Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0D04180g2.292ON70070032450.0
Suva_9.1082.292ON72257022270.0
YIL091C (UTP25)2.292ON72157022090.0
KNAG0A054002.292ON72172422070.0
KAFR0J013402.292ON72857322000.0
Smik_9.882.292ON72457021890.0
Skud_9.822.292ON72257021820.0
NDAI0B035302.292ON73957321550.0
SAKL0E07546g2.292ON71857021460.0
TBLA0B059702.292ON71957021330.0
NCAS0B062302.292ON72357421230.0
TDEL0G022202.292ON71070321160.0
ZYRO0A02002g2.292ON70956820960.0
Kpol_1039.462.292ON70470420760.0
KLTH0G10494g2.292ON74757020680.0
Kwal_27.115032.292ON72757120580.0
TPHA0D015202.292ON71656820410.0
KLLA0E08229g2.292ON70457520170.0
ADL209C2.292ON70470720020.0
Ecym_33312.292ON70871219480.0
Skud_16.1228.683ON109166781.1
KLLA0C01738g1.56ON19790741.6
KLLA0E22463g1.468ON72455752.3
YGL015Cna 1ON13073703.0
KLLA0A01001g3.555ON53343733.7
TPHA0B017904.310ON207457733.9
TDEL0C053603.399ON842112725.4
Kpol_401.117.185ON103245709.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D04180g
         (700 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...  1254   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   862   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   855   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   854   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   852   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   847   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   845   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   834   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   831   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   826   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   822   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   819   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   811   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   804   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   801   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   797   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   790   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   781   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   775   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   754   0.0  
Skud_16.122 Chr16 (218437..221712) [3276 bp, 1091 aa] {ON} YPL16...    35   1.1  
KLLA0C01738g Chr3 complement(138679..139272) [594 bp, 197 aa] {O...    33   1.6  
KLLA0E22463g Chr5 complement(2001004..2003178) [2175 bp, 724 aa]...    33   2.3  
YGL015C Chr7 complement(465043..465435) [393 bp, 130 aa] {ON} Pu...    32   3.0  
KLLA0A01001g Chr1 (94392..95993) [1602 bp, 533 aa] {ON} highly s...    33   3.7  
TPHA0B01790 Chr2 complement(396879..403103) [6225 bp, 2074 aa] {...    33   3.9  
TDEL0C05360 Chr3 complement(956576..959104) [2529 bp, 842 aa] {O...    32   5.4  
Kpol_401.11 s401 (27650..29101,29104..30750) [3099 bp, 1032 aa] ...    32   9.4  

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score = 1254 bits (3245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/700 (89%), Positives = 623/700 (89%)

Query: 1   MDKRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXXXXYN 60
           MDKRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPA                  YN
Sbjct: 1   MDKRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAVEEKVQDDGEKEDDKEQVYN 60

Query: 61  ALLTILKSEHKEDKVKTHRDHXXXXXXXXXXXXXXXXYNXXXXXXXXXXXXXXXXXXXXX 120
           ALLTILKSEHKEDKVKTHRDH                YN                     
Sbjct: 61  ALLTILKSEHKEDKVKTHRDHDEEESEAEEEEQAEDQYNDAFADGESDDEDDDEDEQAQE 120

Query: 121 XXXXXXXXXXKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDA 180
                     KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDA
Sbjct: 121 QEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDA 180

Query: 181 IFSVPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQY 240
           IFSVPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQY
Sbjct: 181 IFSVPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQY 240

Query: 241 KDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPK 300
           KDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPK
Sbjct: 241 KDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPK 300

Query: 301 VLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTN 360
           VLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYD            QHIFKGNTN
Sbjct: 301 VLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTN 360

Query: 361 DYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQ 420
           DYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQ
Sbjct: 361 DYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQ 420

Query: 421 FHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVA 480
           FHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVA
Sbjct: 421 FHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVA 480

Query: 481 NSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFF 540
           NSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFF
Sbjct: 481 NSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFF 540

Query: 541 TSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRT 600
           TSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRT
Sbjct: 541 TSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRT 600

Query: 601 LFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADL 660
           LFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADL
Sbjct: 601 LFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADL 660

Query: 661 NISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           NISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK
Sbjct: 661 NISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/570 (69%), Positives = 481/570 (84%), Gaps = 7/570 (1%)

Query: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE 190
           +DPF++HFN + + K+ + + NA K N ++YKS+K  +G        E  I+S P + G+
Sbjct: 160 QDPFESHFN-QVSEKYVDDVSNAFKANNIKYKSVKSPLGD------DESCIYSKPVVNGD 212

Query: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250
              +E P    S+ SYFLK+RL+IQN LLD + + LT LQ+K+VDPM QYKDILYEYD+Y
Sbjct: 213 ETPVERPYKSSSIYSYFLKQRLKIQNGLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSY 272

Query: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310
            KDEDEYRDLYTLH LNH+YKTRD+I+KNNQ+LQDNPD+E LDQGFTRPKVLI+ PTRD+
Sbjct: 273 EKDEDEYRDLYTLHALNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDA 332

Query: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFT 370
           AY +V K+I+KSG+DQVDKKGKF DQF D            QHIF+GNT+D+FV+G+KFT
Sbjct: 333 AYHVVDKIIKKSGIDQVDKKGKFYDQFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFT 392

