Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0E01397g8.323ON57557519810.0
TDEL0F044908.323ON5101826871e-82
KAFR0B057208.323ON4841686762e-81
NCAS0B035708.323ON5191836757e-81
ZYRO0F10384g8.323ON5581846719e-80
Skud_4.4048.323ON5351706645e-79
Smik_4.3898.323ON5252216627e-79
Suva_2.3068.323ON5411816638e-79
YDR145W (TAF12)8.323ON5391806629e-79
SAKL0H15554g8.323ON5361736472e-76
Kpol_543.638.323ON5851766441e-75
TPHA0A015608.323ON5401816367e-75
KLTH0G12298g8.323ON5001686302e-74
Ecym_42548.323ON5291846234e-73
NDAI0J010208.323ON6381686262e-72
Kwal_56.239168.323ON4991686153e-72
AGL195C8.323ON5541976106e-71
KLLA0D16368g8.323ON5111705953e-69
KNAG0I008908.323ON5081705719e-66
TBLA0A039408.323ON7521685664e-63
TBLA0H012808.323ON4051173352e-33
YEL023C1.460ON68278723.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0E01397g
         (575 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   767   0.0  
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   269   1e-82
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   265   2e-81
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   264   7e-81
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   263   9e-80
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   260   5e-79
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   259   7e-79
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   259   8e-79
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   259   9e-79
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   253   2e-76
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   252   1e-75
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   249   7e-75
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   247   2e-74
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   244   4e-73
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   245   2e-72
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   241   3e-72
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   239   6e-71
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   233   3e-69
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   224   9e-66
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   222   4e-63
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   133   2e-33
YEL023C Chr5 complement(108504..110552) [2049 bp, 682 aa] {ON} P...    32   3.6  

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/575 (70%), Positives = 405/575 (70%)

Query: 1   MSSQNSAQDSKNDNTSAXXXXXXXXXKSAIQQKQIQELTARFKQLVTEAKKVGETTPRGX 60
           MSSQNSAQDSKNDNTSA         KSAIQQKQIQELTARFKQLVTEAKKVGETTPRG 
Sbjct: 1   MSSQNSAQDSKNDNTSAPSGSGGPPSKSAIQQKQIQELTARFKQLVTEAKKVGETTPRGK 60

Query: 61  XXXXXXXXXXXVYENYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
                      VYENYT                                           
Sbjct: 61  ELLLQAAKLKAVYENYTRRQQALARAQQLQQQGSNTNAAASSGSSTTGTTGTANSSGSAS 120

Query: 121 XXXXXXXXXXXQLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVE 180
                      QLANIIKQVLTP              VRASAIKDKHTFIKQNIDRLVVE
Sbjct: 121 TSGNNSSNSSAQLANIIKQVLTPEQNQQYEQLLQNFQVRASAIKDKHTFIKQNIDRLVVE 180

Query: 181 INKQTDEEAKKQLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNPXXXXXX 240
           INKQTDEEAKKQLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP      
Sbjct: 181 INKQTDEEAKKQLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNPALQRLL 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXIPQSVGEAPPTNMGQQQM 300
                                       P             IPQSVGEAPPTNMGQQQM
Sbjct: 241 QRSTQQQRMMQQKKQPQPAQPQVQSQAMPGAQSQANANGQAAIPQSVGEAPPTNMGQQQM 300

Query: 301 PTTATGANISTPSGQQPVQGNTQDPKTQIKTEVGTPAPGSQKGGRPAQPQQTPSGRGQTA 360
           PTTATGANISTPSGQQPVQGNTQDPKTQIKTEVGTPAPGSQKGGRPAQPQQTPSGRGQTA
Sbjct: 301 PTTATGANISTPSGQQPVQGNTQDPKTQIKTEVGTPAPGSQKGGRPAQPQQTPSGRGQTA 360

Query: 361 SQQSPXXXXXXXXXXXXXXXXXXXXIFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDG 420
           SQQSP                    IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDG
Sbjct: 361 SQQSPVTGVNAAASSAGSSTVTKSSIFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDG 420

Query: 421 SAMNAAALNTPVMTTLPPYEIDTDRVMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXX 480
           SAMNAAALNTPVMTTLPPYEIDTDRVMSKRKLRELVKSIGIDEGDGETVI          
Sbjct: 421 SAMNAAALNTPVMTTLPPYEIDTDRVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLD 480

