQSANP--ETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHN 533
            FSPP NG  V  T  +A P  + Q  V  +P+M     A  EQ  + A S + +D     
Sbjct: 500  FSPPANG--VAPTTGTAIPHADEQHVVAGVPAM-----APHEQ--QHAPSMINNDG---- 546

Query: 534  SQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGT------ 587
                +   N+     +P  N    +   +Y  +   Q Q   +                 
Sbjct: 547  ----IQISNMRGGGTVPALNQYGMISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQYG 602

Query: 588  PSELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKIL 647
              ++ VRPEIDLDPS+            N+L+L EET+FFE+VKK+IGN+QIY EFLK+L
Sbjct: 603  SGDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVL 662

Query: 648  NLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCE 707
            NLFS DL+ VDELV KVE Y+    ELF+WFK FVGYQDKPK IEN++HEKH+LDLDLCE
Sbjct: 663  NLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCE 722

Query: 708  AYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 767
            AYGPSYKKLPK+DTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 723  AYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 782

Query: 768  IEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRK 827
            IEEERHEYD+YIESNLRTIQTLETIA+KIANMT+ EK  F+LPPGLGHTS+TIYKK+IRK
Sbjct: 783  IEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRK 842

Query: 828  VYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLD 887
            VYDKERGFEIID LH +PAI+VPI+L+RLKQKDEEWRRAQREWNK+WR+LEQKVYFKSLD
Sbjct: 843  VYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 902

Query: 888  HLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDII 947
            HLGLTFKQADKKLLTTKQLISEI+ IKVDQN+KR+HWLTPKPK QLDY F D DI+FDI+
Sbjct: 903  HLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIV 962

Query: 948  ALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXX 1007
             L  VF  + + YSNPDKER+KD+ RVF+S FF IP   +S AL+ +             
Sbjct: 963  GLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTK------------- 1009

Query: 1008 XXXMDQIAEEIGETE---QDTSSSKKRPF-DNDLNMSDILHKTKQQKTKMNKEMDGSKSP 1063
                   ++E   T+   +    SKKRP  D +L++SDILH+ K QK K  + +  S+  
Sbjct: 1010 -------SDEGKSTDTKFEKADDSKKRPRPDVELSLSDILHRAKYQKLKNGEGLGMSEDD 1062

Query: 1064 SEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFR 1123
             E+          E + S     K WLVGD+V+ AN    + +R +YNLF NTN+YIF R
Sbjct: 1063 DEEKLAKEAEEMSEKNAS-----KPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIR 1117

Query: 1124 HLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLT 1183
            H  TLY RL E+KQ+++ + KEI +R+V  FA+DL L+STQL ++GLDF+  +AYQ+ L 
Sbjct: 1118 HWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLK 1177

Query: 1184 LSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLF 1243
            LSKRLI  ++EHQWFEES+RQAYNN+AFKLYT+DKVV S VKHAHTL++D+K+SE+M LF
Sbjct: 1178 LSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELF 1237

Query: 1244 ENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKS 1303
            E  R  + T  KDQILYR+  RSHMSSTENMFR++Y ++ RH SIQYI LDD+TL+ AK 
Sbjct: 1238 EKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKD 1297

Query: 1304 PEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSN 1363
              E WNYY+TSY+L +PTEG+  + L VPFLE+++EF+ +       +  Y+  G S S 
Sbjct: 1298 DNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSK 1357

Query: 1364 LHIDIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGN 1423
            L I+ID + Y LI+Q GS D++SR++I +YPI    +     + ++ +  +K L    G 
Sbjct: 1358 LKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGW 1417

Query: 1424 SNDDVNEKFNYI 1435
              D  ++  N +
Sbjct: 1418 KKDLSDDVINTV 1429

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1313 bits (3399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/1401 (51%), Positives = 911/1401 (65%), Gaps = 162/1401 (11%)

Query: 165  STTQSPLVSGPAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQ 224
            S T     S     + D   YRPLNVKDAL+YLEQVK QF +RPDIYN FLDIMKDFKSQ
Sbjct: 122  SATAGTTASANDSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQ 181

Query: 225  TIDTPGVIERVSSLFKGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTT----------- 273
            +IDTPGVIERVS+LF+GYP+LIQGFNTFLPQGY IEC+NNPNDPIKVTT           
Sbjct: 182  SIDTPGVIERVSTLFRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETIPYAK 241

Query: 274  PMGSSTT--------------------------------------------VLNTAPQKS 289
            P+ S+ T                                            + N A    
Sbjct: 242  PIPSAATNTNVPGPTTSTSPPTAATTTGTTTPVAANTTAIPNITRNKETNAIENVATAAQ 301

Query: 290  PSPSDXXXXXXXXXXXXXEAQLQSQA-TPI-PTQHDVGQN-FGSAKKPADVEFSQAITYV 346
            PS                E+ +QS A  PI P  H++ Q+     +KPADVEFSQA++YV
Sbjct: 302  PSLLPNLGTPSHTEVTKSESVIQSSANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYV 361

Query: 347  NKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAXXXXXXXXXXXXXSS 406
            NKIK RF D+PDIYK FLEILQTYQ+EQKPIHEVY+QVTILFQNA             ++
Sbjct: 362  NKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKFLPDNN 421

Query: 407  ASGSEETXXXXXXXXXSLSDKMGGNAEAANYAASGMNAQTGYYE---PVKGGVSYXXXXX 463
             S   ET                 N     +    +     YY+   P     +      
Sbjct: 422  NSAGAETNQNIQANAMQYQQLHQNNVAIPQH----IYENNTYYQNNVPTAAAAAANAAGN 477

Query: 464  XXXXXXLPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMN-NAEAVKEQAI---- 518
                  LPP+G+F PP+        + +        +M + S+M+   + ++ Q      
Sbjct: 478  VVTIQSLPPLGNFLPPS-------NKNNNTTAVNNNLMGISSIMHPKVDHIQSQQYIADQ 530

Query: 519  KQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVSNLRTT----------VVEQNYHPETI 568
            KQA++          +QQQ  +Q   +N+ + +S LR +          +   NY P  +
Sbjct: 531  KQAYTP---------AQQQSTTQ--LTNEAMQISELRGSPMMDGQTARNLANVNYSPAEL 579

Query: 569  YQQQGNAQQHM-----------------------VDGGYVGTPSELVVRPEIDLDPSLXX 605
             Q Q  AQQH+                       +DGGY   P ++ VRPEIDLDPS+  
Sbjct: 580  NQLQ--AQQHISIQQQQQQQQQQQQQLQMQMQMQMDGGY---PQDISVRPEIDLDPSIVP 634

Query: 606  XXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVE 665
                      +SL+L+EETNFF++ KK I NKQIY EFLKILNL+S ++L V+ELV+KV+
Sbjct: 635  VIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQ 694

Query: 666  YYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPC 725
            YY+G+NKELFDWFK FVGYQDKPK IENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPC
Sbjct: 695  YYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPC 754

Query: 726  SGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRT 785
            SGRD+MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRT
Sbjct: 755  SGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRT 814

Query: 786  IQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYP 845
            IQTLETIA+KIANMT+ E+A F+LP GLGHTS+TIY+KVIRKVY KERGFE+IDALH YP
Sbjct: 815  IQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYP 874

Query: 846  AISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQ 905
            A++VPIIL+RLKQKDEEWRRAQREWNK+WR+L+QKVY+KSLDHLGLTFKQADKKLLTTKQ
Sbjct: 875  AVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQ 934

Query: 906  LISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDK 965
            LISEI+ IKVDQ +K++HWLTPKPK+QLDY   D  IL+DI+ L  VF  +T+ YSNPDK
Sbjct: 935  LISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDK 994

Query: 966  ERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXXXXMDQIAEEIGETEQDT 1025
            ER++D L+ F+S FF IPL ++  A++ R                +D    +  E+  D+
Sbjct: 995  ERLRDFLQSFISLFFFIPLADIKAAIKIRS--------------PLDDTKTDSEESSGDS 1040

Query: 1026 SS-SKKRPF-DNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLS 1083
                KKR   D+D++  DIL K K QK K    +D +++ S D+ +  +V   +D     
Sbjct: 1041 DKFPKKRSIEDDDISFHDILDKVKYQKVKQG--LDKNETFSNDISSATSVD--DDELIRQ 1096

Query: 1084 EHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEIN 1143
            E +K WL+G +VD AN    + NR+ YN+F NTNIY+F RHL+TLYERL+E KQ+N E+ 
Sbjct: 1097 EAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVT 1156

Query: 1144 KEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIR 1203
            +EIK+R +  FAKDL L+STQL  +GLDF  +D+Y+QLL LS RLIEG++EH WFEES+R
Sbjct: 1157 EEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLR 1216

Query: 1204 QAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQ 1263
            QA+ N+AFKLYTIDKV QS VKHAHT++SD+KT+EIM+L E  R+   T++KDQILYR+Q
Sbjct: 1217 QAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQ 1276

Query: 1264 CRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEG 1323
             RSHMS+T+NMFRIE+ +   + SIQYI +DDLTL   K+ EE W YY+TSY+LS+PTEG
Sbjct: 1277 ARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEG 1336

Query: 1324 VPHENLEVPFLEKVIEFDQEYSKDNGN-NSTYSLAGISKSNLHIDIDREKYNLILQGGSS 1382
            VP E +++PFLEK++E ++ Y+++    N  YS  G+S+S+L I I  E Y L ++ GS 
Sbjct: 1337 VPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKGVSQSDLKIKISPENYALEIEPGSF 1396

Query: 1383 DVYSRATIQKYPI-VASDESRAANISEKTQEIRKVLSHYDGN-------SNDDVNE---K 1431
            D +SR ++ KYPI V SD+ +    ++K   I +V +  +G        S D++N    K
Sbjct: 1397 DTFSRLSMNKYPIDVTSDDYK----NKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLK 1452

Query: 1432 FNYILANGTIDGYVRQSAAVV 1452
            +++I   G++  YV    A +
Sbjct: 1453 YSHIKKYGSLKNYVVPVVAAI 1473

 Score =  173 bits (438), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 133/249 (53%), Gaps = 58/249 (23%)

Query: 61  IILPSFSSLKTEDNRIDTSMNPIGPKSITTSSSTP-----------ASVGFSVASLDNPL 109
           ++LPSFS L    +    + N     S  T++ TP            S   SVAS DNPL
Sbjct: 39  VVLPSFSKLNNNSSNGSVNSNANASTSSNTTTQTPLHHFPNSNANVNSNSLSVASFDNPL 98

Query: 110 PPATK-KPEIKLHPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSTGASETSTTQ 168
           P  T+  P I                                        T     +TT 
Sbjct: 99  PVKTETTPAI-------------------------------------SAETSIPNVNTTY 121

Query: 169 SPLVSGPAQT----QGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQ 224
           S      A      + D   YRPLNVKDAL+YLEQVK QF +RPDIYN FLDIMKDFKSQ
Sbjct: 122 SATAGTTASANDSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQ 181