Query: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430
           RKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDKKKRQDDFLSS+E+ +IDQ HSIEYQN +
Sbjct: 393 RKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNIS 452

Query: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490
           H+FTIFDH+NKIP +QH+ADFSRIRMWYIN+QAK  RQTM+FTKYISP ANSL+N +CRN
Sbjct: 453 HIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLLRQTMVFTKYISPAANSLINGRCRN 512

Query: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550
           L GRWKNHK++ SE SS+G +GLK+RQIFQRF+++GNS+ +EPDYRFKFFTSV+I +I K
Sbjct: 513 LAGRWKNHKVIESETSSIGQLGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVK 572

Query: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610
           STGY+DG LIYIP+Y+D++R+RNYMKEKT+ILFGDINEYS Q+ L +NR+LF QGR+KVL
Sbjct: 573 STGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQKQLNANRSLFQQGRVKVL 632

Query: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670
           LYTERLHH+RRYE+KGVKNV+FYKPP++PEFY E VRYIGK  FLG+ DLNISTVRC YS
Sbjct: 633 LYTERLHHYRRYEIKGVKNVIFYKPPNNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYS 692

Query: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           KLDGL+LE+IVGTKR GVL+H Q E YEFK
Sbjct: 693 KLDGLSLERIVGTKRAGVLSHAQKEVYEFK 722

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 43/84 (51%), Gaps = 13/84 (15%)

Query: 3  KRGRKELRSIRR--AKRTK------IEPEADAGVESSG--SVLEAGPAXXXXXXXXXXXX 52
          KRGR+E+R I+R  A+RT+      ++  A+  VE+    ++ +AG              
Sbjct: 18 KRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAISDAG---SESDLDIGDEE 74

Query: 53 XXXXXXYNALLTILKSEHKEDKVK 76
                Y+ALLTILKSEH E K K
Sbjct: 75 EKQEKVYDALLTILKSEHPEPKRK 98

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/570 (69%), Positives = 479/570 (84%), Gaps = 7/570 (1%)

Query: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE 190
           +DPF++HFN +   K  + L NA K   ++YKS+K   GS  +    E  I++ P + GE
Sbjct: 159 QDPFESHFN-QVPEKFVDKLSNAFKTKSVKYKSVK---GSLSD---SESYIYAKPVVIGE 211

Query: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250
              +E P    S+ SYFLK+RL++QN LLD +++ LT LQ+K+VDPM QYKDILYEYD+Y
Sbjct: 212 EALVESPYRSSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILYEYDSY 271

Query: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310
            KDEDEYRDLY LHVLNH+YKTRD+I+KNNQ+LQDNPD+E LDQGFTRPKVLI+ PTR+ 
Sbjct: 272 EKDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREV 331

Query: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFT 370
           AY++V K+I KSG+DQVDKKGKF DQF D            QHIF+GNTND+FV+G+KFT
Sbjct: 332 AYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFT 391

Query: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430
           RKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDKKKRQDDFLSS+E+ +IDQ HSIEYQN +
Sbjct: 392 RKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNIS 451

Query: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490
           H+FTIFDHLNKIP +QH+ADFSRIRMWYIN+QAK FRQTM+FTKYISP ANSL+N +CRN
Sbjct: 452 HIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRN 511

Query: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550
           + GRWKNHK++ SE+SS+G  GLK+RQIFQRF+++GNS+ +EPDYRFKFFTSV+I  I K
Sbjct: 512 MAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVK 571

Query: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610
           STGY+DG LIYIP+Y+D++R+RNYMKEKT+ILFGDINEYS QR L +NR+LF QGRLKV+
Sbjct: 572 STGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVM 631

Query: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670
           LYTERLHH+RRYE+KGVK+VVFYKPP++PEFY EVVR+IGK  FLG+ DLNISTVRC YS
Sbjct: 632 LYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYS 691

Query: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           KLDGL+LE+IVGTKR  VL+H Q E YEFK
Sbjct: 692 KLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/724 (59%), Positives = 513/724 (70%), Gaps = 35/724 (4%)

Query: 3   KRGRKELRSIRRA-KRTKIE--PEADAGVE-----SSGSVLEAGPAXXXXXXXXXXXXXX 54
           KRGRKELR ++R  KR  I+  P   A VE      +  ++    +              
Sbjct: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDAEAR 66

Query: 55  XXXXYNALLTILKSEHKE---------------DKVKTHRDHXXXXXXXXXXXXXXXXYN 99
               Y ALLTILKSEH E               DK+  H D+                  
Sbjct: 67  KGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHEELEEENEEEQIDNA-- 124

Query: 100 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDPFDTHFNGEEAAKHGEALGNALKDNKL 159
                                          +DPF++HFN +        L  A K  +L
Sbjct: 125 -----ILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFN-QFPETEINTLDAAFKSKQL 178

Query: 160 RYKSIKLKVGSADEDQVQEDAIFSVPYIEGE---TPKIEDPKLKCSLSSYFLKKRLRIQN 216
           +Y+S+KL+     + +  E  I+S P + G    + K+ +   KCS+ SYFLKKRL+IQN
Sbjct: 179 QYRSVKLQPAKVTKVK-DEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQN 237

Query: 217 NLLDTESNALTDLQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKI 276
           +LL+ + + L  +Q+++VDPM QYKDILYEY+ YGK EDEYR LY LH LNHVYKTRD+I
Sbjct: 238 DLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRI 297