Query: 481 XXXXFVTNVTGFACRLAKHRKSDNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASP 540
               FVTNVTGFACRLAKHRKSDNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASP
Sbjct: 481 LADDFVTNVTGFACRLAKHRKSDNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASP 540

Query: 541 AYAQKLTSINADKQAISTASANAVSNKKKPANFQK 575
           AYAQKLTSINADKQAISTASANAVSNKKKPANFQK
Sbjct: 541 AYAQKLTSINADKQAISTASANAVSNKKKPANFQK 575

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  269 bits (687), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 145/182 (79%), Gaps = 3/182 (1%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK SDP VPI++TV+ K P P+ +++NRPT++ G+AMNAAALNTP MT LPPYE+DT+R
Sbjct: 326 IFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTER 385

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVK++GIDEGDGETVI              FV+NVTGFACRLAKHRKSDNL
Sbjct: 386 VMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNL 445

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQAISTASANAVS 565
           +  DIQLHLERNWNIRIPGYSADEIRS  KWN  P+Y QK+ +IN+DK   +T++ NA S
Sbjct: 446 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQKMQAINSDK---ATSAKNASS 502

Query: 566 NK 567
            K
Sbjct: 503 GK 504

 Score =  153 bits (386), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 103/204 (50%)

Query: 31  QQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENYTXXXXXXXXXXXXX 90
           QQ+Q+ ELT +F+ LV EAK VGE TPRG            +Y+NY              
Sbjct: 23  QQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNRQRQQAAQAFVQG 82

Query: 91  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTPXXXXXXX 150
                                                    QLANIIKQVLTP       
Sbjct: 83  RNGGTPGANPASSGSTGSVGAVNAAGSSSSGSSQQSRSSGSQLANIIKQVLTPEQNQQFE 142

Query: 151 XXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKKQLNEKKTELLRNIKAIRLE 210
                   RA++I+DKHTF+KQ+I+RL  E++KQTD  AKKQL EKKTEL  N+K + +E
Sbjct: 143 ALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTELANNLKMLNME 202

Query: 211 HQALQQELQNGKKNFYLECARQNP 234
           + ALQQE QNGKK FY+ECAR NP
Sbjct: 203 YGALQQEFQNGKKKFYVECARHNP 226

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  265 bits (676), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 122/168 (72%), Positives = 135/168 (80%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK SDP VPI++++S K P P+ +R NRPTIS GSAMNAAALNTP+MT LPPYE+DT+R
Sbjct: 298 IFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTER 357

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVK+IGIDEGDGETVI              FVTNVT FAC+LAKHRKSDNL
Sbjct: 358 VMSKRKLRELVKTIGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACKLAKHRKSDNL 417

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK 553
           E  DIQLHLERNWNIRIPGYSADEIRS  KWN + +Y QKL SIN DK
Sbjct: 418 ETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDK 465

 Score =  146 bits (369), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 101/203 (49%), Gaps = 11/203 (5%)

Query: 32  QKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENYTXXXXXXXXXXXXXX 91
           QKQ+ EL+ARFK LV EAKKVGETTP G            +Y+NY               
Sbjct: 25  QKQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNKQKQEAMAQAQARN 84

Query: 92  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTPXXXXXXXX 151
                                                   Q A +I+Q LTP        
Sbjct: 85  NNANTANVNSSSSANSTEANTSGRSGSSA-----------QFATLIRQALTPEQNQQYDK 133

Query: 152 XXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKKQLNEKKTELLRNIKAIRLEH 211
                  RA+ IKDKHTF+KQNIDRLV EI KQTD  AKKQL+EK+ EL+ N+KAI +E+
Sbjct: 134 LVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIELMTNLKAISVEY 193

Query: 212 QALQQELQNGKKNFYLECARQNP 234
             LQQ+  NGKK FY+ECA++NP
Sbjct: 194 TNLQQQYNNGKKAFYIECAKKNP 216

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  264 bits (675), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 122/183 (66%), Positives = 142/183 (77%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK SDP VP++DT+S K P  + +RSNRPT++ GSAM+A+ALNTPVMT LPPYE+DT+R
Sbjct: 335 IFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSAMSASALNTPVMTKLPPYELDTER 394

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVKSIGIDEGDGETVI              F+TNVT FACRLAKHRKSDNL
Sbjct: 395 VMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMADDFITNVTSFACRLAKHRKSDNL 454