Query: 225 TIDTPGVIERVSSLFKGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNT 284
           +IDTPGVIERVS+LF+GYP+LIQGFNTFLPQGY IEC+NNPNDPIKVTTP+GS T     
Sbjct: 182 SIDTPGVIERVSTLFRGYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETI---- 237

Query: 285 APQKSPSPS 293
            P   P PS
Sbjct: 238 -PYAKPIPS 245

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1288 bits (3334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/1316 (52%), Positives = 866/1316 (65%), Gaps = 112/1316 (8%)

Query: 175  PAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIER 234
            PAQ   D  +YRPLNVKDALSYLEQVKFQF +RPD+YN FLDIMKDFKSQ IDTPGVIER
Sbjct: 122  PAQ---DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIER 178

Query: 235  VSSLFKGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVL------NTAPQK 288
            VS+LF GYP LIQGFNTFLP GY IEC ++PNDPIKVTTP G+   +       N A   
Sbjct: 179  VSTLFHGYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITGAGGNHAHGA 238

Query: 289  SPSPSDXXXXXXXXXXXXXEAQLQSQATPIPTQHDVGQNFGSAKKPADVEFSQAITYVNK 348
            +  P               E    + ATP  TQ   G      KK  DVEFS AI+YVNK
Sbjct: 239  NTEPRLQSTQNVPTVYRSAEGSPAAIATPATTQEQYGTG---PKKAGDVEFSHAISYVNK 295

Query: 349  IKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAXXXXXXXXXXXXXSSAS 408
            IKTRFA+QPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQNA             SSA 
Sbjct: 296  IKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAP 355

Query: 409  GSEETXXXXXXXXXSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSYXXXXXXXXXX 468
              +               ++ G   A  +     +AQ+G  + + G              
Sbjct: 356  QLQS------------HQQINGAMVAPGFG----HAQSGLQQALPG------TQPLMHQQ 393

Query: 469  XLPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISD 528
             LPP+G+FS P +           +P      MSLPS+           + Q  S     
Sbjct: 394  NLPPLGNFSTPGD----------HHP------MSLPSVQG-----PNVGLSQGQS----- 427

Query: 529  SHDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTP 588
                     +++Q + SN  IPVS+LR         P+  ++   +    + D  Y+   
Sbjct: 428  -------GHIVTQGV-SNQHIPVSDLRGA-------PDASFR--ASEYNQVQDVQYM--- 467

Query: 589  SELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILN 648
             E  VRPEIDLDPSL            + LNL+EE  FF++ KK IGNKQIY EFLKILN
Sbjct: 468  -EPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILN 526

Query: 649  LFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEA 708
            L+S DLL  ++LV+ V +Y+  + ELFDWFK FVGYQ++PK IEN++HEKH+LDLDLCEA
Sbjct: 527  LYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEA 586

Query: 709  YGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 768
             GPSYK+LPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKI
Sbjct: 587  CGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKI 646

Query: 769  EEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKV 828
            EEERHEYD+YIE+NLRTIQTLETIANKIANMT  EKA F+LPPGLGHTS+TIYKKVIRKV
Sbjct: 647  EEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKV 706

Query: 829  YDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDH 888
            YDK+RGFEIIDALH +PAI+VP++L+RLKQKDEEWRRAQREWNK+WR+LEQKV++KSLDH
Sbjct: 707  YDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDH 766

Query: 889  LGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIA 948
            LGLTFKQADKKLLT KQLISEI+ IKVDQ++KRIH LTPK K+QL YDF + ++  DI++
Sbjct: 767  LGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILS 826

Query: 949  LGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXX 1008
            L  VF  N N YS  D ER+KD  + F+S FFS PL E+ + L +R              
Sbjct: 827  LVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTR 886

Query: 1009 XXMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLG 1068
                  ++E  +TE+ ++  + R  D +  + DIL++ KQQK     + D S   SE+  
Sbjct: 887  K-----SKEDPKTEKHSARKRVRD-DTEHLLRDILYRNKQQKVNKGPQNDQS---SEEFE 937

Query: 1069 TDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTL 1128
             + ++   E      E +K WL+G +VD A+    + +R  +N+FANTNIY+FFRHL T+
Sbjct: 938  KESDIE--EKEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTM 995

Query: 1129 YERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRL 1188
            YERL EVK+IN E+ KEI +R+V  FAKDL LISTQL+++GLDF  +DAY++LL LS+ L
Sbjct: 996  YERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSL 1055

Query: 1189 IEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRN 1248
            I G++EHQWFEES+RQAY N+AFKLYTIDKV+Q+ VKHAHT++ D KT EIMLLF+N R 
Sbjct: 1056 ISGELEHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRT 1115

Query: 1249 NTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAW 1308
            +T T+TKDQILYR+Q RS+MS+ ENMFRIEY     HASIQ++A++DLTL   KS  + W
Sbjct: 1116 STSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKW 1175

Query: 1309 NYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDI 1368
             YY+TSYSLS+PTEG+ H+NL  PFLEK+IE D+ Y  D   +  YS  G++ SN+ + I
Sbjct: 1176 QYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDD--GDERYSPEGVASSNMKVKI 1233

Query: 1369 DREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSND-- 1426
            D   Y++ ++ G  D++SR ++ K+P      +R     +K+ E++ VL  +        
Sbjct: 1234 DPLTYSMEVEPGCHDIFSRKSVNKFP------TRVDVKKKKSAELKLVLEGFLNGERGWK 1287

Query: 1427 ---------DVNEKFNYILANGTIDGYVRQSAAVVQETEKTYNDDSGR-NTSSIKS 1472
                     +   +  Y+  NGT+D Y  + +   +    T  D +G  +T+S  S
Sbjct: 1288 RGLTTKRTAEAERRLEYVKNNGTLDDYAEEISTDTKAALSTTTDTAGNVSTASFSS 1343

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1251 bits (3237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/1349 (50%), Positives = 881/1349 (65%), Gaps = 132/1349 (9%)

Query: 181  DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240
            DP SYRPLN KDALSYLEQVKFQF+ RPD+YN FLDIMKD+KSQ IDT GVIER+S+LFK
Sbjct: 139  DP-SYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197

Query: 241  GYPNLIQGFNTFLPQGYRIECSNNPNDP--IKVTTP-----------MGSSTTVLNTAPQ 287
            GYP LIQG NTFLPQGY+IEC+ NPNDP  IKVTTP           M +   ++   P 
Sbjct: 198  GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPS 257

Query: 288  KSPSPSDXXXXXXXXXXXXXEAQLQSQAT--PIPT-------QHDVGQNFGSAKKPA--- 335
              PS                + +L++  T  P+PT       QH+       ++ PA   
Sbjct: 258  LMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNQNLPQHEQQNQQHGSQSPAMPQ 317

Query: 336  ---------------DVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEV 380
                           DVEFS AI+YVNKIKTRFADQP+IYK FLEILQTYQREQKPIHEV
Sbjct: 318  QQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEV 377

Query: 381  YAQVTILFQNAXXXXXXXXXXXXXSSASGSEETXXXXXXXXXSLSDKMGGNAEAANY--- 437
            YAQVT LFQNA             ++A+  ++              +     +  ++   
Sbjct: 378  YAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLLLQQQQQQQQQLQQQQIQQHQSHYQN 437

Query: 438  AASGMNA-QTGYYEPVKGGVSYXXXXXXXXXXXLPPIGSFSPPTNGPFVDQTQQSANPET 496
            A+  ++  Q   ++P    V +           LPP+GSFSPP NG       +  +P+ 
Sbjct: 438  ASQDLDQRQQHTHQPFGNTVPFYQTQQGRPQN-LPPLGSFSPPING-------RENDPQ- 488

Query: 497  QKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVSNLRT 556
                ++LP++   A     Q +    S ++          QV+         +P+S+LR 
Sbjct: 489  ----LNLPAVQPPAMEFASQQVPHHPSHVVP---------QVIPGGT-----LPLSDLRG 530

Query: 557  TVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPSELVVRPEIDLDPSLXXXXXXXXXXXXN 616
              ++ N+ P+ +  Q         D  ++    E   RPEIDLDPSL            N
Sbjct: 531  -AMDGNFAPQPLQSQ---------DVQFI----EPTSRPEIDLDPSLVPVIPEPIKPLEN 576

Query: 617  SLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFD 676
             L L+EET+FF+R KK +GNKQ+Y EFLKILNLFS DL+  +ELVDKVE+Y+G + ELFD
Sbjct: 577  DLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFD 636

Query: 677  WFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVL 736
            WFK FV Y +KPK IEN++HEKH+LDLDLCEA  PSYKKLPK DTFMPCSGRD+MCWEVL
Sbjct: 637  WFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVL 696

Query: 737  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKI 796
            NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIE+NLRTIQ LETIANKI
Sbjct: 697  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKI 756

Query: 797  ANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRL 856
            +NMT  EK  F+LPPGLGHTSMTIYKKVIRKVYDK+RGFEIIDALH  PA+SVPIIL+RL
Sbjct: 757  SNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRL 816

Query: 857  KQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVD 916
            KQKDEEWRRAQREWNK+WR+LEQKV++KSLDHLGLTFKQADKKLLT KQLISEI+ IKVD
Sbjct: 817  KQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVD 876

Query: 917  QNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFV 976
            Q +KRI+  TPKPK+QLDYD  D  +LFDI+ L   F  +++ YSNPDKE++    + F+
Sbjct: 877  QTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFL 936

Query: 977  SQFFSIPLKEVSDALERRGFXXXXXXXXXXXXXXMDQIAEEIGETEQDTSSSKKRPFDND 1036
            S FFSI  +E+ ++                     D ++          S+ +KR ++++
Sbjct: 937  SVFFSISYQEIENS----------------TPADSDAVS---------NSNPRKRLWESE 971

Query: 1037 LNMSDILH-KTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSL-SEHRKQWLVGDV 1094
              + ++L  K K  K +     D S S  ++   +++   IED   +  E +K WL+G++
Sbjct: 972  QPLKELLRSKHKHHKKRDTSAEDDSISDDQN-SPEKSPQEIEDEEVIRQEAKKPWLLGNI 1030

Query: 1095 VDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTF 1154
            +D AN    + NR I+NLFANTN+Y+FFRHL T+Y+RLSEVK +N+E+ +EI SR V  F
Sbjct: 1031 LDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQF 1090

Query: 1155 AKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLY 1214
            AKDL L+STQLS++GLDF   DAY QLLTL KRLI  D++HQWFEES+RQAY N+AFK+Y
Sbjct: 1091 AKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIY 1150

Query: 1215 TIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENM 1274
            T+DKV+QS VKHAH++I+D+K++EIM+LFE  R  T T+TK+QILYR+Q RS+M  TENM
Sbjct: 1151 TVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENM 1210

Query: 1275 FRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFL 1334
            FR+E  ++  H  IQY+A+DDLTLK  +S ++ W+YY+TSY+LS+PTEG+PHE ++VPFL
Sbjct: 1211 FRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFL 1270

Query: 1335 EKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYP 1394
            EK ++ D+E   D G+    S +G S SNL I ++ E Y L ++ GS D+++R  + ++ 
Sbjct: 1271 EKTLQDDEE--ADEGSEER-SPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRF- 1326