Query: 277 IKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQ 336
           +KNNQ+LQ+N D+E LDQGFTRPKVLIIAPTRD+AY IVT +I KSG+DQVDK+GKF+DQ
Sbjct: 298 LKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQ 357

Query: 337 FYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMI 396
           FY+            Q IFKGNTND+FVLG+KFTRKAIKLYSNFYQSDIIVCSPLGLQMI
Sbjct: 358 FYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMI 417

Query: 397 VENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRM 456
           VENTDKKKRQDDFLSS+E+TIIDQ HSIEYQN +HL+TIF+HLN IP EQHDADFSRIRM
Sbjct: 418 VENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRM 477

Query: 457 WYINDQAKFFRQTMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVR 516
           WYINDQA+FFRQTM+FTKYISP ANS++N KCRN  GRWKNH+IVS+E S +G + L+VR
Sbjct: 478 WYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVR 537

Query: 517 QIFQRFNVLGNSVADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMK 576
           QIFQRF V G S+ DEPDYRFKFFTSV+I  I KSTGY+DG LIYIPEY+DYVRVRNY+K
Sbjct: 538 QIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLK 597

Query: 577 EKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPP 636
           EKT ILFGDINEYS Q+ LT+NR+LF QGRLKVLLYTERLHH+RRYE+KGVK+V+FYKPP
Sbjct: 598 EKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPP 657

Query: 637 SDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNET 696
           SDPEFY EVVR IG+  FLG+ DLNISTVRC YSKLD LALE +VGT+R GVL HGQNE 
Sbjct: 658 SDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEI 717

Query: 697 YEFK 700
           YEFK
Sbjct: 718 YEFK 721

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/573 (70%), Positives = 481/573 (83%), Gaps = 11/573 (1%)

Query: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYI--- 187
           +DPF+THFN  +  K  + L  + K+N ++YKS KL +    ED   E AIFS P I   
Sbjct: 164 QDPFETHFNSVDE-KFTDKLDVSFKNNDIKYKSTKLPIS---ED---EYAIFSKPVIKSD 216

Query: 188 EGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEY 247
           E E+P +E    K S+ SYFLK+RL++QNNL+D + + LT LQ+++VDPM QYKDILY+Y
Sbjct: 217 EIESP-VELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQY 275

Query: 248 DTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPT 307
           D+YGKDEDEYRDLY+LHVLNH+YKTRDKI+KNNQ+LQDN D+E LDQGFTRPKVLI+ PT
Sbjct: 276 DSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPT 335

Query: 308 RDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGV 367
           RD+AYQ++ K+I KSG+DQVDKKGKF+DQF++            Q IFKGNTND+FVLGV
Sbjct: 336 RDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGV 395

Query: 368 KFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQ 427
           KFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKKRQDDFLSS+E+ IIDQ HSIEYQ
Sbjct: 396 KFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQ 455

Query: 428 NYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIK 487
           N +HLFTI +H+NKIPQEQHDADFSR+RMWYINDQAK FRQTM+FTKYISP+ANSLLN K
Sbjct: 456 NISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGK 515

Query: 488 CRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISN 547
           C+N  GRWKNHK++S+  SS+  VG+K+RQIFQRF  +  SV DEPDYRFKFFTSV + N
Sbjct: 516 CQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPN 575

Query: 548 ITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRL 607
           I K+TGY+DGTLIYIPEY+DY+RVRNY+K+KT+ILFGDINEYS+Q+ L SNR+LF QGR+
Sbjct: 576 IVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRV 635

Query: 608 KVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRC 667
           KVLLYTERLHH+RRYE+KGVKNVVFY+PP +PEFY EVVRYIGK  FLG+ DLNISTVRC
Sbjct: 636 KVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRC 695

Query: 668 CYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
            YSKLD L+LE IVG+KR GVL H QNE YEFK
Sbjct: 696 LYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/570 (67%), Positives = 477/570 (83%), Gaps = 7/570 (1%)

Query: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE 190
           +DPF++HFN + + K+ + L NA K   ++YKS+K  +G        E  I++ P++ GE
Sbjct: 162 QDPFESHFN-QVSEKYVDDLSNAFKSKSIKYKSVKASLGD------DESYIYAKPFMVGE 214

Query: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250
              +E P    S+ SYFLK+RL++QN LLD + + LT +Q+K++DPM QYKDILYEYD+Y
Sbjct: 215 EALVESPYRSSSIYSYFLKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSY 274

Query: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310
            KDE EYRDLY LHVLNH+YKTRD+I+KNNQ+LQDNPD+E LDQGFTRPKVLI+ PTR+ 
Sbjct: 275 EKDESEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREV 334

Query: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFT 370
           AY++V K+I KSG+DQVDKKGKF DQF D            QHIFKGNT+D+FV+G+KFT
Sbjct: 335 AYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFT 394

Query: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430
           RKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKKRQDDFLSS+E+ +IDQ HSIEYQN +
Sbjct: 395 RKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNIS 454

Query: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490
           H+FTIFDH+NKIP +QH+ADFSRIRMWYIN+QAK FRQTM+FTKYISP ANSL+N +C N
Sbjct: 455 HIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCN 514

Query: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550
           + GRWKNHK++ SE SS+G +GLKVRQIFQRF+++GNS+ +EPDYRFKFFTSV+I +I K
Sbjct: 515 MAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVK 574