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQAISTASANAVS 565
           E  DIQLHLERNW+IRIPGYSADEIRS+ KWN +  Y QKL  IN DK   ++ ++   S
Sbjct: 455 EARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTYNQKLQQINNDKNNAASGNSTTAS 514

Query: 566 NKK 568
           +KK
Sbjct: 515 SKK 517

 Score =  122 bits (305), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 132 QLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDE-EAK 190
           QLANI++QVLT                RASA+KDKHTF+KQNI+RL  EINKQ D   A+
Sbjct: 120 QLANIMRQVLTDEQNANFDKLDQTFRSRASALKDKHTFLKQNIERLTQEINKQADNVNAR 179

Query: 191 KQLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
           KQL EK+ ELLRN+KAI +EH  L Q+ QNGKK FY+ECA+ NP
Sbjct: 180 KQLEEKRGELLRNLKAITMEHNTLYQKYQNGKKAFYIECAKTNP 223

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 29/47 (61%)

Query: 30 IQQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENY 76
          +Q  QI+ELTA+FK LV EAK+VGE T RG            +Y+NY
Sbjct: 21 LQPNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNY 67

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  263 bits (671), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 144/184 (78%), Gaps = 2/184 (1%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK SDP VPI++ V+VK P P+A++SNRPT++ G+AMNA+ LNTP +T LPPYE+DT+R
Sbjct: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVK++GID+GDGETVI              FVTNVTGFACRLAKHRKSDNL
Sbjct: 429 VMSKRKLRELVKTVGIDDGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNL 488

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK--QAISTASANA 563
           +  DIQLHLERNWNIRIPGYSADEIRS  KWN S +Y QK+ SIN DK   A ++A+   
Sbjct: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGG 548

Query: 564 VSNK 567
            SNK
Sbjct: 549 ASNK 552

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 69/102 (67%)

Query: 133 LANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKKQ 192
           LANIIKQVLTP               R + I+DKH F++Q+++ L  EINK+T+  AKKQ
Sbjct: 139 LANIIKQVLTPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQ 198

Query: 193 LNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
           L +KK ELL N+K++ +E+  L+QE  NGKK FY+ECAR NP
Sbjct: 199 LEDKKMELLTNLKSLNMEYSVLRQEFTNGKKKFYVECARHNP 240

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%)

Query: 30 IQQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENYT 77
          +Q +Q+ EL  +F+QLVTE+K VGE T RG            VY NY+
Sbjct: 34 LQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYS 81

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  260 bits (664), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 135/170 (79%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK ++P +PI++ +S K P P+A+RSNRPT++ GSAMNA+ALNTPV T LPPYE+DT R
Sbjct: 350 IFKQTEPAIPISENISTKAPAPVAYRSNRPTVTGGSAMNASALNTPVTTKLPPYEMDTQR 409

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVK++GIDEGDGETVI              FVTNVT FACRLAKHRKSDNL
Sbjct: 410 VMSKRKLRELVKTVGIDEGDGETVIDGDVEDLLLDLADDFVTNVTAFACRLAKHRKSDNL 469

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQA 555
           E  DIQLHLERNWNIRIPGYSADEIRS  KWN S +Y QKL +I +DK A
Sbjct: 470 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNITSDKVA 519

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 67/103 (65%)

Query: 132 QLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKK 191
           + +N+IKQVLTP              VR ++IK++  F+KQN+DRL  EINKQTDE  K+
Sbjct: 136 KFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEREAFLKQNVDRLEQEINKQTDEGTKQ 195

Query: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
           QL EKK ELL + K +++E+  L    QN KK FY+ECAR NP
Sbjct: 196 QLEEKKNELLNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNP 238

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%)

Query: 30 IQQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENYT 77
          +Q +Q+QE+TA+F+ L+ EA+ VGETTPRG            VY+  T
Sbjct: 33 LQPRQLQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALT 80

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  259 bits (662), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 146/221 (66%), Gaps = 10/221 (4%)

Query: 343 GGRPAQPQQ-------TPSGRG---QTASQQSPXXXXXXXXXXXXXXXXXXXXIFKPSDP 392
             +P Q QQ       TP G G   QT   ++                     IFK ++P
Sbjct: 287 ASKPQQQQQNTLPGTNTPRGNGNAPQTEQSKAKVTNVNATASMMNNVSSSKSAIFKQTEP 346