Query: 1395 IVASDESRAANISEKTQEIRKVLSHYDGNSN----------DDVNEKFNYILANGTIDGY 1444
             + S E+  +N   K ++ + ++S  DG+            D      NY+  +G  +  
Sbjct: 1327 -LNSSENN-SNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGKHES- 1383

Query: 1445 VRQSAAVVQETEKTYNDDS-GRNTSSIKS 1472
            + ++ A+VQ T    ++ S  +  SS++S
Sbjct: 1384 LNKNPALVQGTRDPRHESSVAKEASSLES 1412

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 50/91 (54%), Gaps = 3/91 (3%)

Query: 167 TQSPLVSGPAQTQGDPMSYRP---LNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKS 223
           +QSP +    +     M  RP   +    A+SY+ ++K +F  +P+IY  FL+I++ ++ 
Sbjct: 310 SQSPAMPQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQR 369

Query: 224 QTIDTPGVIERVSSLFKGYPNLIQGFNTFLP 254
           +      V  +V+SLF+  P+L+  F  FLP
Sbjct: 370 EQKPIHEVYAQVTSLFQNAPDLLDDFKKFLP 400

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1237 bits (3200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1214 (54%), Positives = 822/1214 (67%), Gaps = 122/1214 (10%)

Query: 316  TPIPTQHDVGQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQK 375
             P P Q  +       KK ADVEFSQAI+YVNKIK RF+DQPDIYK FLEILQTYQREQK
Sbjct: 502  VPAPVQPQLADQ---TKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQK 558

Query: 376  PIHEVYAQVTILFQNAXXXXXXXXXXXXXSSASGSEETXXXXXXXXXSLSDKMGGNAEAA 435
            PI+EVYAQVT+LFQNA             SSAS +++               +  + +AA
Sbjct: 559  PINEVYAQVTVLFQNAPDLLDDFKKFLPDSSASAAQQQR--------QQLQPVMQHQQAA 610

Query: 436  NYAASGMNAQTGYY---EPVKGGVSYXXXXXXXXXXXLPPIGSFSPPTNGPFVDQTQQSA 492
              AA+G     GYY   +PV                 LPP+GSFSPP NG       Q  
Sbjct: 611  --AATGY----GYYGENQPV-------------ARQNLPPLGSFSPPPNGTAPRDYYQ-- 649

Query: 493  NPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVS 552
              E  +G M+LP M +    ++ QA K      ++ SH       V++Q + SND IP+S
Sbjct: 650  --EPSQG-MALPPMTH----LETQAAK------VTPSH------YVMTQGM-SNDAIPLS 689

Query: 553  NLRTTVV---------------------------------------EQNYHPETIYQQQG 573
            N+R+  V                                       EQ+  P+TI   Q 
Sbjct: 690  NMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQQLPPQQQEQSLPPQTIPLTQP 749

Query: 574  NAQQHMVDGGYVGTPSELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKS 633
            +      +  YV    ++ VRPEIDLDPS+            +SL+L+EET+FF++ KK 
Sbjct: 750  SQLGPQQEVQYV----DIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDKAKKF 805

Query: 634  IGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIEN 693
            IGNKQ+Y EFLKILNL+S DLL +D LV+KVE+Y+G +KELF WFK FVGYQD+PK IEN
Sbjct: 806  IGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIEN 865

Query: 694  IVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGF 753
            ++HEKH+LDLD+CEA GPSYKKLPK+DTFMPCSGRD+MCWEVLNDEW+GHPVWASEDSGF
Sbjct: 866  VIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGF 925

Query: 754  IAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGL 813
            IAHRKNQYEETLFK+EEERHEYD+YIESNLRTIQTLETIA+KIANMT+ EKA F+LPPGL
Sbjct: 926  IAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGL 985

Query: 814  GHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKI 873
            GHTS+TIYKKVIRKVYDKERGFEIIDALH +PA++VP++L+RLKQKDEEWRRAQREWNK+
Sbjct: 986  GHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKV 1045

Query: 874  WRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQL 933
            WR+LEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEI+ IKVDQ +KRIHWLTPKPK+QL
Sbjct: 1046 WRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQL 1105

Query: 934  DYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALER 993
            DYDFPD +I  DI++L  VF  +T  YSN DKER+KD L+ F+S FFSIP+ EV+D L R
Sbjct: 1106 DYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPVSEVNDGLRR 1165

Query: 994  RGFXXXXXXXXXXXXXXMDQIAEEIGETEQDTS-SSKKRPFDNDLNMSDILHKTKQQKTK 1052
            R                 ++   E  + E  T+ +  KRP + +L + DILH+ K QK K
Sbjct: 1166 RS--------------PSNKEEHEANKKENGTALAHGKRPREIELPLRDILHRNKYQKLK 1211

Query: 1053 MNKE-MDGSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYN 1111
            +  +  +GS   SE+   ++     E+     E +K WL+G++V+ AN +  + NR  +N
Sbjct: 1212 LRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIISNRKSFN 1271

Query: 1112 LFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLD 1171
            LFANT+IY+FFRHL TLYERL EVK I+ E+ +EI SR+V+ FAKDL LIS QL  +GLD
Sbjct: 1272 LFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLD 1331

Query: 1172 FNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLI 1231
            F   DAY+QLL LSKRLIEGDIEHQWFEES+RQAYNNRAFK YT+DKVVQ+ VKHAHT++
Sbjct: 1332 FAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTIL 1391

Query: 1232 SDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYI 1291
            +D K SEIM+LFE  R    T+ KDQILYR+Q RSHMS+TENMFRIE+ R  +H  IQYI
Sbjct: 1392 TDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYI 1451

Query: 1292 ALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNN 1351
            A+DDLTL  AKS E+ W YYVTSYSLS+PTEG+ HE+L+VPFLEK+IE +QEY +DNG +
Sbjct: 1452 AIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGD 1511

Query: 1352 STYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQ 1411
              +S  G+SKS+L I ID E Y L ++ GS DV+SR  + K+P+  + ES    + +K +
Sbjct: 1512 PKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNE 1571

Query: 1412 EIRKVL-------SHYDGNSNDDVNEKFNYILANGTIDGYVRQSAAVVQET-EKTYNDDS 1463
             IR  L        + D  S   V EK N++   GT+ GY  Q   +   T E  ++D  
Sbjct: 1572 LIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKEAPFSDAV 1631

Query: 1464 GRNTSSIKSIIGSA 1477
             R   S     G+A
Sbjct: 1632 ERKADSAAQADGAA 1645

 Score =  189 bits (480), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 84/97 (86%), Positives = 92/97 (94%)

Query: 185 YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244
           YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQ IDTPGVIERVS+LF+GYPN
Sbjct: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336

Query: 245 LIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTV 281
           LIQGFNTFLPQGYRI+CS NP++PIKVTTPMGSST  
Sbjct: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVA 373

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 55/99 (55%), Gaps = 3/99 (3%)

Query: 158 STGASETSTTQSPLVSGPAQTQGDPMSYRPLNVK--DALSYLEQVKFQFHTRPDIYNLFL 215
           S  +S T  TQ P V  P Q Q    + +  +V+   A+SY+ ++K +F  +PDIY  FL
Sbjct: 489 SAVSSGTGPTQ-PEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFL 547

Query: 216 DIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTFLP 254
           +I++ ++ +      V  +V+ LF+  P+L+  F  FLP
Sbjct: 548 EILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLP 586

 Score = 36.6 bits (83), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 31/48 (64%)

Query: 342 AITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 389
           A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFR 332

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1212 bits (3135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/1147 (54%), Positives = 782/1147 (68%), Gaps = 90/1147 (7%)

Query: 318  IPTQHDVGQNF-----GSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQR 372
            +P Q   GQ          KK ADVEFSQAI YVNKIK RFA+QPDIYK FLEILQTYQR
Sbjct: 356  LPLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQR 415

Query: 373  EQKPIHEVYAQVTILFQNAXXXXXXXXXXXXXSSASGSEETXXXXXXXXXSLSDKMGGNA 432
            EQKPI+EVYAQVT+LFQNA             SS S + +          S         
Sbjct: 416  EQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSANRQQQQPGVLQQQS--------- 466

Query: 433  EAANYAASGMNAQTGYYEPVKGGVSYXXXXXXXXXXXLPPIGSFSPPTNGPFVDQTQQSA 492
                  A G++A   YY       S            LPP+GSFSPP NG       +  
Sbjct: 467  -----PAFGLSA---YYNETSPPTS---------RQNLPPLGSFSPPPNGAVPHNYYRDQ 509

Query: 493  NPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVS 552
             P+T    + LP +                   + +  D  S   + +Q I + + +PVS
Sbjct: 510  QPQT----LGLPPVAQ-----------------VENHIDQRSPPHIATQGI-AGEPMPVS 547

Query: 553  NLRTTVVEQN-YHPETIYQQQGNAQQ---HMVDGGYVGTPSELVVRPEIDLDPSLXXXXX 608
            NLR+ +  Q+      ++QQQ    Q   ++ DG Y+    ++ VRPEIDLDPS+     
Sbjct: 548  NLRSQITAQSPSELAQLHQQQQIPSQPTANIPDGQYL----DIAVRPEIDLDPSIVPVVP 603

Query: 609  XXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYI 668
                   +SL L+EET+FF+R KK IGNKQIY EFLKILNLFS DLL VDELV +VE+Y+
Sbjct: 604  EPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYL 663

Query: 669  GANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGR 728
            G NKELF WFK FVG+QDKPK IENIVHEKH+LDLDLCEA GPSYKKLPK+DTFMPCSGR
Sbjct: 664  GGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGR 723

Query: 729  DDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQT 788
            D+MCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQT
Sbjct: 724  DEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQT 783

Query: 789  LETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAIS 848
            LETIA+KIANM++ EKA F+LPPGLGHTS+TIYKKVIRKVYDKERGFEIIDALH YPAI+
Sbjct: 784  LETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIA 843

Query: 849  VPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLIS 908
            VP++L+RLKQKDEEWRRAQREWNK+WR+LEQKVY+KSLDHLGLTFKQADKKLLTTKQLIS
Sbjct: 844  VPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLIS 903

Query: 909  EINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERI 968
            EI  IK DQ +KR+HWLTPKPK+QLDY  PD  + FDI++L   F  + + YSNPDK R+
Sbjct: 904  EIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRL 963

Query: 969  KDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXXXXMDQIAEEIGETEQDTSSS 1028
            KD+ ++FVS FFSIP+ EV++A+ RRG                D   +   + E D  ++
Sbjct: 964  KDLFKIFVSLFFSIPMYEVNEAVSRRG-------------NLDDDKEDSTQKMESDNLNN 1010

Query: 1029 KKRPFDNDLNMSDILHKTKQQ--KTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLSEHR 1086
             KRP ++++++S++LH+ K Q  K++   E     +   +   +    TI       E +
Sbjct: 1011 SKRPREDEISLSEVLHRAKNQRFKSRAADETSEESAAEPEPELNEEEETIR-----QEAK 1065

Query: 1087 KQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEI 1146
            K WL+G++V+  N +  ++NR  +N+FANTNIY+FFRHL TLYERL EVK++ND + KEI
Sbjct: 1066 KPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEI 1125