Query: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610
           S GY+DG L+YIP+Y+D++R+RNYMKEKT+ILFGDINEYS QR L +NR+LF QGRLKV+
Sbjct: 575 SVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVM 634

Query: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670
           LYTERLHH+RRYE+KGVK+VVFYKPP++PEFY E VR+IGK  FLG+ DLNISTVRC YS
Sbjct: 635 LYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYS 694

Query: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           KLDGL+LE+IVGTKR  VL+H Q E YEFK
Sbjct: 695 KLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 3  KRGRKELRSIRRA--KRTK------IEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXX 54
          KRGR+ELR I+R+  +RTK      ++  AD  V S+G    +                 
Sbjct: 18 KRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIGSEEDNLDVEDEEGK 77

Query: 55 XXXXYNALLTILKSEHKEDK 74
              Y+ALLTILKSEH E K
Sbjct: 78 KEKVYDALLTILKSEHPEPK 97

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/570 (68%), Positives = 470/570 (82%), Gaps = 7/570 (1%)

Query: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE 190
           +DPF++HFN +   K  + L NA K   +RYKS+K  +         E  I++ P + GE
Sbjct: 160 QDPFESHFN-QVPEKDVDDLSNAFKSKNIRYKSVKAPLNG------DESYIYAQPVVVGE 212

Query: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250
              +E P    S+ SYFLK+RL+IQN L D + + L  LQRK+VDPM QYKDILYEYD+Y
Sbjct: 213 ESSVESPYKSSSIYSYFLKQRLKIQNGLQDKKIDPLNALQRKLVDPMFQYKDILYEYDSY 272

Query: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310
            KDEDEYRDLYTLHVLNH+YKTRD+I+KNNQ+LQDNPD+E LDQGFTRPKVLI+ PTRD 
Sbjct: 273 EKDEDEYRDLYTLHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDV 332

Query: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFT 370
           AY++V K+I KSG+DQVDKKGKF DQF D            QHIFKGNTND+FV+G+KFT
Sbjct: 333 AYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFT 392

Query: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430
           RKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDKKKRQDDFLSS+E+ +IDQ HSIEYQN +
Sbjct: 393 RKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNIS 452

Query: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490
           H+ TIFDHLNKIP +QH+ADFSRIRMWYIN+QAKFFRQTM+FTKYISP  NSL+N +CRN
Sbjct: 453 HILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRN 512

Query: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550
           + GRWKNH+ +  E SS+G +GLK+RQIFQRF+ +GNS+ +EPDYRFKFFTSV+I +I K
Sbjct: 513 MAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVK 572

Query: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610
           STGY+DG LIYIP+Y+D++R+RNYMKEKT+ILFGDINEYS QR L +NR+LF QGRLKV+
Sbjct: 573 STGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVM 632

Query: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670
           LYTERLHH+RRY++KGVK+V+FYKPP++PEFY E VR+IGK  F G+ DLNISTVRC YS
Sbjct: 633 LYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYS 692

Query: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           KLDG++LE+IVGTKR  VL+H Q E YEFK
Sbjct: 693 KLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 35/82 (42%), Gaps = 13/82 (15%)

Query: 3  KRGRKELRSIRRAKRTKIE----------PEADAGVESSGSVLEAGPAXXXXXXXXXXXX 52
          KRGR+ELR I+R+   + E           E   G   + +V + G              
Sbjct: 18 KRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVG---SEDDLDVGDED 74

Query: 53 XXXXXXYNALLTILKSEHKEDK 74
                Y+ALLTILKSEH E K
Sbjct: 75 EKKKKVYDALLTILKSEHPEPK 96

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/573 (68%), Positives = 472/573 (82%), Gaps = 10/573 (1%)

Query: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE 190
           +DPF++HFN +   +  + L  A +  +++YK+ K+ +  +         I S P I GE
Sbjct: 174 QDPFESHFN-KPTEQFVDKLHAAFESREIKYKATKIVIDDS------HSVISSKPTIFGE 226

Query: 191 ---TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEY 247
              T ++   K   S+ SYF+K+RL+IQNNLL+ + + LT LQ++++DPM QYKDILYEY
Sbjct: 227 ELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEY 286

Query: 248 DTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPT 307
           D+YGKDEDEYRDLY LH LNHVYKTRD+I+KNNQ+LQDN D+E+LDQGFTRPKVLI+ PT
Sbjct: 287 DSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPT 346

Query: 308 RDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGV 367
           RD+AY++  K+I+KSGLDQVDKKGKF DQF D            Q IFKGNTND+FVLG+
Sbjct: 347 RDTAYEVTDKIIKKSGLDQVDKKGKFYDQFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGL 406

Query: 368 KFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQ 427
           KFTRKAIKLYSNFYQSDIIVCSPLG+QMIVENTDKKKRQDDFLSS+E+ I+DQ HS+EYQ
Sbjct: 407 KFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQ 466

Query: 428 NYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIK 487
           N  H+FTIFDHLNKIP EQHDADFSRIRMWYINDQAK FRQTM+FTKY+SP AN+++N +
Sbjct: 467 NLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPAANAIINNR 526

Query: 488 CRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISN 547
           CRN EGRWKNHKIV+ E SS+G +GLK++QIFQRF+++G S+ DEPDYRFK FTSV+I +
Sbjct: 527 CRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPS 586

