Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0D05148g7.195ON1081085626e-76
ZYRO0D15818g7.195ON1181122478e-28
KLTH0E04576g7.195ON115952451e-27
TDEL0H025207.195ON1191122338e-26
Kpol_1063.107.195ON1221092312e-25
KAFR0G029907.195ON1101062293e-25
NCAS0E018207.195ON1141102284e-25
TPHA0C045207.195ON1351072201e-23
Kwal_55.20373singletonOFF115982154e-23
Kwal_YGOB_ADL119W7.195ON115982154e-23
Ecym_43817.195ON1201031903e-19
KLLA0D16192g7.195ON121931852e-18
ADL119W7.195ON185981865e-18
KNAG0L012307.195ON1281021826e-18
SAKL0F07480g7.195ON113971809e-18
Scer_YGOB_ADL119W (ADL119W)7.195ON96951744e-17
TBLA0J015107.195ON107981745e-17
NDAI0G019907.195ON101811675e-16
Skud_6.1257.195ON225951677e-15
Suva_6.1147.195ON26895968e-05
Suva_3.846.313ON52745651.2
TBLA0E037402.232ON250940641.8
SAKL0B08624g3.393ON45454614.4
NCAS0G001602.232ON245153607.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D05148g
         (108 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {O...   221   6e-76
ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON} conse...   100   8e-28
KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {O...    99   1e-27
TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON...    94   8e-26
Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON...    94   2e-25
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    93   3e-25
NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON...    92   4e-25
TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.19...    89   1e-23
Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {O...    87   4e-23
Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa...    87   4e-23
Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON} ...    78   3e-19
KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON} conse...    76   2e-18
ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...    76   5e-18
KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.1...    75   6e-18
SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserv...    74   9e-18
Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON} ANN...    72   4e-17
TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {O...    72   5e-17
NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON...    69   5e-16
Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)         69   7e-15
Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)         42   8e-05
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...    30   1.2  
TBLA0E03740 Chr5 complement(932793..940322) [7530 bp, 2509 aa] {...    29   1.8  
SAKL0B08624g Chr2 complement(733369..734733) [1365 bp, 454 aa] {...    28   4.4  
NCAS0G00160 Chr7 complement(13871..21226) [7356 bp, 2451 aa] {ON...    28   7.5  

>CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {ON}
           some similarities with KLLA0D16192g Kluyveromyces lactis
           and DEHA0C08349g Debaryomyces hansenii
          Length = 108

 Score =  221 bits (562), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 108/108 (100%), Positives = 108/108 (100%)

Query: 1   MNGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMPF 60
           MNGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMPF
Sbjct: 1   MNGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMPF 60

Query: 61  IQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRLPGGKTATI 108
           IQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRLPGGKTATI
Sbjct: 61  IQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRLPGGKTATI 108

>ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON}
           conserved hypothetical protein
          Length = 118

 Score = 99.8 bits (247), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 71/112 (63%), Gaps = 12/112 (10%)

Query: 1   MNGVIKIPDTRFEQTFRRAIDREVAKQNALSGKS--TDD-------KKSGP---SAYVIC 48
           M+G+  IPDTRFE TF+RA++RE  KQ  L  K    +D       +K+ P   ++YV+C
Sbjct: 1   MSGLYPIPDTRFESTFKRALNREAEKQRTLQWKKMGVEDPLVINQLQKNQPVKINSYVVC 60

Query: 49  KVVVRDVLLMPFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL 100
           KVV RDV+ MP +Q +LWT  L+ +KPWLR V+  GR+ G ++ R + G  L
Sbjct: 61  KVVARDVIFMPLVQGLLWTSLLITMKPWLRSVIQNGRKFGTFIYRTVLGTDL 112

>KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {ON}
           conserved hypothetical protein
          Length = 115

 Score = 99.0 bits (245), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 64/95 (67%), Gaps = 2/95 (2%)

Query: 5   IKIPDTRFEQTFRRAIDREVAK-QNALS-GKSTDDKKSGPSAYVICKVVVRDVLLMPFIQ 62
           + +PD RFEQTF+RA+ RE +K Q A S G ST D  +  SA VICKVV+RDVLLMPF+Q
Sbjct: 13  VAVPDLRFEQTFQRALRREASKNQKATSQGHSTTDADATISASVICKVVLRDVLLMPFLQ 72

Query: 63  SVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYG 97
            +LWT  L+ LKPWL MV   G+  G  +   + G
Sbjct: 73  GILWTSALIALKPWLHMVRIRGQLVGHRIYEMVLG 107

>TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 119

 Score = 94.4 bits (233), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 65/112 (58%), Gaps = 12/112 (10%)