Query: 1147 KSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAY 1206
             SR+V  FAKDL LIS QL E+GLDF  +DAY+QL  L KRLIEGDIEHQWFEES+RQAY
Sbjct: 1126 NSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAY 1185

Query: 1207 NNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRS 1266
            NN+AFKLYT+DKV+QS VKHAHT+++DSKTSEIM  FE  R    T+ KDQILYR+Q RS
Sbjct: 1186 NNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRS 1245

Query: 1267 HMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPH 1326
            +MSSTENMFRIEY ++ ++  IQ+IA+DDLTL   +S EE W YYVTSYSLS+PTEG+  
Sbjct: 1246 YMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQ 1305

Query: 1327 ENLEVPFLEKVIEFDQEYSKDNGNNST--YSLAGISKSNLHIDIDREKYNLILQGGSSDV 1384
            E L++PFLEKV+E +++Y  D  N S   +S  G+SKS L I ID E Y L ++ GS DV
Sbjct: 1306 EELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDV 1365

Query: 1385 YSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDG---NSNDD----VNEKFNYILA 1437
            +SR ++ ++P++           +K   + + L    G   N +DD    + EK   +  
Sbjct: 1366 FSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKE 1425

Query: 1438 NGTIDGY 1444
            NG++D +
Sbjct: 1426 NGSLDDF 1432

 Score =  184 bits (466), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 81/97 (83%), Positives = 91/97 (93%)

Query: 185 YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244
           YRPLNVKDALSYLEQVK+QF++RPD+YN FLDIMKDFKSQ IDTPGVI+RVS+LFKGYP 
Sbjct: 191 YRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPG 250

Query: 245 LIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTV 281
           LIQGFNTFLPQGYRIECS NP++PI+VTTPMGSS+  
Sbjct: 251 LIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVA 287

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 193 ALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTF 252
           A++Y+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 253 LP 254
           LP
Sbjct: 445 LP 446

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 31/48 (64%)

Query: 342 AITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 389
           A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1207 bits (3124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/1185 (53%), Positives = 811/1185 (68%), Gaps = 95/1185 (8%)

Query: 332  KKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNA 391
            +KPADVEFSQA++YVNKIK RFADQPDIYK FLEILQTYQREQKPI EVYAQVT+LFQNA
Sbjct: 356  EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA 415

Query: 392  XXXXXXXXXXXXXSSASGSEETXXXXXXXXXSLSDKMGGNAEAANYAASGMNAQTGYYEP 451
                         SS S +                              G+N   GYY+ 
Sbjct: 416  PDLLDDFKKFLPDSSPSVT----------TQQPVQPQQQALPQQQQPMYGVN--NGYYQA 463

Query: 452  VKGGVSYXXXXXXXXXXXLPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAE 511
             K                LPP+G+FSPP+NG    + ++ +  E Q  +M+LPSM+   +
Sbjct: 464  GK---------IPSANQNLPPLGNFSPPSNGAVPGRPEEFST-EAQHHMMALPSML---Q 510

Query: 512  AVKEQAIKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVSNLRTTVVE----QNYHP-- 565
            A  E A  Q H+           QQ +      +N+ IP+S+LR+ +++     NY P  
Sbjct: 511  APTEHA--QLHA-----------QQHIAPM---TNEAIPISDLRSQIIDNNHVHNYTPIE 554

Query: 566  ----------ETIYQQQGNAQQHMVDGGYVGTPSELVVRPEIDLDPSLXXXXXXXXXXXX 615
                      +   QQQ   QQ  ++  Y    +E +VRPEIDLDPS+            
Sbjct: 555  LAQLQQQQQQQQQQQQQQQQQQMQLEAAYA---TEGIVRPEIDLDPSIVPVIPEPTEPIE 611

Query: 616  NSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELF 675
             SL+L+EE NFF++ KK IGNKQ+Y EFLKILNL+S D+L++D+L++KV+YY+G+NKELF
Sbjct: 612  ESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELF 671

Query: 676  DWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEV 735
            DWFK FVG+QDKPK IEN+VHEKHKLDLDLCEA GPSYKKLPKTDTFMPCSGRD+MCWEV
Sbjct: 672  DWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV 731

Query: 736  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANK 795
            LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQTLETIA+K
Sbjct: 732  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASK 791

Query: 796  IANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRR 855
            IANMT+ EK  F+LP GLGHTS TIY+KVIRKVYDKERGFEIIDALH YP+++VP++L+R
Sbjct: 792  IANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKR 851

Query: 856  LKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKV 915
            LKQKD+EWRRAQREWNK+WR+LEQKV+FKSLDHLGLTFKQ+DKKLLTTKQL++EI+ IKV
Sbjct: 852  LKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKV 911

Query: 916  DQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVF 975
            DQ +KRIHWLTPKPK+QLDY+  D  +LFDI+ L  VF  +T+ YSNPDKER++D L+ +
Sbjct: 912  DQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSY 971

Query: 976  VSQFFSIPLKEVSDALERRGFXXXXXXXXXXXXXXMDQIAEEIGETEQDTS--SSKKRPF 1033
            +  FFSIP++E+ DA+E                  +D   +++ E EQ++S  +S KRP 
Sbjct: 972  IGLFFSIPIREIKDAVE----------------AAIDN-GKQLDENEQNSSKKNSNKRPR 1014

Query: 1034 DNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGD 1093
            D ++ +SDIL++++ Q+ K +  +D S++    +   +N     D     E +K WL+G 
Sbjct: 1015 DVEICLSDILNRSRYQRLKHS--LDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGS 1072

Query: 1094 VVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTT 1153
            +V+ AN +  + NR IYN+FAN N+Y+F R+L+T+Y+RL EVK IND + KEI  R+V  
Sbjct: 1073 LVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQ 1132

Query: 1154 FAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKL 1213
            FAKDL LIS QL  +GLDF+  D+Y QLL LSKRLIEGD+EHQWFEES+RQAY NRAFKL
Sbjct: 1133 FAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKL 1192

Query: 1214 YTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTEN 1273
            YTIDKV+QS VKHAH +++DSK+S++M LFE  R ++ TT+KDQILYR+Q RSHMS+TE+
Sbjct: 1193 YTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEH 1252

Query: 1274 MFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPF 1333
            MFRIEY  +K   SIQYIALDDLTL+  K+ E+ W YY+TSYSLS+PTEG+P E +++PF
Sbjct: 1253 MFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPF 1312

Query: 1334 LEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKY 1393
            L+KVIE +Q + +D  +N  YS  G+SKSNL I ID E Y L ++ GS D++SR ++ K+
Sbjct: 1313 LDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKF 1372

Query: 1394 PIVASDESRAANISEKTQEIRKVLSHYDG-------NSNDDVNEKFNYILANGTIDGYVR 1446
            P+    ES       +    +  L+   G       ++   + +KFN  L NGT     R
Sbjct: 1373 PVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFN-DLKNGTFQQRSR 1431

Query: 1447 QSAAVVQETEKTYNDDSGRNTSSIKSIIGSATERTEKPLINGSPI 1491
             + +         +D + +   S      + T  T +P +   PI
Sbjct: 1432 SATSETTSVPLNASDSTQKEQES------TGTSETSQPALQKVPI 1470

 Score =  183 bits (465), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 82/98 (83%), Positives = 91/98 (92%)

Query: 180 GDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLF 239
            D   YRPLNVKDAL+YLEQVK QF++RPDIYN FLDIMKDFKSQ+IDTPGVIERVS+LF
Sbjct: 116 ADGSYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 175

Query: 240 KGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGS 277
           +GYPNLIQGFNTFLPQGY IECS+NP+DPIKVTTP+GS
Sbjct: 176 RGYPNLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGS 213

 Score = 52.8 bits (125), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 8/103 (7%)

Query: 159 TGASETSTTQSPLVSGPAQT-----QGDPMSYRPLNVK--DALSYLEQVKFQFHTRPDIY 211
           TG S  S+T  P  + P  T     QG     +P +V+   A+SY+ ++K +F  +PDIY
Sbjct: 326 TGISSPSST-IPAGTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIY 384

Query: 212 NLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTFLP 254
             FL+I++ ++ +      V  +V+ LF+  P+L+  F  FLP
Sbjct: 385 KHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKFLP 427

 Score = 41.6 bits (96), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 329 GSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILF 388
           GS  +P +V+   A+TY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF
Sbjct: 118 GSYYRPLNVK--DALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 175

Query: 389 Q 389
           +
Sbjct: 176 R 176

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1102 bits (2851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/963 (56%), Positives = 694/963 (72%), Gaps = 51/963 (5%)

Query: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529
            LPPIGSFSPPTNG  V    Q         ++ LPSM+ +   +  Q I           
Sbjct: 559  LPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQHGPNMVHQGI----------- 607

Query: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGN--AQQHMVDGGYVGT 587
                           +N+++P+S+LRT++ +Q Y P T  QQQ N  +   + D  Y   
Sbjct: 608  ---------------ANENLPISDLRTSLTDQ-YAPSTFQQQQQNPPSISPITDLQYGDV 651

Query: 588  PSELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKIL 647
            P    VRPEIDLDPS+            ++++L EE  FFE+ K+ IGNK +Y EFLKIL
Sbjct: 652  P----VRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 707

Query: 648  NLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCE 707
            NL+S D+L +D+LV+KV++Y+G+NKELF WFK FVGYQ+K K IENIVHEKH+LDLDLCE
Sbjct: 708  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCE 767

Query: 708  AYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 767
            A+GPSYK+LPK+DTFMPCSGRDDMCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 768  AFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 827

Query: 768  IEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRK 827
            IEEERHEYD+YIESNLRTIQ LETI NKI NMT++EK+ F+LPPGLGHTSMTIYKKVIRK
Sbjct: 828  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRK 887

Query: 828  VYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLD 887
            VYDKERGFEIIDALH +PA++ P++L+RLKQKDEEWRRAQREWNK+WR+LEQKV+FKSLD
Sbjct: 888  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 947

Query: 888  HLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDII 947
            HLGLTFKQADKKLLTTKQLISEIN IKVDQ +K+IHWLTPKPK+QLD+DFPD DI +DI+
Sbjct: 948  HLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDIL 1007

Query: 948  ALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXX 1007
             L   F  +T  YSNPDKER+KD+L+ F+S FFSIPL+++  AL+               
Sbjct: 1008 YLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHK------------ 1055

Query: 1008 XXXMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDL 1067
                + ++E  G  +  +S+S+KRP+  ++++ DILH+ + QK K + + +G      + 
Sbjct: 1056 ----ENVSESSGSDDGGSSTSRKRPYQQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEP 1111

Query: 1068 GTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVT 1127
              + +    E+     E R  WL G++V+ AN +  + NR+I+NLFANTNIYIFFRH  T
Sbjct: 1112 LDEESNTIEEEELISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTT 1171

Query: 1128 LYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKR 1187
            +YERL E+KQ+N +I KE+ +R   TFAKDL L+S QL E+GLDF   DAY+Q+L LS+R
Sbjct: 1172 IYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRR 1231