Query: 548 ITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRL 607
           I KST YDDG LIYIP+Y+DYVR+RNY+KEKT ILFGDINEYSEQR L SNR+L  QGR+
Sbjct: 587 IVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRV 646

Query: 608 KVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRC 667
           KVLLYTERLHH+RRYE+KGVK+VVFYKPP++PEFY EVVR+IGK  FLG+ DLNISTVR 
Sbjct: 647 KVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRT 706

Query: 668 CYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
            Y KLDGL+LE+IVGTKR G+L H QNE YEFK
Sbjct: 707 VYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/570 (68%), Positives = 471/570 (82%), Gaps = 9/570 (1%)

Query: 132 DPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE- 190
           D F+ HFN     +    L +A +D K+RYKS+K+ V   +ED+     I+S P +EGE 
Sbjct: 157 DSFELHFNNVSELQ-ATKLASAFRDKKIRYKSVKVPV---NEDEF---FIYSRPTVEGED 209

Query: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250
              +  P  K SL SYF+K++L+IQNNLLD +  AL  LQ+ +VDPM QY+D+LYEY +Y
Sbjct: 210 GSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLYEYRSY 269

Query: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310
            + E+EYRDLY LHVLNHVYKTRD+I++N+QKLQDN D E LDQGFTRPKVLI+ PTRD 
Sbjct: 270 -EQEEEYRDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDV 328

Query: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFT 370
           AYQIVTK+IEKSGLDQVDK+GKF+DQF+D            +HIFKGNTND+FVLG KFT
Sbjct: 329 AYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLPPSSKPKSFKHIFKGNTNDFFVLGAKFT 388

Query: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430
           RK +KLYSNFYQSD+I CSPLG+Q+I+ENTDKKKRQDDFLSS+E+ +IDQ HSIEYQN +
Sbjct: 389 RKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLS 448

Query: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490
           H+ TIF H+NKIPQ+QHDADFSRIRMWYIN+QA  FRQTM+FTKY SP ANSL+N KCRN
Sbjct: 449 HITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRN 508

Query: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550
             GRWKNH IV  E SS+  +GLKVRQIFQRF+++G S  DEPDYRFKFFTSV+I++I K
Sbjct: 509 HAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIK 568

Query: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610
           STGY+DG L+YIP+Y+DYVRVRN+++EKT++LFGDINEYSEQ+ LTSNR LF QG++KVL
Sbjct: 569 STGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVL 628

Query: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670
           LYTERLHHFRRYE+KGVK+V+FYKPP++PEFY+EVVRYIGK+ FLG ADLNISTVRC Y 
Sbjct: 629 LYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYC 688

Query: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           KLDGL+LE++VGTKR  VLTHGQNE YEFK
Sbjct: 689 KLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 36/82 (43%), Gaps = 4/82 (4%)

Query: 3   KRGRKELRSIRRAK-RTKIEPEADAGVESSGSVLE---AGPAXXXXXXXXXXXXXXXXXX 58
           K GRKELR+I RA  R   E + D   E   S  E   A                     
Sbjct: 22  KTGRKELRTITRANARHANESKDDFENEPDMSSEEEELADNKPRSDEEEEEDIETKKQKV 81

Query: 59  YNALLTILKSEHKEDKVKTHRD 80
           YNALLT+L+SEH   K K +R+
Sbjct: 82  YNALLTLLESEHPHKKSKKNRE 103

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/570 (67%), Positives = 468/570 (82%), Gaps = 8/570 (1%)

Query: 132 DPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYI-EGE 190
           DPFD+HFN +   +      +A K+ +++Y+SIK K+         E +I+S P I E E
Sbjct: 157 DPFDSHFN-QPTEQFTNKFADAFKNKQIKYRSIKYKINEY------ESSIYSEPRILEDE 209

Query: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250
             K++ P LK S+ SY LKKRL+I N+LLD   N LT +Q+++VDPM QYKDILYEY  Y
Sbjct: 210 QTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNY 269

Query: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310
           GKDE+EYR LY LHVLNH+YKTRD+I+KNN K+QDNPD+EFLDQGFTRPKVLI+APTRD+
Sbjct: 270 GKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDA 329

Query: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFT 370
            Y IV ++I+KSG+DQ+DKK KFRDQFY+            Q +FKGN+NDYFVLG+KFT
Sbjct: 330 GYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFT 389

Query: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430
           RKAIKLYSNFYQSDIIVCSPLGL MI+ENTDKKKRQDDFLSS+E+ IIDQ HS+E+QN +
Sbjct: 390 RKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNIS 449

Query: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490
           H+ +IF+H+NKIP+EQHD DFSRI+MWYINDQAK FRQTMIFTKYISP AN  LN KC+N
Sbjct: 450 HVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQN 509

Query: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550
             GRWKNHK+++  +SS+G +GL+V+Q+F RF+++G S+ DEPDYRFK+FTSV++ +ITK
Sbjct: 510 WSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITK 569

Query: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610
           ST Y+DG LIYI +Y+DYVRVRNY+KEKT+ILFGDINEYS+Q+ + SNR LF Q R+KVL
Sbjct: 570 STSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVL 629

Query: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670
           LYTERLHHFRRYE+KGVKN+VFYK P++PEFY EVVRYIGK  F G+ D+NIS VR  YS
Sbjct: 630 LYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYS 689

Query: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           KLDGLALE+I+GTKR  VLTHGQNETYEFK
Sbjct: 690 KLDGLALERIMGTKRAAVLTHGQNETYEFK 719