Query: 393 TVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDRVMSKRKL 452
            +PI++ +S K P P+A+RSNRPTI+ GSAMNA+ALNTP  T LPPYE+DT RVMSKRKL
Sbjct: 347 AIPISENISAKAPAPVAYRSNRPTITGGSAMNASALNTPAATKLPPYEMDTQRVMSKRKL 406

Query: 453 RELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNLEPTDIQL 512
           RELVK++GIDEGDGETVI              FVTNVT F+CRLAKHR+SDNLE  DIQL
Sbjct: 407 RELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRRSDNLEARDIQL 466

Query: 513 HLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK 553
           HLERNWNIRIPGYSADEIRS  KWN S +Y QKL SI +DK
Sbjct: 467 HLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQSITSDK 507

 Score =  127 bits (318), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 98/207 (47%), Gaps = 2/207 (0%)

Query: 30  IQQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENYTXXXXXXXXXXXX 89
           +Q +Q+QE+TA+F  L+TEA+ VGETTPRG            VY+  T            
Sbjct: 33  LQPRQLQEMTAKFTALLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAY 92

Query: 90  XXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTPXXXX 147
                                                       + +++IKQVLTP    
Sbjct: 93  RNASMGNTNSNSNNPVTMSTEKTSNSSQQHQQQHQQQQTRNNSNKFSSMIKQVLTPEENQ 152

Query: 148 XXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKKQLNEKKTELLRNIKAI 207
                      R ++IK+K TF+KQNIDRL  EINKQT+E AK+QL EKK ELL + K +
Sbjct: 153 EYEKLWQNFQARHTSIKEKETFLKQNIDRLEQEINKQTEEGAKQQLQEKKNELLNDWKVL 212

Query: 208 RLEHQALQQELQNGKKNFYLECARQNP 234
           ++E+  L    QN KK FY+ECAR NP
Sbjct: 213 KIEYTKLFNSYQNSKKTFYVECARHNP 239

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  259 bits (663), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 121/181 (66%), Positives = 140/181 (77%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK ++P +PI++ +S K P P+ +RSNRPTI+ GSAMNA ALNTPV T LPPYE+DT R
Sbjct: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVK++GIDEGDGETVI              FVTNVT FACRLAKHRKSDNL
Sbjct: 416 VMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFACRLAKHRKSDNL 475

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQAISTASANAVS 565
           E  DIQLHLERNWNIRIPGYSADEIRS  KWN S +Y QKL +IN+DK A +  + ++V 
Sbjct: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAKNNNSSVP 535

Query: 566 N 566
           N
Sbjct: 536 N 536

 Score =  110 bits (274), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 69/103 (66%)

Query: 132 QLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKK 191
           + +N+IKQVLT               VRA+++K+K TF+KQNIDRLV E+NKQTDE  KK
Sbjct: 131 KFSNMIKQVLTSEENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKK 190

Query: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
           QL +KK ELL N K + +E+  L +  QN KK FY+ECAR NP
Sbjct: 191 QLEDKKNELLNNRKVLGIEYNNLLKGFQNSKKTFYVECARHNP 233

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 30/47 (63%)

Query: 30 IQQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENY 76
          +QQKQ+ E+T +FK LV+EA+ VGETTPRG            VY+ +
Sbjct: 33 LQQKQLLEMTVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAF 79

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  259 bits (662), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 120/180 (66%), Positives = 138/180 (76%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK ++P +PI++ +S K P P+A+RSNRPTI+ GSAMNA+ALNTP  T LPPYE+DT R
Sbjct: 354 IFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQR 413

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVK++GIDEGDGETVI              FVTNVT F+CRLAKHRKSDNL
Sbjct: 414 VMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNL 473

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQAISTASANAVS 565
           E  DIQLHLERNWNIRIPGYSADEIRS  KWN S  Y QKL SI +DK A +  + N V+
Sbjct: 474 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDKVAAAKNNGNNVA 533

 Score =  107 bits (267), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%)

Query: 132 QLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKK 191
           + +N+IKQVLTP              VR ++IK+K T++KQNIDRL  EINKQTDE  K+
Sbjct: 131 KFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQ 190

Query: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
           QL EKK ELL + K +++E+  L    QN KK FY+ECAR NP
Sbjct: 191 QLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNP 233

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%)