Query: 1188 LIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQR 1247
            LI GD+EHQWFEES+RQAYNN+AFKLYTIDKV QS VKHAHTL++D KT+EIM LF   R
Sbjct: 1232 LINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDR 1291

Query: 1248 NNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEA 1307
            N   T+ KDQI+YR+Q RS+MS+ ENMFRIE  +   H S+QYIALDDLTLK  K+ E+ 
Sbjct: 1292 NAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDK 1351

Query: 1308 WNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHID 1367
            W YYVTSY L +PTEG+ HE L++PFLE++IEF Q+ +     +  +S  GIS S L I 
Sbjct: 1352 WKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQD-TDGREVDEEFSPEGISLSTLRIK 1410

Query: 1368 IDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSNDD 1427
            I    Y L ++ GS DV++R  + KYP +A+D+     + +KT  I + L +    S +D
Sbjct: 1411 IQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFLENA-IRSRND 1469

Query: 1428 VNE 1430
            +NE
Sbjct: 1470 LNE 1472

 Score =  283 bits (725), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 171/249 (68%), Gaps = 39/249 (15%)

Query: 181 DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240
           DP  YRPLNVKDALSYLEQVKFQF +RPDIYNLFLDIMKDFKSQ IDTPGVIERVS+LF+
Sbjct: 221 DP-DYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279

Query: 241 GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQ-------KSPS-- 291
           GYP LIQGFNTFLPQGYRIECS NP+DPI+VTTPMG++T   N +P        + PS  
Sbjct: 280 GYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSL 339

Query: 292 ---------PSDXXXXXXXXXXXXXEAQLQSQATP---------------IPTQHDV--G 325
                    P               ++Q Q Q+ P               IP  H +  G
Sbjct: 340 SEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSIHPPEIPPHHQILQG 399

Query: 326 QNFG---SAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYA 382
           Q+      AKK  DVEFSQAI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYA
Sbjct: 400 QSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYA 459

Query: 383 QVTILFQNA 391
           QVT LFQNA
Sbjct: 460 QVTHLFQNA 468

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/951 (57%), Positives = 693/951 (72%), Gaps = 52/951 (5%)

Query: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529
            LPPIGSFSPPTNG    +  Q         +M LPSM+     +  Q I           
Sbjct: 565  LPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQQGPNMVHQGI----------- 613

Query: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGN--AQQHMVDGGYVGT 587
                            N++IP+S+LRT++ +Q Y P    QQQ    +   ++D  Y   
Sbjct: 614  ---------------VNENIPLSDLRTSLTDQ-YAPSNFQQQQQQQPSISPIIDSQYGDV 657

Query: 588  PSELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKIL 647
            P    VRPEIDLDPS+            ++++L EE  FFE+ K+ IGNK +Y EFLKIL
Sbjct: 658  P----VRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKIL 713

Query: 648  NLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCE 707
            NL+S D+L +D+LV+KV++Y+G+NKELF WFK FVGYQ+K K IEN+VHEKH+LDLDLCE
Sbjct: 714  NLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCE 773

Query: 708  AYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 767
            A+GPSYK+LPK+DTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 774  AFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 833

Query: 768  IEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRK 827
            IEEERHEYD+YIESNLRTIQ LETI NKI NMT+ EKA F+LPPGLGHTSMTIYKKVIRK
Sbjct: 834  IEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRK 893

Query: 828  VYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLD 887
            VYDKERGFEIIDALH +PA++ P++L+RLKQKDEEWRRAQREWNK+WR+LEQKVYFKSLD
Sbjct: 894  VYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 953

Query: 888  HLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDII 947
            HLGLTFKQADKKLLTTKQLISEI+ IKVDQ +K+IHWLTPKPK+QLD+DFPD DI +DI+
Sbjct: 954  HLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDIL 1013

Query: 948  ALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXX 1007
             L   F  +T  YSNPDKER+KD+L  F+S FFSIPL+++ +AL+               
Sbjct: 1014 YLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQ--------------- 1058

Query: 1008 XXXMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDL 1067
                  +++  G  + D+S+ +KRP+  ++++ DILH++K QK K + + DG K P    
Sbjct: 1059 -SYKQNLSDSSGSDDGDSSTPRKRPYQQEMSLLDILHRSKYQKLKRSNDEDG-KVPQLSE 1116

Query: 1068 GTDRNVGTIEDSGSLSEHRKQ-WLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLV 1126
              D     IE+   ++E  K  WL G++V+ AN +  + NRNI+NLFAN+NIYIFFRH  
Sbjct: 1117 PLDEESNAIEEEELINEEAKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWT 1176

Query: 1127 TLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSK 1186
            T+YERL E+KQ+N+++ KEI  R + TFAKDL L+S+QLSE+GLDFN  DAY+Q+L LS+
Sbjct: 1177 TIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSR 1236

Query: 1187 RLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQ 1246
            RLI G++EHQWFEE +RQAYNN+AFKLYTIDKV+Q  VKHAHTL++D+KT+EIM LF   
Sbjct: 1237 RLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKD 1296

Query: 1247 RNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEE 1306
            RN + T+ KDQI+YR+Q RS+MS+TENMFR+E+ R   H S+QYIALDDLTLK  ++ E+
Sbjct: 1297 RNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADED 1356

Query: 1307 AWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHI 1366
             W YYVTSY+L +PTEG+ HE L++PFLE++IE+ Q+ +     +  +S  G+S S L I
Sbjct: 1357 KWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYGQD-TDGREVDEKFSPEGLSVSTLKI 1415

Query: 1367 DIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVL 1417
             I    Y L ++ GS DV++R    KYP VA+D+     + +KT  I K L
Sbjct: 1416 KIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFL 1466

 Score =  279 bits (713), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 155/268 (57%), Positives = 175/268 (65%), Gaps = 36/268 (13%)

Query: 181 DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240
           DP  YRPLNVKDALSYLEQVKFQF++RPDIYNLFLDIMKDFKSQ IDTPGVIERVS+LF+
Sbjct: 64  DP-DYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

Query: 241 GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAP-------QKSPS-- 291
           GYP LIQGFNTFLPQGYRIECS NP+DPI+VTTPMG++T   N +P        + PS  
Sbjct: 123 GYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSL 182

Query: 292 -----------------PSDXXXXXXXXXXXXXEAQLQSQATPIPTQHDV------GQNF 328
                            PS+                L +  + +P+ H         Q  
Sbjct: 183 PEADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPELPIPQSQPL 242

Query: 329 GS---AKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVT 385
            +    KK  DVEFSQAI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT
Sbjct: 243 TAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 302

Query: 386 ILFQNAXXXXXXXXXXXXXSSASGSEET 413
            LFQNA             SSAS +E+ 
Sbjct: 303 HLFQNAPDLLEDFKKFLPDSSASANEQV 330

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%)

Query: 173 SGPAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVI 232
           S P   Q D      +    A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V 
Sbjct: 239 SQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY 298

Query: 233 ERVSSLFKGYPNLIQGFNTFLP 254
            +V+ LF+  P+L++ F  FLP
Sbjct: 299 AQVTHLFQNAPDLLEDFKKFLP 320

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1058 bits (2736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/930 (58%), Positives = 671/930 (72%), Gaps = 41/930 (4%)

Query: 535  QQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPSELVVR 594
            QQ +++Q + SNDDIP+S +R T               G  +  + + G V    E V R
Sbjct: 471  QQHIITQGM-SNDDIPISEVRNTA-------------DGAYRSDLRNSGEVQY-MEPVAR 515

Query: 595  PEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDL 654
            PEIDLDPSL            N ++L+EET+FF++ KK IGNKQIY EFLKILNL+S DL
Sbjct: 516  PEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDL 575

Query: 655  LTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYK 714
            L  DELV+KVEYY+G NKELFDWFK FVGY+ KPK IENIVHEKH+LDLDLCEA GPSYK
Sbjct: 576  LDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYK 635

Query: 715  KLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE 774
            KLPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE
Sbjct: 636  KLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE 695

Query: 775  YDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERG 834
            YD+YIE+NLRTIQTLETIANKIANMT  EKA F+L PGLGHTS+TIYKKVIRKVYDK+RG
Sbjct: 696  YDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRG 755

Query: 835  FEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFK 894
            FEIIDALH  P+I+VPI+L+RLKQKDEEWRRAQREWNK+WR+LEQKVY+KSLDHLGLTFK
Sbjct: 756  FEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK 815

Query: 895  QADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFT 954
            QADKKLLTTKQL+SEI+ IKVDQ +KRIH LTPKPK+QLDY F D ++L+DI+ L  VF 
Sbjct: 816  QADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFI 875

Query: 955  INTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXXXXMDQI 1014
                 YSNPDKE++ D L+ F+  FFS P+ EV  A  RR                   I
Sbjct: 876  DCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARR----------------RGDI 919

Query: 1015 AEEIGET---EQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDR 1071
              + GE    ++++  S+KR  + +  + D+L + K QK + N   +       +     
Sbjct: 920  GVQDGEENSGQENSDLSRKRTREEENLLKDVLRRNKYQKGR-NFAEEEPIPEESEFAEKT 978

Query: 1072 NVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYER 1131
                 E+     E +K WL+G +VD AN+   ++NR  +N+FANTNIY+FFRHL TLY R
Sbjct: 979  VEEKEEEEIIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTR 1038

Query: 1132 LSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEG 1191
            LSEVK IN+ + +EIK+R+V  FAKDL LISTQLS++GLDF  +DAY Q+LTLSKRLIEG
Sbjct: 1039 LSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEG 1098

Query: 1192 DIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTL 1251
            DIEHQWFEES+RQAY N+AFK+YTIDKVVQS VKHAHT+I+D KT EIM+LFE  R    
Sbjct: 1099 DIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLN 1158

Query: 1252 TTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYY 1311
            T+ K+QILYR+Q RSHM++ ENMFRIEY R+  HASIQ++A+DDLTL+  KS E+ W YY
Sbjct: 1159 TSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYY 1218

Query: 1312 VTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDRE 1371
            VTSYSLS+PTEG+ HE L+ PFLEK++E ++E+  +NG    YS  G+S SNL + I+ E
Sbjct: 1219 VTSYSLSHPTEGISHEELQPPFLEKILEKEEEFQCENGE---YSPEGVSSSNLKVKINPE 1275

Query: 1372 KYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSNDDVNEK 1431
             Y+L +Q GS D +SR +I K+PI  ++++  +   EK + +   L+   G     V  K
Sbjct: 1276 TYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASK 1335

Query: 1432 FNYILANGTIDGYVRQSAAVVQETEKTYND 1461
               +L   T   YV+    +V    K  ND
Sbjct: 1336 ---VLKAQTEIEYVKTKGTLVGLESKDKND 1362

 Score =  275 bits (703), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 153/248 (61%), Positives = 172/248 (69%), Gaps = 46/248 (18%)

Query: 181 DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240
           DP SYRPLNVKDALSYLEQVKFQF+ RPD+YN FLDIMKDFKSQ IDTPGVIERVS+LF+
Sbjct: 155 DP-SYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