Query: 1   MNGVIKIPDTRFEQTFRRAIDREVAKQNALSGKS---------TDDKKSGP---SAYVIC 48
           M+    +PDTRFEQTFRRA+ RE  K  A   +           + +K+ P   S  V+C
Sbjct: 1   MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC 60

Query: 49  KVVVRDVLLMPFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL 100
           KVV+RDV+ MP +Q +LWTG L+ +KPWL+  V  GRR G  + R + G  L
Sbjct: 61  KVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDL 112

>Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON}
           complement(28076..28444) [369 nt, 123 aa]
          Length = 122

 Score = 93.6 bits (231), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 11/109 (10%)

Query: 7   IPDTRFEQTFRRAIDREVAKQNALS----GKSTDD-----KKSGP--SAYVICKVVVRDV 55
           +PD RFE+TF RAI++E  KQ   S    G +TD+     +   P  + Y++ KV+VRD+
Sbjct: 12  VPDVRFEETFNRAINKEAEKQREYSLKKKGLTTDEISKIKENEAPEVTTYIVWKVIVRDM 71

Query: 56  LLMPFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRLPGGK 104
           L+MPFIQ ++++G L+ LKPWLR VVG GRR G ++   + G  L   K
Sbjct: 72  LIMPFIQGIMFSGLLIILKPWLRSVVGNGRRFGTFIYNTVLGKNLTKTK 120

>KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 110

 Score = 92.8 bits (229), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 5/106 (4%)

Query: 1   MNGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTD-DKKSGPSAYVICKVVVRDVLLMP 59
           +N  + IPDTRF   FR+A+ +E+ KQ     K TD D K      +ICKV+ RDV+LMP
Sbjct: 8   INNNLAIPDTRFGYVFRKAVQKELRKQ----VKETDSDNKHINKNLIICKVIARDVILMP 63

Query: 60  FIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRLPGGKT 105
           FIQS+LWTGFL+  KP LR  + F +R G  +  ++  G +   KT
Sbjct: 64  FIQSILWTGFLISFKPCLRGFIRFCQRLGPMIKGSILEGNIGKSKT 109

>NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON}
           Anc_7.195
          Length = 114

 Score = 92.4 bits (228), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 67/110 (60%), Gaps = 5/110 (4%)

Query: 4   VIKIPDTRFEQTFRRAIDRE----VAKQNALSGKSTDDKKSGPSAYVIC-KVVVRDVLLM 58
           V+ IPD R EQTF+RA+ +E    + K  A   +ST  + +     VIC KV++RD+L+M
Sbjct: 5   VLNIPDLRVEQTFKRAVAKETKEYIIKNKATFPRSTITELTRVEKAVICSKVILRDILVM 64

Query: 59  PFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRLPGGKTATI 108
           PF+QSV WTGFL+ LKPWLR  V FGR+ G      + G  L   K  +I
Sbjct: 65  PFLQSVAWTGFLIVLKPWLRTTVTFGRKMGSSAMDLITGRNLVKSKPKSI 114

>TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 135

 Score = 89.4 bits (220), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 67/107 (62%), Gaps = 11/107 (10%)

Query: 5   IKIPDTRFEQTFRRAIDREVAKQNA--LSGKSTDD------KKSGPSA---YVICKVVVR 53
           +K+PD R EQ+F  A+ +E  KQ    L  +  DD      +K+ P+    Y++ KV++R
Sbjct: 23  LKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVILR 82

Query: 54  DVLLMPFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL 100
           D++LMPFIQ  L+TG L+ +KPWLR VVG GRR G Y+ + + G  L
Sbjct: 83  DMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDL 129

>Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {OFF}
           [contig 149] FULL
          Length = 115

 Score = 87.4 bits (215), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 5   IKIPDTRFEQTFRRAIDREVAKQNALSGKS-TD-DKKSGPSAYVICKVVVRDVLLMPFIQ 62
           + IPD RFEQTF+ A+ RE  K      K+ TD D +S  SA +ICKVV+RDVLL+PF+Q
Sbjct: 13  VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPFLQ 72

Query: 63  SVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL 100
             LWTG L+ ++PWL  V   G + G  +   + G  L
Sbjct: 73  GALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDL 110

>Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 115

 Score = 87.4 bits (215), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 5   IKIPDTRFEQTFRRAIDREVAKQNALSGKS-TD-DKKSGPSAYVICKVVVRDVLLMPFIQ 62
           + IPD RFEQTF+ A+ RE  K      K+ TD D +S  SA +ICKVV+RDVLL+PF+Q
Sbjct: 13  VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPFLQ 72

Query: 63  SVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL 100
             LWTG L+ ++PWL  V   G + G  +   + G  L
Sbjct: 73  GALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDL 110

>Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON}
           similar to Ashbya gossypii ADL119W
          Length = 120

 Score = 77.8 bits (190), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 59/103 (57%), Gaps = 10/103 (9%)

Query: 5   IKIPDTRFEQTFRRAIDREVAKQNA-----LSGK-----STDDKKSGPSAYVICKVVVRD 54
           + IPD RFEQTF  A+ +E  KQ+      L G      S D  +   + +V+ KV+VRD
Sbjct: 6   LAIPDIRFEQTFMVALKKEALKQHQYKIRKLKGSQDIVVSEDFGEPTITTFVVAKVIVRD 65

Query: 55  VLLMPFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYG 97
           V+L+P +  +LWTGFL+ +KPWL+     GRR G  +   + G
Sbjct: 66  VVLLPLVHGMLWTGFLIMMKPWLKACTQNGRRLGAGIYNVIVG 108

>KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON}
           conserved hypothetical protein
          Length = 121

 Score = 75.9 bits (185), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 55/93 (59%), Gaps = 2/93 (2%)

Query: 7   IPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGP--SAYVICKVVVRDVLLMPFIQSV 64
           +PD RFEQTF++++ +E  KQN L+    D     P  + Y++ KVV RD+L+ PF+Q V
Sbjct: 18  LPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQGV 77

Query: 65  LWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYG 97
             + F +  KPWL+     GR  G  + R L+G
Sbjct: 78  FLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFG 110

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score = 76.3 bits (186), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 63/98 (64%), Gaps = 4/98 (4%)

Query: 4   VIKIPDTRFEQTFRRAIDREVAKQNAL----SGKSTDDKKSGPSAYVICKVVVRDVLLMP 59
            I IPD RFEQTFR A+ +E A+Q  L     G++  D ++G SA V+ KVVVRDVLLMP
Sbjct: 79  AITIPDVRFEQTFRAALAKESARQRQLRAQKEGEAAADGEAGISALVVAKVVVRDVLLMP 138

Query: 60  FIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYG 97
            +Q  LWTG L+ +KP L + +  GRR  +   RAL G
Sbjct: 139 LVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG 176

>KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 128

 Score = 74.7 bits (182), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (53%), Gaps = 12/102 (11%)

Query: 5   IKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMPFIQSV 64
           IKIP+ RF   F  A+  E A+ N           + P+ +++CKVV +DVLLMPF+QS 
Sbjct: 34  IKIPEMRFNYVFNNALKAEAARHNV----------AEPTTWMVCKVVCKDVLLMPFLQSF 83

Query: 65  LWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL--PGGK 104
           LWT  L+ +K  L+  + + +R    L   + G  +  P GK
Sbjct: 84  LWTALLISMKTPLKNALNYTKRMCSALFTNVSGANMYKPKGK 125

>SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserved
           hypothetical protein
          Length = 113

 Score = 73.9 bits (180), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 62/97 (63%), Gaps = 1/97 (1%)

Query: 5   IKIPDTRFEQTFRRAIDREVAKQNALS-GKSTDDKKSGPSAYVICKVVVRDVLLMPFIQS 63
           I +PDTRFEQTF+ A+ +E  +  A   G +T D  +  +  V+ KVVVRDVLLMP +Q 
Sbjct: 12  IVVPDTRFEQTFKNALKKEAKRMKAARLGITTLDDNAPVTPMVVAKVVVRDVLLMPLVQG 71

Query: 64  VLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL 100
           VLWT FL+ +KPWLR  V  GRR G  + R + G  L
Sbjct: 72  VLWTSFLIAIKPWLRNAVWQGRRFGMSVYRLVLGKDL 108

>Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 96

 Score = 71.6 bits (174), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 58/95 (61%), Gaps = 10/95 (10%)

Query: 2  NGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMPFI 61
          N  + IPD RFE+ F++A+ RE+A  ++LS K          A VI KVVVRDVLLMP +
Sbjct: 10 NKHLNIPDLRFEKVFKKALHRELAPSSSLSRK----------AGVITKVVVRDVLLMPLL 59

Query: 62 QSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALY 96
          QS + +  L+G+K WL  +   GR  G+ + + L+
Sbjct: 60 QSFVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLF 94

>TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 107

 Score = 71.6 bits (174), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 57/98 (58%), Gaps = 6/98 (6%)

Query: 4   VIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVIC--KVVVRDVLLMPFI 61
           VI IPDTRFE TFRR +D+E+ K N  S     D++      ++C  KV+ RDV+ MPF+
Sbjct: 9   VIPIPDTRFESTFRRKLDKELNKNNVNSNSIIKDER---VRKLLCLGKVICRDVIFMPFV 65