Query: 29 AIQQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENYT 77
           +Q +Q+QE+ A+F+ L+TEA+ VGETTPRG            VY+  T
Sbjct: 32 VLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALT 80

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  253 bits (647), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 136/173 (78%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK  +P++P+++ V+ K P  +A+RSNRPTI+ GSAMNAAALNTPVMT LPPYE+D++R
Sbjct: 328 IFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVDSER 387

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVKS+G+DEGDGET I              F++NVTGFACRLAKHRKSDNL
Sbjct: 388 VMSKRKLRELVKSVGVDEGDGETTIDGDVEELLLDLADDFISNVTGFACRLAKHRKSDNL 447

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQAIST 558
           +  DIQLHLERNWNIRIPGYSADEIRS  KWN++  Y QKL  INA K   +T
Sbjct: 448 DVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGINAAKAVKTT 500

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 137 IKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEI-NKQTDEEAKKQLNE 195
           I+ +LTP                A  I+ +  ++++NI+ L  EI N++++  A ++L  
Sbjct: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179

Query: 196 KKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
            K EL+  ++ +    QAL Q+    KK FY+ECA  NP
Sbjct: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNP 218

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  252 bits (644), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 138/176 (78%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK SDP+VPI+++++VK PE +++ SNRP+++ G+AMNA+ LNTP +T LPPYEIDT+R
Sbjct: 397 IFKQSDPSVPISESITVKAPEAVSYISNRPSLTGGTAMNASVLNTPTITKLPPYEIDTER 456

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLREL+KS+GIDEGDGETVI              FVTNVT FACRLAKHRKSD+L
Sbjct: 457 VMSKRKLRELIKSVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKSDSL 516

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQAISTASA 561
           E  DIQLHLERNWNIRIPGYS DEIRS  KW  + +Y+QK+ SIN +K  I+  S 
Sbjct: 517 EARDIQLHLERNWNIRIPGYSGDEIRSTRKWIPTQSYSQKMQSINNEKSNIAKNSG 572

 Score =  114 bits (285), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (69%)

Query: 132 QLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKK 191
           QLA++IKQVLTP               RAS+IKD+HTF+KQ+IDRL  EIN+QTDE AKK
Sbjct: 130 QLADLIKQVLTPEENQQYDKLLQNFQSRASSIKDQHTFLKQHIDRLSQEINQQTDEAAKK 189

Query: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
           QL   + ELL N++ +  E+  L ++++N KK FY+ECARQNP
Sbjct: 190 QLEVNRAELLTNLRTLNTEYSNLYEDIKNKKKAFYVECARQNP 232

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 22/38 (57%)

Query: 39 TARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENY 76
          T +FK+LV EAK+VG+ T RG            VY+NY
Sbjct: 31 TTKFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNY 68

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  249 bits (636), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 117/181 (64%), Positives = 138/181 (76%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK SDPTVPI+D V+++P E I ++SNRP+++ G+AM+AAALN P +TTLPPYEIDT+R
Sbjct: 354 IFKQSDPTVPISDNVTLEPTELIPYKSNRPSLTGGAAMSAAALNVPPLTTLPPYEIDTER 413

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VM+KRKLREL+K++GIDEGDGETVI              FVTNVT FACRLAKHRKS+NL
Sbjct: 414 VMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKSENL 473

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQAISTASANAVS 565
           E  DIQLHLERNWNIRIPGYS DEIRS  KW  + A++QKL SIN DK   S  S     
Sbjct: 474 ESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQKLQSINNDKSNPSNTSKTTAK 533

Query: 566 N 566
           N
Sbjct: 534 N 534

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 132 QLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKK 191
           Q+ANIIKQ+LT                + ++IKDKH F+KQNID+L  EIN  ++     
Sbjct: 147 QIANIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNNDVN 206

Query: 192 Q---LNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
               L  K+ EL+ N+K + LE   + +E +N KK FY+ECA+QNP
Sbjct: 207 VKKNLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNP 252

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 33/51 (64%)

Query: 27 KSAIQQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENYT 77
          K A+QQKQ+ ELT +FKQLV EAK VGE TPRG            +YEN+T
Sbjct: 22 KLALQQKQLIELTNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYENFT 72

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  247 bits (630), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 131/168 (77%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK  +P+VP+++T++ + P P+  RSNRPTI+ GSAMNAAAL TPVMT LPPYE+D +R
Sbjct: 305 IFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVKS+GIDEGDGET I              F+TNVT FACRLAKHRKSDNL
Sbjct: 365 VMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 424