Query: 241 GYPNLIQGFNTFLPQGYRIECSNNPND--PIKVTTPMGSSTTV-LNTAPQKSPSPSDXXX 297
           GYPNLIQGFNTFLPQGY+IECS+NPND  PIKVTTP G++ +V LNTAP +   PS+   
Sbjct: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAPLEQRYPSN--- 270

Query: 298 XXXXXXXXXXEAQLQSQATPI----------------------------------PTQHD 323
                       QLQ   + +                                  P Q D
Sbjct: 271 --ENVLLSPDHLQLQQHHSVLQQEQQQPQPQPQQQPQPQTQTQTQTQTQTQQQHYPDQQD 328

Query: 324 VGQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQ 383
             Q++  AKK  DVEFS AI+YVNKIKTRFA+QPDIYK FLEILQTYQREQKPI+EVYAQ
Sbjct: 329 --QHY-LAKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQ 385

Query: 384 VTILFQNA 391
           VT+LFQNA
Sbjct: 386 VTVLFQNA 393

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 193 ALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTF 252
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 253 LPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQKSPSP 292
           LP     + +  P        P+   T     APQ++  P
Sbjct: 404 LPDASAPQSTTTP-------APVNGGTFYPQAAPQQNLPP 436

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 16/21 (76%)

Query: 90  TSSSTPASVGFSVASLDNPLP 110
           T   TP+  GFSVASL+NPLP
Sbjct: 110 THRHTPSGTGFSVASLNNPLP 130

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1046 bits (2704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/854 (61%), Positives = 641/854 (75%), Gaps = 31/854 (3%)

Query: 589  SELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILN 648
            SE   RPEIDLDPS+            N++ L+EET+FFE+VKK I +K IY EFLK+LN
Sbjct: 712  SEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLN 771

Query: 649  LFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEA 708
            L+S DLL+ +ELV +V+YYIG+NKELFDWFK FVGY + P  IENI+HEKHKLDLDLCEA
Sbjct: 772  LYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEA 831

Query: 709  YGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 768
            YGPSYKKLPKTDTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI
Sbjct: 832  YGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 891

Query: 769  EEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKV 828
            EEERHEYD++IESNLRTIQTLETIANKI NMT  EK  F+LP GLGHTS TIYKKVIRKV
Sbjct: 892  EEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKV 951

Query: 829  YDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDH 888
            YDKERGFEIIDALH +PA +VPIILRRLK+KDEEWRRAQREWNK+WR+LEQKVY+KSLDH
Sbjct: 952  YDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDH 1011

Query: 889  LGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIA 948
            LGLTFKQADKKLLTTKQLISEI+ I+VDQN+KRIHWLTPKPK+QLD+ F D+DIL DI+ 
Sbjct: 1012 LGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILD 1071

Query: 949  LGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXX 1008
            L  VF  +T+ YSN +KER+KD LRVF+  FFSIP  E+   L  +              
Sbjct: 1072 LANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKN------------D 1119

Query: 1009 XXMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTK----------MNKEMD 1058
               ++ +     T   T S+KKR  + D+ ++D+L K K QK K           N+  +
Sbjct: 1120 EKFEKGSSSSSSTSNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNEYDE 1179

Query: 1059 GSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNI 1118
              +   E+L   +     ED     E +K WL+G V+D  ++   ++NR+I+NLFANTNI
Sbjct: 1180 RDEEFDEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNI 1239

Query: 1119 YIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAY 1178
            Y+FFRH  T+YERL E+KQIND++ +EI SR+VT FAKDLGLISTQL+ +GLDF +SD+Y
Sbjct: 1240 YVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSY 1299

Query: 1179 QQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSE 1238
            ++LL L+KRLI+ DIEHQWFEES+RQAYNN+AFKLYT DKV+Q+ VKHA+++++DSK SE
Sbjct: 1300 KELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASE 1359

Query: 1239 IMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTL 1298
            IM LFE  R  + TTT+DQI+YR+Q R+HM++TENMFRIE+     H  IQYIA++DLTL
Sbjct: 1360 IMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTL 1419

Query: 1299 KTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNS------ 1352
            K + + +E W YYVTSY+L +PTEGVP E L+VPFLEK +  + E ++D  N +      
Sbjct: 1420 KPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFI 1479

Query: 1353 -TYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQ 1411
               S  GIS S L I ID+E YNL ++ GS DV+SR ++ K+P  A  +   ++I EK++
Sbjct: 1480 EKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDA--KKIESSIKEKSE 1537

Query: 1412 EIRKVLSHYDGNSN 1425
               K LS   G +N
Sbjct: 1538 AFNKFLSSKRGWNN 1551

 Score =  176 bits (447), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/99 (82%), Positives = 91/99 (91%), Gaps = 1/99 (1%)

Query: 181 DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240
           DP  YRPLNVKDALSYLEQVK QF+++P IYN FLDIMKDFKSQTIDTPGVIERVS+LFK
Sbjct: 267 DP-EYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

Query: 241 GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSST 279
           GYP LIQGFNTFLPQGY I CS+NP+DP++VTTPMG+ST
Sbjct: 326 GYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTST 364

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%)

Query: 336 DVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNA 391
           +VEFSQAI YVNKIKTR+ADQP IYK FLEILQTYQRE+KPI EVY QVT+LF +A
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDA 519

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 193 ALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTF 252
           A++Y+ ++K ++  +P IY  FL+I++ ++ +      V E+V+ LF   P+L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 253 LPQ 255
           LP+
Sbjct: 530 LPE 532

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 333 KPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 389
           +P +V+   A++Y+ ++K +F  QP IY QFL+I++ ++ +      V  +V+ LF+
Sbjct: 271 RPLNVK--DALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1039 bits (2686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/992 (54%), Positives = 679/992 (68%), Gaps = 73/992 (7%)

Query: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529
            LPP+GSFS P +           +P      M+LP             + QA +  ++  
Sbjct: 489  LPPLGSFSTPGDH----------HP------MNLP-------------LVQAPNMNLNQG 519

Query: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPS 589
            H       +++Q + SN  IP+S+LRTT  + +Y P      QG   Q+M          
Sbjct: 520  H----PAHIITQGM-SNQKIPISDLRTTA-DTSYRPAEY--SQGQDTQYM---------- 561

Query: 590  ELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILNL 649
            E   RPEIDLDPSL            + LNL+EE +FF++ KK IGNKQIY EFLKILNL
Sbjct: 562  ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNL 621

Query: 650  FSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAY 709
            +S DLL  + LV+KV +Y+    ELFDWFK FVGYQ+KPK IENIVHEKH+LDLDLCEA 
Sbjct: 622  YSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEAC 681

Query: 710  GPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 769
            GPSYK+LPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIE
Sbjct: 682  GPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIE 741

Query: 770  EERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVY 829
            EERHEYD+YIE+NLRTIQTLETIANKIANMT  EKA F+LPPGLGHTS+TIYKKVIRKVY
Sbjct: 742  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVY 801

Query: 830  DKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHL 889
            DK+RG+EIIDALH YPAI+VPI+L+RLKQKDEEWRRAQREWNK+WR+LEQKV+FKSLDHL
Sbjct: 802  DKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 861

Query: 890  GLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIAL 949
            GLTFKQADKKLLT KQLISEI+ IKVDQN+KRIH LTPK K+QLD+DF D ++ +DI+ L
Sbjct: 862  GLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNL 921

Query: 950  GFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXXX 1009
              VF  N N YS PDKER+KD  + F+S F S P+ ++  AL +R               
Sbjct: 922  AIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRD-----AASSSQSSN 976

Query: 1010 XMDQIAEEIGETEQDTSSSKKRPF-DNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLG 1068
               +   E  + + D    KKR   D+D  + D+L + KQQK        G  SP  D  
Sbjct: 977  SNTETYSEKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQK-------GGRNSPRGDSS 1029

Query: 1069 TDRNVGTIEDSGSL--SEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLV 1126
                  +  +   +   E +  WL+G +VD A+    ++NR  +NLFANTNIY+FFRHL 
Sbjct: 1030 ISAEKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLA 1089

Query: 1127 TLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSK 1186
            T+YERL EVK++NDE+ KEI +R+V  FAKDL LISTQL+++GLDF   DAY++LL LS+
Sbjct: 1090 TIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSR 1149

Query: 1187 RLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQ 1246
             LI GD+EHQWFEES+RQAY N+AFK+YT+DKV+Q+ VKHAH +I+D+KT EIM+LFE  
Sbjct: 1150 SLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKD 1209

Query: 1247 RNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEE 1306
            R +  T+TKDQILYR+Q RS+MS+ ENMFRIEY R   H  IQ++A+DDLTL+  KS ++
Sbjct: 1210 RTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKD 1269

Query: 1307 AWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHI 1366
             W YY+TSYSLS+PTEG+ H+NL  PFLEK+IE   E       +  YS  G++ SNL +
Sbjct: 1270 KWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIE--SEEDIIEDKDEKYSPEGVATSNLKV 1327

Query: 1367 DIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSND 1426
             ID   Y++ ++ GS D++SR  + K+P+    + R    SE   E+ + L+   G   D
Sbjct: 1328 KIDPITYSMEVEFGSHDIFSRKAVNKFPVRV--DIRKKKSSELKLELERFLNSNSGWKKD 1385

Query: 1427 -------DVNEKFNYILANGTIDGYVRQSAAV 1451
                   +V ++  ++  NG ++ Y   SA  
Sbjct: 1386 LSAKQIAEVEKRLEFVKLNGNLEEYSDDSAVA 1417

 Score =  184 bits (467), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 94/107 (87%), Gaps = 2/107 (1%)

Query: 175 PAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIER 234
           PA   G   SYRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQ IDTPGVIER
Sbjct: 152 PAHQDGS--SYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIER 209

Query: 235 VSSLFKGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTV 281
           VS+LF+GYP LIQGFNTFLPQGY IECS++PNDPIKVTTP G++  V
Sbjct: 210 VSTLFQGYPTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTTGEV 256

 Score =  115 bits (287), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (78%), Gaps = 1/80 (1%)

Query: 313 SQATPIPTQHDVGQNFGSA-KKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQ 371
           +  +P   Q      FG+  KK  DVEFS AI+YVNKIKTRFADQPDIYK FLEILQTYQ
Sbjct: 327 TDGSPTMPQRQPQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQ 386

Query: 372 REQKPIHEVYAQVTILFQNA 391
           REQKPI+EVYAQVT+LFQNA
Sbjct: 387 REQKPINEVYAQVTVLFQNA 406

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 193 ALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTF 252
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 253 LP 254
           LP
Sbjct: 417 LP 418

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 329 GSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILF 388
           GS+ +P +V+   A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF
Sbjct: 157 GSSYRPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 214

Query: 389 Q 389
           Q
Sbjct: 215 Q 215

 Score = 33.9 bits (76), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 188 LNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQ 247
           LN+ +  S+ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648

Query: 248 GFNTFLPQGYR 258
            F +F+  GY+
Sbjct: 649 WFKSFV--GYQ 657

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1032 bits (2669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/879 (56%), Positives = 649/879 (73%), Gaps = 40/879 (4%)

Query: 590  ELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILNL 649
            E  VRPEIDLDPSL            ++L L+EETNFF++VKK IGNK IY EFLK+LNL
Sbjct: 827  ENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNL 886