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 3  KRGRKELRSIRR---AKRTKIEPE--ADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXXX 57
          KRGR + RSI++   AKR K E        +E   S  +                     
Sbjct: 16 KRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDLEKKKQ 75

Query: 58 XYNALLTILKSEHKEDKVK 76
           Y+AL+TILKSEHKE K++
Sbjct: 76 VYDALVTILKSEHKEPKMR 94

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/574 (67%), Positives = 467/574 (81%), Gaps = 12/574 (2%)

Query: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEG- 189
           +DPF++HFN + + K  + L  A     ++YKS K  +G        +  I S+P I G 
Sbjct: 158 QDPFESHFN-QVSEKTADDLNTAFNTGSVKYKSTKSVIGD------NKTVISSIPTIIGK 210

Query: 190 ---ETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYE 246
              E  K   PK   S+ SYFLK+RLR+ N++LD++ + L  LQ+++VDPM QY+DIL E
Sbjct: 211 ENTEEEKDSAPK-SSSIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCE 269

Query: 247 YDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAP 306
           Y +Y KDEDEYRDLY LH LNHVYKTRD+I+K+N +LQDN D+E+ DQGFTRPKVLI+ P
Sbjct: 270 YSSYEKDEDEYRDLYALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVP 329

Query: 307 TRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLG 366
           TRD+AY++++K+I KSGLDQVDKKGKF DQF+D            QHIFKGNTND+FVLG
Sbjct: 330 TRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLG 389

Query: 367 VKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEY 426
           VKFTRKAIKLYSNFYQSDIIVCSPLG+QMIVENTDKK RQDDFLSS+EV IIDQ HSIEY
Sbjct: 390 VKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEY 449

Query: 427 QNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNI 486
           QN  H+FTIFDHLNKIP++QH+ADFSRIRMWYINDQA+ FRQTMIFTKY++P AN+L+N 
Sbjct: 450 QNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINN 509

Query: 487 KCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVIS 546
           +CRN  GRWKNH+I+  E S++  +GLKV+Q FQRF+++G SV DEPDYRFK F+SV+I 
Sbjct: 510 RCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIP 569

Query: 547 NITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGR 606
           +I KST Y DG LIYIP+Y+DYVR+RNY+KEKT++LFGDINEYSEQR L SNR+LF QGR
Sbjct: 570 SIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGR 629

Query: 607 LKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVR 666
           +KVLLYTERLHH+RRYELKGVK+VVFYKPP++PEFY EVVRYIGK+ FLG+ADLNISTVR
Sbjct: 630 VKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVR 689

Query: 667 CCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
             Y KLDGL+LE+IVG+KR G+L H QNE YEF+
Sbjct: 690 TLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 34/74 (45%), Gaps = 7/74 (9%)

Query: 3  KRGRKELRSIRRAKRTKIEPEADAGVESSGSV----LEAGPAXXXXXXXXXXXXXXXXXX 58
          KRGR+ELR+IRR+   K+  +    V +S  V     E   +                  
Sbjct: 16 KRGRQELRTIRRSAGAKVSSQE---VFNSSIVDDEEQELNESNESEQEEDIDEEEKKNKV 72

Query: 59 YNALLTILKSEHKE 72
          Y ALLTILKSEH E
Sbjct: 73 YGALLTILKSEHPE 86

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/703 (57%), Positives = 497/703 (70%), Gaps = 15/703 (2%)

Query: 3   KRGRKELRSIRRAKRTKIEPEADAGVESSGSVLE----AGPAXXXXXXXXXXXXXXXXXX 58
           KRGRKELRSIRR +R K   E +   ESS   ++                          
Sbjct: 18  KRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHNEEIANVEEDEENKRRKV 77

Query: 59  YNALLTILKSEHKEDKVKTHRDHXXXXXXXXXXXXXXXXYNXXXXXXXXXXXXXXXXXXX 118
           Y ALLTIL SEH + K K                                          
Sbjct: 78  YGALLTILNSEHPKPKPKQEVTVQSRKEDSESDVEEDERDEVEQLEDNLARVDENPSEDD 137

Query: 119 XXXXXXXXXXXXKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQE 178
                       +D FD+HFN +      + L  A K+ +L+YKS K+ +G        E
Sbjct: 138 LSEDADEESDDEQDTFDSHFN-QVPENVVDKLDAAFKERQLKYKSAKVPIGE------NE 190

Query: 179 DAIFSVPYI-EGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPM 237
             ++S P + E ++ K+E P    SL SY  K+RL+IQN+L   E   LT  QR +VDPM
Sbjct: 191 SMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENLTSTQRTLVDPM 247

Query: 238 MQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFT 297
           +QY D+LYEY++Y KDEDEYRDLY LHVLNHVYKTRDKI+KNNQ++ DNPD+++LDQGFT
Sbjct: 248 LQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGFT 307

Query: 298 RPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKG 357
           RPKVLI+ PTRD+AYQ++ K+I+KSG+DQ+DKKGKFRDQF++            QH+FKG
Sbjct: 308 RPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSSKPKSFQHVFKG 367

Query: 358 NTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTI 417
           NTND+FVLGVKFTRKAIKLYSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFLSS+E++I
Sbjct: 368 NTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEISI 427