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK 553
           +  DIQLHLERNWNIRIPGY+ADE+RS  KWN + +Y QKL  IN+ K
Sbjct: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGINSAK 472

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 53/103 (51%), Gaps = 1/103 (0%)

Query: 133 LANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINK-QTDEEAKK 191
           +++ I+ +LTP                   IK ++T++K+ I+ L  EI K Q D    K
Sbjct: 112 MSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVK 171

Query: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
           QL   KTE+L  ++     + AL Q+L+  KK FY+ECA  NP
Sbjct: 172 QLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNP 214

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  244 bits (623), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 117/184 (63%), Positives = 138/184 (75%), Gaps = 3/184 (1%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK  +P++PI ++VS      +++RSNRPTI+ GSAMNAAAL TPVMT LPPYE+D++R
Sbjct: 329 IFKQPNPSIPIPESVSPISTTSVSYRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDSER 388

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVKS+GID+GDGET I              F+TNVT FACRLAKHRKSDNL
Sbjct: 389 VMSKRKLRELVKSVGIDDGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 448

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKL---TSINADKQAISTASAN 562
           +  DIQLHLERNWNIR PGYSADEIRS  KWN++PAY QK+   TS  A K + + AS N
Sbjct: 449 DVRDIQLHLERNWNIRTPGYSADEIRSTKKWNSTPAYGQKMQVITSAKAAKLSPTAASTN 508

Query: 563 AVSN 566
             SN
Sbjct: 509 VNSN 512

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (52%), Gaps = 1/102 (0%)

Query: 133 LANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEI-NKQTDEEAKK 191
           +A+ IK +L P                A  IK ++ F+K+NI+ L  EI N+Q++    +
Sbjct: 129 VASNIKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPITVR 188

Query: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQN 233
           QL  KK ELL  + ++  + Q L ++ Q  KK FY+ECA  N
Sbjct: 189 QLESKKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATN 230

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%)

Query: 35 IQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENY 76
          +Q+L  +F  LV EA++VG  TP G            +YE Y
Sbjct: 20 LQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYETY 61

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  245 bits (626), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 114/168 (67%), Positives = 131/168 (77%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           +FKP++P V I+DT+S K P  + +RSNRP+++ GSAMNA+AL TPV T LPPYEIDT+R
Sbjct: 439 MFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMNASALTTPVATKLPPYEIDTER 498

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVKSIG+DEGDGETVI              FVTNVT FACRLAKHR SD+L
Sbjct: 499 VMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRNSDSL 558

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK 553
           EP DIQLHLE+NWNIRIPGYSADEIRS+ KW+    Y QKL  IN DK
Sbjct: 559 EPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQKLQHINNDK 606

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 67/104 (64%), Gaps = 1/104 (0%)

Query: 132 QLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINK-QTDEEAK 190
           QLA+I+KQVLTP               RA+AIK+KH+F+KQNI+RL  E+NK   D   K
Sbjct: 162 QLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNKPNLDPNLK 221

Query: 191 KQLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
            QL  KKTEL   I+AI +EH  L Q+ Q G+K FY+ECA+ NP
Sbjct: 222 TQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNP 265

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 30 IQQKQIQELTARFKQLVTEAKKV-GETTPRGXXXXXXXXXXXXVYENY 76
          +Q  Q+ EL+ +FK LV EAK++ G+ + RG            +Y+ Y
Sbjct: 36 LQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTY 83

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  241 bits (615), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 130/168 (77%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK  +P+VP+++T++ K P  +  RSNRPTI+ GSAMNAAAL TPVMT LPPYE+D +R
Sbjct: 305 IFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVKS+GIDEGDGET I              F+TNVT FACRLAKHRKSDNL
Sbjct: 365 VMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 424

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK 553
           +  DIQLHLERNWNIRIPGY+ADE+RS  KWN + +Y QKL  IN+ +
Sbjct: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSAR 472

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 137 IKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAK-KQLNE 195
           I+ +LTP                   IK ++T++K+ I+ L  EI K+  + A  KQL  
Sbjct: 116 IQNLLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEA 175

Query: 196 KKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
            K E+L  +K     + AL Q+L+  KK FY+ECA  NP
Sbjct: 176 NKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNP 214