Query: 650  FSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAY 709
            +S+DLL VDELV+K++YY+  N+ELF WFK FVGY +KPK IENIVHEKHKLDLDLCEA 
Sbjct: 887  YSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEAC 946

Query: 710  GPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 769
            GPSYKKLPKTDT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +++
Sbjct: 947  GPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLK 1006

Query: 770  EERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVY 829
            ++ HEYD+YIESNLRTIQTLETIA+KIANMT+ EK  F+LP GLGHT+ TIYKKVIRKVY
Sbjct: 1007 KKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVY 1066

Query: 830  DKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHL 889
            DKERGFEIIDALH YPAI+VP++L+RLKQKDEEWRRAQREWNK+WR+LEQKV+FKSLDHL
Sbjct: 1067 DKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 1126

Query: 890  GLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIAL 949
            GLTFKQADKKLLTTKQLISEI+ IKVDQ  KR+HWLTPKPK+QLD++ PD DI+FDI++ 
Sbjct: 1127 GLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSF 1186

Query: 950  GFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXXX 1009
              +F  +T+ YSNP+KER+ D ++ F S FFSIPL+E+ +A+ +R               
Sbjct: 1187 VEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKN--------- 1237

Query: 1010 XMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKM---NKEMDGSKSPSED 1066
              D+  E+  +   + +S K+   D  L++ DIL +TK Q+ K    + E+DG  +  +D
Sbjct: 1238 --DEKLED-KQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD 1294

Query: 1067 LGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLV 1126
                     +       E +K WL+G +V+ AN +  + +RNI+N+F+NTN+YIF RHL 
Sbjct: 1295 QKLLEEEELLR-----QEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLT 1349

Query: 1127 TLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSK 1186
            T+YERL E+KQ+ND++++EI  R+++ FAKDL LISTQL+E+GLDF+  D YQQLL L K
Sbjct: 1350 TMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCK 1409

Query: 1187 RLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQ 1246
            RLI GD+EHQWFEES+RQA+NN+AFKLYT+DKV Q+ VKHAHT+ISD KT+EIM LFE  
Sbjct: 1410 RLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKD 1469

Query: 1247 RNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEE 1306
            R    T++KDQILYR+Q R+ M+  ENMFRIEY    +H  IQYIALDDLT+K AK+ EE
Sbjct: 1470 RTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEE 1529

Query: 1307 AWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEF----------DQEYSKDNGNNSTYSL 1356
             W YY+TSY+LS+PTEG+  EN+++PFLE++IE           DQ+ +K   +   YS 
Sbjct: 1530 KWKYYITSYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTK---SLMKYSP 1586

Query: 1357 AGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKV 1416
             GIS S L I ID + Y L ++ GS D++SR ++ ++P+  + +S+   + +    + K 
Sbjct: 1587 EGISGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKF 1646

Query: 1417 LSHYDG-------NSNDDVNEKFNYILANGTIDGYVRQS 1448
            L+   G       +  + +  K++++  NG ++GY  +S
Sbjct: 1647 LNSKMGWKRAISKDQMESIESKWDHLSNNGNLEGYQEKS 1685

 Score =  179 bits (454), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 95/116 (81%), Gaps = 5/116 (4%)

Query: 175 PAQTQGDPMS---YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGV 231
           P  TQ  P     YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQ IDTPGV
Sbjct: 286 PNNTQDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGV 345

Query: 232 IERVSSLFKGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTT--VLNTA 285
           I RVSSLF  YP+LIQGFNTFLPQGYRIECS+NPN PI V TPMG++T   VL T+
Sbjct: 346 IARVSSLFHDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETS 401

 Score =  109 bits (273), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 86/172 (50%), Gaps = 25/172 (14%)

Query: 326 QNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVT 385
           Q     ++  DVEFSQAI+YVNKIK RFA+QP IYK FLEILQTYQREQKPI+EVY+QVT
Sbjct: 532 QELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVT 591

Query: 386 ILFQNAXXXXXXXXXXXXXSSASGSEETXXXXXXXXXSLSDKMGGNAEAANYAASGMNAQ 445
           +LFQ A             SSA+                +  +  + E     A+G N Q
Sbjct: 592 VLFQEAPDLLEDFKKFLPDSSANN---------------NGSIVTSQEENFMYANGFNQQ 636

Query: 446 TGYYEPVKGGVSYXXXXXXXXXXXLPPIGSFSPPTNGPFVDQTQQSANPETQ 497
             +  P                  LPP+GSFS   NG F  Q  Q   P ++
Sbjct: 637 QPHLTP----------HSEIQAQNLPPLGSFSTQPNGVFPKQESQQIVPTSR 678

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 53/98 (54%), Gaps = 3/98 (3%)

Query: 160 GASETSTTQSPLVSG---PAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLD 216
             + T+T Q P+VS    P Q   +    + +    A+SY+ ++K +F  +P IY  FL+
Sbjct: 512 ATAGTATQQFPMVSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLE 571

Query: 217 IMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTFLP 254
           I++ ++ +      V  +V+ LF+  P+L++ F  FLP
Sbjct: 572 ILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKFLP 609

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 333 KPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 390
           +P +V+   A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V A+V+ LF +
Sbjct: 300 RPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1029 bits (2660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/932 (55%), Positives = 661/932 (70%), Gaps = 46/932 (4%)

Query: 478  PPTNGPFVDQTQ--QSANPETQKGVM----SLPSMMNNAEAVKEQAIKQAHSRLISDSHD 531
            PP   P++ Q Q  Q      Q GV+    +LP + N + +   QA    +S ++   H 
Sbjct: 544  PPQ--PYLQQNQSMQGQGFYPQSGVLMQPTNLPPLGNFSAS--GQASPAENSHMLPSMHQ 599

Query: 532  HNSQQQVLSQNI----HSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDG-GYVG 586
            H +   V+ Q++     SN DIPVS +R+T+     + +  Y Q        ++G  Y+ 
Sbjct: 600  HIAGGHVIPQHVVTQGMSNQDIPVSEMRSTM--NGTYNQVEYIQGAPGYPQPLEGVQYME 657

Query: 587  TPSELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKI 646
             P   + RPEIDLDPSL            +++ L +E  FFERVK+ IGNKQ+Y EFLKI
Sbjct: 658  AP---MARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGNKQVYAEFLKI 714

Query: 647  LNLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLC 706
            LNL+S DLLT  ELV KVE+Y+ ++KELFDWFK FVGYQ+KPK IENIVHEKH+LDLDLC
Sbjct: 715  LNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLC 774

Query: 707  EAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 766
            EA GPSYKKLPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLF
Sbjct: 775  EACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLF 834

Query: 767  KIEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIR 826
            K+EEERHEYD+YIESNLRTIQTLETIANKIANMT+ EK  F+LPPGLGHTS+TIYKKV+R
Sbjct: 835  KVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVR 894

Query: 827  KVYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSL 886
            KVYDK+RGFEIIDALH +PA++VPI+L+RLKQKDEEWRRAQREWNK+WR+LEQKVY+KSL
Sbjct: 895  KVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSL 954

Query: 887  DHLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDI 946
            DHLGLTFKQADKKLLTTKQL+SEI+ IKVDQ +KRIH LTPKPK+QLD++  D ++L+DI
Sbjct: 955  DHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDI 1014

Query: 947  IALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXX 1006
            + L F F      YSN DK ++    + F+S FFS P+K+V++A+  R            
Sbjct: 1015 LDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERS----------- 1063

Query: 1007 XXXXMDQIAEEIGETEQDTSSSKKRPFDNDLN--MSDILHKTKQQKTKMNKEMDGSKSPS 1064
                 DQ   E    + D+  S KR   ++ +  M DIL +TK  KT  ++E   S S  
Sbjct: 1064 --SITDQENGEEDSNKSDSEKSNKRTLSDEDSYLMKDILRRTKNAKTSNSEENQNSSSVK 1121

Query: 1065 EDLGTDRNVGTIEDSGSL--SEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFF 1122
             +          ED   L   E  K WL+G ++D AN    + +R+I+NLF NT IY+FF
Sbjct: 1122 SNE---------EDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFF 1172

Query: 1123 RHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLL 1182
            RHL TLYERL EVK+I+ E+  EIK+R++  FA DL LISTQL+++GL F  + AY +LL
Sbjct: 1173 RHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELL 1232

Query: 1183 TLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLL 1242
             LSKRLI GD++HQWFEES+RQAY N+AFK+YTIDKVVQS VKHAH++I+D K + +M+L
Sbjct: 1233 RLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVL 1292

Query: 1243 FENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAK 1302
            FE  R    TT KDQILYR++ R+ M  +ENMFRIEY  +  H SIQY+A+DDLTLK  +
Sbjct: 1293 FEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQ 1352

Query: 1303 SPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKS 1362
            + +E W+YYVTSYSLS+PTEG+  E++  PFL K+IE + EY  D   N  +S  G+S+S
Sbjct: 1353 NMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQS 1412

Query: 1363 NLHIDIDREKYNLILQGGSSDVYSRATIQKYP 1394
             L ++I  E Y L  + GS+DV++R ++ K+P
Sbjct: 1413 KLKVNIHPETYELTFECGSTDVFTRKSVNKFP 1444

 Score =  182 bits (462), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 81/103 (78%), Positives = 91/103 (88%)

Query: 184 SYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYP 243
           SYRPLNVKDALSYLEQVKFQF +RPD+YN FLDIMKDFKSQ IDTPGVI+RV++LF+G+P
Sbjct: 200 SYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFP 259

Query: 244 NLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAP 286
           NLIQGFNTFLP GY+IECS NPNDPIKVTTP G++  V    P
Sbjct: 260 NLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPP 302

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/59 (89%), Positives = 56/59 (94%)

Query: 332 KKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 390
           +K  +VEFS AI+YVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN
Sbjct: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 193 ALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTF 252
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 253 LP 254
           LP
Sbjct: 490 LP 491

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 39/60 (65%), Gaps = 2/60 (3%)

Query: 330 SAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 389
           S+ +P +V+   A++Y+ ++K +F+ +PD+Y  FL+I++ ++ +      V  +VT LFQ
Sbjct: 199 SSYRPLNVK--DALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1013 bits (2620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/943 (55%), Positives = 650/943 (68%), Gaps = 71/943 (7%)

Query: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529
            LPP+G+FSPP NG   D   Q   P  Q   +  P                      S S
Sbjct: 580  LPPLGNFSPPING--RDNEAQVNLPAVQPPALDFPPQQQ------------------SQS 619

Query: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPS 589
            H H     V++Q + +N+ +PVS++R  V +  + P+ +Y Q         D  Y+    
Sbjct: 620  HRH-----VVAQGM-TNNSLPVSDMRGPV-DGGFAPQPLYSQ---------DVQYM---- 659

Query: 590  ELVVRPEIDLDPSLXXXXXXXXXXXXNSLNLMEETNFFERVKKSIGNKQIYNEFLKILNL 649
            E   RPEIDLDPSL            N   L+EET+FF++ KK +GNKQ+Y EFLKILNL
Sbjct: 660  EPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNL 719