Query: 62  QSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGR 99
           Q +   G  + +KPWL  ++  G+  G      L+GG+
Sbjct: 66  QGMFMCGAFILIKPWLLKLLRNGKNIGRNF-VELFGGQ 102

>NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON}
          Anc_7.195
          Length = 101

 Score = 68.9 bits (167), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 7/81 (8%)

Query: 5  IKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSG--PSAYVICKVVVRDVLLMPFIQ 62
          I IPDTRF+Q F+ A++RE   +N L   +T          + VI KV++RDV+L+PFIQ
Sbjct: 4  IVIPDTRFQQVFQNALERE---RNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQ 60

Query: 63 SVLWTGFLLGLKPWLRMVVGF 83
          SVLWT FL+  KP  R+  GF
Sbjct: 61 SVLWTEFLIVCKP--RIYRGF 79

>Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)
          Length = 225

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 56/95 (58%), Gaps = 10/95 (10%)

Query: 2   NGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMPFI 61
           N  + IPD RFE+ F++A+ RE+A  +++  K            VI KVVVRDVLLMP +
Sbjct: 139 NRHLNIPDLRFEKVFKKALHRELAPSSSVPSKWA----------VITKVVVRDVLLMPLL 188

Query: 62  QSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALY 96
           QS + +  L+G+K WLR +   GR  G  L + L+
Sbjct: 189 QSFVLSLVLMGVKDWLRFIRLEGRTLGGRLRQRLF 223

>Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)
          Length = 268

 Score = 41.6 bits (96), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 2   NGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMPFI 61
           N  + IPD RF + F RA+ R++    + S K     K            VRDVLLMP +
Sbjct: 182 NKQLNIPDLRFGKVFERALYRDLTPSASRSRKLAVVAKVV----------VRDVLLMPLV 231

Query: 62  QSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALY 96
           QS++ +  L+G+K WLR +   G   G  L + L+
Sbjct: 232 QSIVLSVVLIGVKDWLRYIRLKGFTLGARLRQRLF 266

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score = 29.6 bits (65), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 5/45 (11%)

Query: 2   NGVIKIPDTRFEQTFRR----AIDREVAKQNA-LSGKSTDDKKSG 41
           NGV K+ D   ++TF R    AI +E+ + NA L G  TDD  SG
Sbjct: 455 NGVDKLDDPYDDETFPRLNVEAIAKELEEYNATLQGAMTDDLHSG 499

>TBLA0E03740 Chr5 complement(932793..940322) [7530 bp, 2509 aa] {ON}
           Anc_2.232 YIL129C
          Length = 2509

 Score = 29.3 bits (64), Expect = 1.8,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 4/40 (10%)

Query: 20  IDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMP 59
           I  EVAK+NA       D+KS  S Y++C+V++  +   P
Sbjct: 433 IQLEVAKENAFQA----DRKSLISIYILCRVLIEIIKQAP 468

>SAKL0B08624g Chr2 complement(733369..734733) [1365 bp, 454 aa] {ON}
           similar to uniprot|P38272 Saccharomyces cerevisiae
           YBR130C SHE3 Protein that acts as an adaptor between
           Myo4p and the She2p-mRNA complex part of the mRNA
           localization machinery that restricts accumulation of
           certain proteins to the bud also required for cortical
           ER inheritance
          Length = 454

 Score = 28.1 bits (61), Expect = 4.4,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 3   GVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVL 56
           G+ +   TR   + R ++    A   + SG+ST+ + S PS  VI  +  R+ L
Sbjct: 372 GLKRSSSTRKPSSNRNSLANNTANSRSTSGESTEPESSPPSQQVIPDIPQRNSL 425

>NCAS0G00160 Chr7 complement(13871..21226) [7356 bp, 2451 aa] {ON}
           Anc_2.232 YIL129C
          Length = 2451

 Score = 27.7 bits (60), Expect = 7.5,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 8/53 (15%)

Query: 11  RFEQTFRRA--IDREVAKQ--NALSGKSTDDKKSGPSAYVICKVVVRDVLLMP 59
           RF   F R+  ID  + K   NAL     +D+KS  S Y++C+V++  V   P
Sbjct: 365 RFSSDFERSREIDMLIEKTRINALQ----EDRKSLISIYILCRVLIEIVKQTP 413

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.141    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,728,656
Number of extensions: 368031
Number of successful extensions: 780
Number of sequences better than 10.0: 24
Number of HSP's gapped: 761
Number of HSP's successfully gapped: 24
Length of query: 108
Length of database: 53,481,399
Length adjustment: 78
Effective length of query: 30
Effective length of database: 44,537,451
Effective search space: 1336123530
Effective search space used: 1336123530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)