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  239 bits (610), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 114/197 (57%), Positives = 142/197 (72%), Gaps = 14/197 (7%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK  +P++PI + ++      +++RSNRPTI+ GSAMNA+AL  PVMT LPPYE+D++R
Sbjct: 358 IFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSER 417

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVK++GID+GDGET +              F+TNVT FACRLAKHRKSDNL
Sbjct: 418 VMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 477

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQA---------I 556
           +  DIQLHLERNWNIRIPGY+ADEIRS  KWN +PAY+QKL  I++ + A         +
Sbjct: 478 DVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISSARAAKLAPATTANV 537

Query: 557 STASANAV-----SNKK 568
           +T SANA      SNKK
Sbjct: 538 TTGSANAAAVATESNKK 554

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 133 LANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEI-NKQTDEEAKK 191
           +A+ IK +LTP                   I  ++ F+K+NI+ L  EI N+Q +    K
Sbjct: 158 VASNIKMLLTPQQREAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVK 217

Query: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQN 233
           QL  KK ELL  +  +  + QAL ++ Q  KK FY+ECA  N
Sbjct: 218 QLETKKNELLTKLTGLNTQFQALPKKFQEDKKKFYIECAATN 259

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 35  IQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENY 76
           +++L  +F+ LV+EA++VG  TP G            +YE Y
Sbjct: 80  MRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY 121

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  233 bits (595), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 130/170 (76%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK  +P++PI++ V+  P   +++RSNRPTI+ GS MNA AL TPVMT LPPYE+DT+R
Sbjct: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VMSKRKLRELVK++GIDEGDGET I              F+TNVT FAC+LAKHRKSD+L
Sbjct: 395 VMSKRKLRELVKTVGIDEGDGETTIDGDVEELLLDLADDFITNVTNFACKLAKHRKSDSL 454

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQA 555
           +  DIQ+HLERNWNIRIPG++ DEIRS  KWN +P+Y Q + +IN +K A
Sbjct: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTA 504

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 74/200 (37%), Gaps = 8/200 (4%)

Query: 35  IQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENYTXXXXXXXXXXXXXXXXX 94
           +Q+L  R K LV EAK++G  T  G            +YE Y+                 
Sbjct: 18  MQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRQQQAQAQAGAQGAV 77

Query: 95  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLANIIKQVLTPXXXXXXXXXXX 154
                                                 + N IK +LTP           
Sbjct: 78  NNNATNVKSMDQQQQQQQQQQQQQATASSN-------NVTNNIKVLLTPQQREAYNRLVQ 130

Query: 155 XXXVRASAIKDKHTFIKQNIDRLVVEI-NKQTDEEAKKQLNEKKTELLRNIKAIRLEHQA 213
                   IK +  F+K+NI  L  EI N++ +  + +QL   + ELL  I+A+  ++  
Sbjct: 131 KYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYST 190

Query: 214 LQQELQNGKKNFYLECARQN 233
           LQQ+ Q  ++ FY+EC++ N
Sbjct: 191 LQQKYQEDRRKFYIECSQTN 210

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  224 bits (571), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 100/170 (58%), Positives = 125/170 (73%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK S+P+VPI +++    P  +A++ NRPTI+ GS MNA ALNTPV   +P YE DTDR
Sbjct: 323 IFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEADTDR 382

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           V+SKRKLRELV+++G+DEGDGETV+              FV++VT FACRLAKHR SD+L
Sbjct: 383 VLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGSDSL 442

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQA 555
           E  D+QLHLERNWNIR+PGY+ DEIRS  KWN + AY QKL +I  D+ A
Sbjct: 443 EARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAIAQDRTA 492

 Score =  102 bits (253), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 67/103 (65%)

Query: 132 QLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKK 191
           QLA  ++Q LTP               +A +I+DKH ++KQNID+L  EINKQ D  AK+
Sbjct: 114 QLAMAMRQALTPEQVQQYDKIATNFQNKAKSIRDKHNYLKQNIDKLTAEINKQQDRSAKQ 173

Query: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
           QL EK+ ELLR+++ + +EH +L+   Q  +KNFY+ECA+ NP
Sbjct: 174 QLAEKRNELLRSVRQLTVEHNSLKVNFQLSRKNFYVECAKLNP 216