Query: 650  FSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAY 709
            FS DL+  DELVDKVE+Y+G N ELFDWFK FV Y ++PK IEN+VHEKH+LDLDLCEA 
Sbjct: 720  FSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEAC 779

Query: 710  GPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 769
             PSYKKLPK DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 780  CPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 839

Query: 770  EERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVY 829
            EERHEYDYYIE+NLRTIQ LETIANKI+NMT  EK  F+LPPGLGHTS TIYKKVIRKVY
Sbjct: 840  EERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVY 899

Query: 830  DKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHL 889
            DK+RGFEIIDALH  PA+SVPI+LRRLKQKDEEWRRAQREWNK+WR+LEQKV++KSLDHL
Sbjct: 900  DKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHL 959

Query: 890  GLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIAL 949
            GLTFKQADKKLLT KQLISEI+ IK+DQ +KRI+  T KPK+QLD+D  D  +LFDI+ L
Sbjct: 960  GLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNL 1019

Query: 950  GFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFXXXXXXXXXXXXX 1009
               F  ++  YSNPDKE++    R F+S FFSIPL +                       
Sbjct: 1020 VDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTD----------------------- 1056

Query: 1010 XMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDIL-HKTKQQKTKMNKEMDGSKSPSEDLG 1068
             +D  +EE     ++  S++KR  D+D    D+L  K KQ K K +++ D S S  +D  
Sbjct: 1057 -LDNPSEE--HKVENGDSTRKRSRDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTA 1113

Query: 1069 TDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTL 1128
               +     +     + +K WL+G+++D AN    + NR  YN+FANTNIY+FFRHL T+
Sbjct: 1114 AKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTM 1173

Query: 1129 YERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRL 1188
            Y+RLSE K IN+E+ KEI SR+V  FAKDL L STQLS++GLDF  +DAY+QLL L KRL
Sbjct: 1174 YQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRL 1233

Query: 1189 IEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRN 1248
            I+ DIEHQWFEES+RQAY N+AFK+YT+DKV+QS VKHAH++I+D+KT+EIM+LFE  R 
Sbjct: 1234 IQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRK 1293

Query: 1249 NTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAW 1308
               T+T++QILYR+Q RS M  TENMFRIE      H SIQ++A+DDLTL    S ++ W
Sbjct: 1294 APTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQW 1353

Query: 1309 NYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDI 1368
             YY+TSYSLS+PTEGVPHE ++ PFLEK +   ++    + ++  YS  G S S L I I
Sbjct: 1354 QYYLTSYSLSHPTEGVPHEEIKAPFLEKTL---RDDGDSDEDSEWYSPGGQSVSQLRIQI 1410

Query: 1369 DREKYNLILQGGSSDVYSRATIQKYPI-VASDESRAANISEKT 1410
            + E Y L ++  S D+++R+T+ K+P  +     R A   +K+
Sbjct: 1411 NPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKS 1453

 Score =  248 bits (632), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 138/247 (55%), Positives = 159/247 (64%), Gaps = 39/247 (15%)

Query: 184 SYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYP 243
           SYRPLN KDALSYLEQVKFQF+ RPD+YN FLDIMKD+KSQ IDT GVIER+S+LFKGYP
Sbjct: 248 SYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYP 307

Query: 244 NLIQGFNTFLPQGYRIECSNNPNDP--IKVTTPM-------------GSST-------TV 281
            LIQG NTFLPQGY+IEC++NP+DP  IKVTTP              GS+          
Sbjct: 308 VLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAGPAT 367

Query: 282 LNTAPQKSP------SPSDXXXXXXXXXXXXXEAQLQSQATPIPTQHDV----------- 324
           ++T+P + P      S +               AQ Q       TQ ++           
Sbjct: 368 VSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIQKSAQLQQSQQ 427

Query: 325 GQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQV 384
            Q + + +   DVEFS AI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPIHEVY QV
Sbjct: 428 DQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQV 487

Query: 385 TILFQNA 391
           T LFQNA
Sbjct: 488 TSLFQNA 494

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 193 ALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTF 252
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+SLF+  P+L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 253 LP 254
           LP
Sbjct: 505 LP 506

 Score = 36.6 bits (83), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 59  ERIILPSFSSLKTEDNRIDTSMN----PIGPKSITTSSSTPASVGFSVASLDNPLP 110
           + ++LPS S L+T   R +   +    P    +   S+S+  S GFSVASL+NPLP
Sbjct: 162 QHVVLPSLSGLET-GGRAEYGASAQRLPFMQGAAPQSASSGGSKGFSVASLNNPLP 216

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
           (REAL)
          Length = 1566

 Score =  279 bits (714), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 170/264 (64%), Gaps = 38/264 (14%)

Query: 185 YRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPN 244
           YRPLNVKDALSYLEQVKFQF +RPDIYNLFLDIMKDFKSQ IDTPGVIERVS+LF+GYP 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 245 LIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAP-------QKSPSP----- 292
           LIQGFNTFLPQGYRIECS NP+DPI+VTTPMG++T   N +P        + PS      
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348

Query: 293 ------SDXXXXXXXXXXXXXEAQLQSQATP---------------IPTQHDVGQNFGSA 331
                 S              + Q Q Q  P               IP  H + Q    A
Sbjct: 349 GNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLA 408

Query: 332 -----KKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTI 386
                KK  DVEFSQAI+YVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT 
Sbjct: 409 VQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 468

Query: 387 LFQNAXXXXXXXXXXXXXSSASGS 410
           LFQNA             SSAS +
Sbjct: 469 LFQNAPDLLEDFKKFLPDSSASAN 492

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
           {ON} weakly similar to uniprot|P22579 Saccharomyces
           cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  234 bits (597), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 133/327 (40%), Positives = 192/327 (58%), Gaps = 13/327 (3%)

Query: 626 FFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWF-KVFVGY 684
           F    +  + ++ IY EFLK++NLF+  L+ ++    +   + G++  L   F  +   Y
Sbjct: 206 FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265

Query: 685 QDKPKRIENIVHEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGH 743
           +D  +R++  +      D+ D     GPSYK+L   +T   C GRD +C EVLNDEWVGH
Sbjct: 266 KDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGH 325

Query: 744 PVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANMTDAE 803
           PVWASE+ GFIAH+KNQYEETLFK+EEERHEYD+++ S    I         +    D  
Sbjct: 326 PVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDG 385

Query: 804 KAQFRLP----PGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQK 859
           + + R+     P +   S+T  +KVIR++Y  E G  +IDA+   P   VP IL+  K+K
Sbjct: 386 RRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEK 443

Query: 860 DEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNS 919
            ++W  A+ EWNK WR++EQK Y+KSLDHLGL FK A+K+ L  KQL+ E    K D+  
Sbjct: 444 YQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLL 503

Query: 920 KRIHWLTPKPKNQLDYDFPDYDILFDI 946
           K  H+   + K    Y+F D  +L+D+
Sbjct: 504 KE-HYDNYEYK----YEFFDKSVLYDV 525

 Score =  128 bits (321), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 164/316 (51%), Gaps = 14/316 (4%)

Query: 1106 NRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEI--KSRRVTTFAKDLGLIST 1163
            NR   N+F + NI   F ++ TLYER ++VK     I K++  K RR +  AK L L+  
Sbjct: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPM 678

Query: 1164 QLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSF 1223
            QLS+ GL+    D Y+ + T SK+ + G+++HQWFEES+R  + N+A+KLYTID+V+++ 
Sbjct: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738

Query: 1224 VKHAHTLISDSKTSEIM-LLFENQRNNTLTTTK-DQILYRIQCRSHMSSTENMFRIEYKR 1281
            +    T+       +I+ LL +N +   LTTTK  Q+ YR + R  M    +MFR+E  R
Sbjct: 739  LGVITTISQTPSLLQILDLLVDNMKK--LTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVR 796

Query: 1282 EKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFD 1341
            +      QYI +DDL        +   + Y   Y  ++ T+ +  + L  P+      + 
Sbjct: 797  DSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPY------YS 850

Query: 1342 QEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKY--PIVASD 1399
                K    N  +    I K +L ++I+   Y + +  GS D+ S   I K    + +S 
Sbjct: 851  LNLLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKLKSSLKSSR 910

Query: 1400 ESRAANISEKTQEIRK 1415
            +++ A++  K  + RK
Sbjct: 911  KTQMASLISKIAKNRK 926

>TPHA0G02610 Chr7 complement(545411..546379) [969 bp, 322 aa] {ON}
           Anc_2.389 YMR140W
          Length = 322

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 831 KERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLD 887
           +  G  +I+ + N P  ++PI  ++LK  +  +   Q + +K W  +E  +YFK+L+
Sbjct: 130 RNNGIGLINHIKNLPPNNIPIESKKLKADNNCYSPIQEQIDK-WESIENDLYFKALN 185

>KAFR0H01600 Chr8 (296523..299762) [3240 bp, 1079 aa] {ON} Anc_8.473
            YPL022W
          Length = 1079

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 1060 SKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNI 1109
            S +P ++LG  RN G  ED  S  E   + L+ D++DS + E  ++ + I
Sbjct: 608  SYNPEQELGRTRNDGYEEDGDSFEEPDDELLITDIIDSQDTELYLEQKYI 657

>YFR025C Chr6 complement(203743..204750) [1008 bp, 335 aa] {ON}
           HIS2Histidinolphosphatase, catalyzes the eighth step in
           histidine biosynthesis; mutations cause histidine
           auxotrophy and sensitivity to Cu, Co, and Ni salts;
           transcription is regulated by general amino acid control
          Length = 335

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%)

Query: 319 PTQHDVGQNFGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFL 364
           P +  +G+N        +  F   +++  +IKTR+AD+PD+  +F+
Sbjct: 50  PEEQSLGKNPEEVITKLETSFKNFMSHAQEIKTRYADRPDVRTKFI 95

>KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 16/122 (13%)

Query: 1106 NRNIYNLFANTNIYIFFRHLVTLYERLSE----VKQINDEINKEIKSRRVTTFAKDLGLI 1161
            N  +Y +   T    F  +L TLY +L+E    +K +  +I KE+         K   L 
Sbjct: 194  NMGVYKIGLATKQSEFESNLATLYRKLNECEDHLKGVYKDIEKEVGKNNKVEILKKFYLF 253

Query: 1162 STQLSELGLDFNSS-----DAYQQLLTLSKRLIEGDIE--HQWFEESIRQAY-NNRAFKL 1213
              Q+++  + F ++      ++ Q L  + R+I  D    H W    +R  Y N++AF+L
Sbjct: 254  GNQITDTDIRFYTTAIRFDSSHAQHLKCNWRIIRDDYPYIHLW----LRNLYWNHKAFRL 309

Query: 1214 YT 1215
             T
Sbjct: 310  TT 311

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 154,845,209
Number of extensions: 7087899
Number of successful extensions: 22304
Number of sequences better than 10.0: 91
Number of HSP's gapped: 23040
Number of HSP's successfully gapped: 158
Length of query: 1493
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1370
Effective length of database: 39,377,481
Effective search space: 53947148970
Effective search space used: 53947148970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)