Query: 418 IDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYIS 477
            DQ HSIEYQN +H+ TIFDHLN IPQEQHD DF R+R+WYIN+QAK FRQTMIFTKY+S
Sbjct: 428 FDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVS 487

Query: 478 PVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRF 537
           P AN+L+N KC+N+ GRWKNH  +    SS+G +GLKVRQIFQR ++   S+ +E D+RF
Sbjct: 488 PTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRF 547

Query: 538 KFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTS 597
           KFFTSV+I +I KSTGY+DG L+YIP+Y+D++RVRNYMKEKT+I+FGDINEYS Q+ L S
Sbjct: 548 KFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNS 607

Query: 598 NRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGD 657
           NR LF QGR KVLLYTERLHHFRRYE+KGVK+VVFY+PP++PEFY EVVR+I K+  LG 
Sbjct: 608 NRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGT 667

Query: 658 ADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
            DLNISTVR  YSKLDG++LE+IVGTKR  +LTHGQNE YEFK
Sbjct: 668 TDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/568 (66%), Positives = 471/568 (82%), Gaps = 9/568 (1%)

Query: 133 PFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGETP 192
           PF++HFN +  ++  ++L  A K  K+  KS K++V   D+D+    ++     + G+  
Sbjct: 151 PFESHFNMQ--SESIDSLDEAWKQKKIVNKSGKIRV---DDDE----SLIYTKTLAGKGQ 201

Query: 193 KIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTYGK 252
           + E P  K  LSSY LK++L+IQNNLL+++ + LT LQRKIVDP+ QY+D+LYEY+ Y +
Sbjct: 202 EFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQ 261

Query: 253 DEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAY 312
           DEDEYRDLY LHVLNH+YKTRD+I+K+NQ+L  NPD EFLDQGFTRPKVLI+APTRD+AY
Sbjct: 262 DEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAY 321

Query: 313 QIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFTRK 372
           QIV+K+IEKSGLDQVDKK K RDQF++            +H FKGNTND+FVLGVKFTRK
Sbjct: 322 QIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRK 381

Query: 373 AIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHL 432
           AI+LYSNFYQSD+IVCSPLGLQ+I+ENTD+KKRQDDFLSS+E+ IIDQ +SIE+QN +HL
Sbjct: 382 AIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHL 441

Query: 433 FTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRNLE 492
           FTIF H+NKIP+EQHD DF R+RMWYIN+QAK  RQT+IFT+Y++P AN LLN KCRN+ 
Sbjct: 442 FTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIG 501

Query: 493 GRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITKST 552
           GRWKNH  ++ E SSV  +G +VRQIFQR ++ G SV DEPDYRF+FFTSV++ +ITKST
Sbjct: 502 GRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKST 561

Query: 553 GYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLY 612
           GY+DG L+YIP+Y+D++RVRNY+K+KT+ILFGDINEYS+ R LTS R+LF QGR+KVLLY
Sbjct: 562 GYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLY 621

Query: 613 TERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKL 672
           TERLHHFRRYE+KGVK+V+FY+PPS+PEFY EVVRYIGK+ FLGD DLNISTVRC YSKL
Sbjct: 622 TERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKL 681

Query: 673 DGLALEKIVGTKRTGVLTHGQNETYEFK 700
           DGLALE+IV +KR  VLTHGQNE YEFK
Sbjct: 682 DGLALERIVSSKRAAVLTHGQNEIYEFK 709

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 3  KRGRKELRSIRRAKRTKI---EPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXXXXY 59
          KRGRK+LRSIRRA+  K    EPE     E  G + E   +                  Y
Sbjct: 17 KRGRKDLRSIRRARNDKEPVEEPEIPVASEEDGELSED--SEEDATNEVQEQEDSKEKAY 74

Query: 60 NALLTILKSEHKEDKVKTHR 79
           ALLTILKSEH ED+ +  R
Sbjct: 75 GALLTILKSEHPEDRQRERR 94

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/704 (56%), Positives = 506/704 (71%), Gaps = 18/704 (2%)

Query: 3   KRGRKELRSIRRAKRT---KIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXXXXY 59
           KRGR ELRSIRR  R+   K + +     E+  S+  +                     Y
Sbjct: 13  KRGRTELRSIRRPNRSQHSKHDQQVVHESENEDSLESSSDDDEDIAQAEAENSDRKEKVY 72

Query: 60  NALLTILKSEHKEDKVKTHRDHXXXXXXXXXXXXXXXXYNXXXXXXXXXXXXXXXXXXXX 119
            ALLTIL SEH E K   H+ H                                      
Sbjct: 73  GALLTILNSEHPERK--KHKSHSTDFVKEIDEQEEIEQ-GMASESEEEDEENDEEESNEG 129

Query: 120 XXXXXXXXXXXKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQED 179
                       D F++HFN + +    + +    KD +++YKS+K  +        +E 
Sbjct: 130 DEEEEEEPTDQLDTFESHFN-DVSQDLVDDISAGFKDKQIKYKSMKYSLDK------KES 182

Query: 180 AIFSVPYI---EGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDP 236
           AIF  P +   + ET  I++P L  S  SYF+K+RL+IQN+LLD+    LT L++K++DP
Sbjct: 183 AIFGKPLLLTQQDET--IDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDP 240

Query: 237 MMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGF 296
           M QYKD+L EY  Y  DE EYR+LY+LHVLNH+YKTRDKI+K+NQ+LQ+N D E LDQGF
Sbjct: 241 MFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGF 300