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 9  DSKNDNTSAXXXXXXXXXKSA-IQQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXX 67
          D+ N N S           SA   Q+Q+ EL  RFK  V EAK+VGETT  G        
Sbjct: 3  DANNGNDSGAATPASPAAGSASTPQQQLVELAQRFKLFVGEAKRVGETTEAGKQLLVRAA 62

Query: 68 XXXXVYEN 75
              VY++
Sbjct: 63 KIKAVYDS 70

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  222 bits (566), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 127/168 (75%)

Query: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445
           IFK ++P +PI++ ++ K PE I +R+NRPT++ G+AMN + LNTPV+T LPPYEIDT R
Sbjct: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625

Query: 446 VMSKRKLRELVKSIGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 505
           VM KRKL+E+V+S+G+D+GDGETVI              FVT+VT FAC++AKHRKSD+L
Sbjct: 626 VMLKRKLKEVVRSVGVDDGDGETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685

Query: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK 553
           +  DIQLHLE+NWNIRIP YS D IRS  KWN + +Y QKL S+N  K
Sbjct: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLNPGK 733

 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 66/104 (63%), Gaps = 1/104 (0%)

Query: 132 QLANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINK-QTDEEAK 190
           QLAN IKQ+LTP              +RA+ IK+KH F+KQ+I R   E+NK       +
Sbjct: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288

Query: 191 KQLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
            +L +KK EL+ N+KAI +++  L QE QNGKK+FY+ CARQNP
Sbjct: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNP 332

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 29/47 (61%)

Query: 30  IQQKQIQELTARFKQLVTEAKKVGETTPRGXXXXXXXXXXXXVYENY 76
           +QQKQ+ EL A+FK LV EAKKVGE T RG            +Y+N+
Sbjct: 56  LQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNF 102

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  133 bits (335), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 80/117 (68%), Gaps = 1/117 (0%)

Query: 439 YEIDTDRVMSKRKLRELVKSIGIDEGDGETV-IXXXXXXXXXXXXXXFVTNVTGFACRLA 497
           YE++++RV+SKRKLRELV+S+ IDE D + + I              FV+N+T F+CRL+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 498 KHRKSDNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQ 554
           +HR S+ +   DIQLH+ERNWNIR+PG++ADEI+S  KW +S  Y   L S+N  K 
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVNLAKH 390

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (3%)

Query: 133 LANIIKQVLTPXXXXXXXXXXXXXXVRASAIKDKHTFIKQNIDRLVVEINKQTD-EEAKK 191
           L+ +IK  LTP              +RA+ IK +H+ +K+ ID +   +N +T+ +EA  
Sbjct: 107 LSMMIKNALTPEQNESYETLLKDFQIRAAKIKREHSDVKEKIDNISKLLNSKTNNQEA-- 164

Query: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNP 234
            L  K+ E L  +K +  ++  L Q+ QN KKNFYL+ A+QN 
Sbjct: 165 -LTAKRNEYLFQLKKLSKDYTELHQQFQNEKKNFYLKSAKQNS 206

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 29 AIQQKQIQELTARFKQLVTEAK-KVGETTPRG 59
          A QQKQ+ EL   FK L+ +AK   G+TT +G
Sbjct: 9  AQQQKQLNELAENFKNLIKDAKLNGGDTTEKG 40

>YEL023C Chr5 complement(108504..110552) [2049 bp, 682 aa] {ON}
           Putative protein of unknown function; expression is
           increased greatly during sporulation; YEL023C is not an
           essential gene
          Length = 682

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 7/78 (8%)

Query: 160 ASAIKDKHTFIKQN----IDRLVVEINKQTDEEAKKQLNEKKTELLRNIKAIRLEHQALQ 215
            S   D H ++  N       L V  N+    E K   NE+  + L+NIK  RL   +L+
Sbjct: 440 GSLFADTHDYLSFNSPKKCSLLGVSDNEDGAREDKSGRNERMEDCLKNIKETRL---SLK 496

Query: 216 QELQNGKKNFYLECARQN 233
            E +  K  F L+C   N
Sbjct: 497 DEKEKVKDAFTLKCGHAN 514

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,427,132
Number of extensions: 1483247
Number of successful extensions: 6571
Number of sequences better than 10.0: 56
Number of HSP's gapped: 6832
Number of HSP's successfully gapped: 94
Length of query: 575
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 460
Effective length of database: 40,294,809
Effective search space: 18535612140
Effective search space used: 18535612140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)