Query: 297 TRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFK 356
           TRPKVLI+ PTRD+AYQ+V  +IEKSGLDQ+DKKGKF+DQF+D            +H+FK
Sbjct: 301 TRPKVLIVVPTRDTAYQVVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFK 360

Query: 357 GNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVT 416
           GNTND+FVLG+KFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKKRQDDFLSS+EV 
Sbjct: 361 GNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVM 420

Query: 417 IIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYI 476
           I+DQ HSIEYQN +H++TI +H+NKIPQ+Q +ADFSRIRMWYINDQAKF RQTM+FT+YI
Sbjct: 421 IVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYI 480

Query: 477 SPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYR 536
           SP AN+++N KC N+ GRWKN++I+SSEDSS+G +G+K++QIFQRF+++G +V DE DYR
Sbjct: 481 SPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYR 540

Query: 537 FKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLT 596
           FK+FTSVV+ NI KSTGY+DG L+YIPEY+DY+R+RNYMKEKT+ILF +INEYS Q+ L 
Sbjct: 541 FKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLD 600

Query: 597 SNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLG 656
           SNR++F QGR KVLLYTERLHH+RRYELKG+K+V+FYKPP++PEFY EV+R+  K  FLG
Sbjct: 601 SNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLG 660

Query: 657 DADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
            +D+NIST+R  YSKLDGLAL++IVG+KR  +L HGQNE+Y+FK
Sbjct: 661 KSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/570 (65%), Positives = 467/570 (81%), Gaps = 10/570 (1%)

Query: 132 DPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE- 190
           D  + HFN   + K   AL  A K  ++RY+S KL V     D+ QE  I+S P +  E 
Sbjct: 187 DTLEIHFNSV-SEKDTNALDAAFKAKEVRYRSCKLHV-----DKNQE-FIYSRPTLVNEP 239

Query: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250
              +  P    SL+SYF+K+RL+IQN+LLD++ + LT LQ++IVDPM QY+D+LYEY+ Y
Sbjct: 240 ASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQDLLYEYEDY 298

Query: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310
            K E EYRDLY LHVLNH+YKTRD+I+KNNQ+LQ+NPD E LDQGFTRPKVLI+APTRD+
Sbjct: 299 DK-ETEYRDLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDA 357

Query: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFT 370
           AY I++K+I+KSGLDQVDKK KF+DQF+             Q +FKGNTND+FVLG KFT
Sbjct: 358 AYDILSKIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFT 417

Query: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430
           RK IKLYSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFLSS+E+ ++DQ HSIE+QN  
Sbjct: 418 RKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNML 477

Query: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490
           HL +IF+H+NKIPQ+QHDADFSRI+MWYINDQAK FRQT+IFTK+ SP ANSL+N KCRN
Sbjct: 478 HLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRN 537

Query: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550
             GRWKNH+++  E+SS+G +G++ R IFQRF+++G SV++EPD RFK F SV++ NI K
Sbjct: 538 YAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVK 597

Query: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610
           STGY+DG L+YIP+Y+D+VRVRNY++EKT+ILFGDINEYSEQR LTSNR +F QGR+KVL
Sbjct: 598 STGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVL 657

Query: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670
           LYTERLHHFRRYE+KGVK V+FYKPP++PEF++EV RY+GK+ FLG ADLNIS VRC +S
Sbjct: 658 LYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFS 717

Query: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           KLDGL+LE+IVGT+R  VLTHG NETYEFK
Sbjct: 718 KLDGLSLERIVGTERAAVLTHGPNETYEFK 747

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 2/70 (2%)

Query: 3  KRGRKELRSIRRAKRTKIE-PEADAGVESSGSVLEA-GPAXXXXXXXXXXXXXXXXXXYN 60
          K GRK+LR+IR+A   +    E  A  E++GS  EA                      Y 
Sbjct: 21 KSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKLAAPELNEPAQDQRAGGEAYA 80

Query: 61 ALLTILKSEH 70
          ALLT+LK+EH
Sbjct: 81 ALLTLLKAEH 90

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/571 (65%), Positives = 463/571 (81%), Gaps = 12/571 (2%)

Query: 132 DPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVP--YIEG 189
           DP + HFN     K  +AL  A K  ++RY+S K+K+         E+ I+S P   +E 
Sbjct: 167 DPLEAHFNSV-PEKDTDALDQAFKTKQVRYRSSKIKISK------NEEFIYSRPDLNLES 219

Query: 190 ETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDT 249
            TP I+ P+   SLS YF+K+RL+IQN+LLD+++N LT LQ+KIVDP+ QY+D+LYEY+ 
Sbjct: 220 RTP-IQVPQGTQSLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYEN 277

Query: 250 YGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRD 309
           Y + E EYRDLY LH L+H+YKTRD+I+KNNQ+LQDNPD E LDQGFTRPKVLI+ PTRD
Sbjct: 278 YDQ-ETEYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRD 336

Query: 310 SAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKF 369
            AY +++K+IEKSGLDQVDKK KFRDQFY             Q +FKGNTND+FVLG KF
Sbjct: 337 VAYSVLSKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKF 396

Query: 370 TRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNY 429
           TRK IKLYSNFYQSDIIVCSPLG+Q+I+ENTDKKKRQDDFLSS+E+ +IDQ HSIE+QN 
Sbjct: 397 TRKTIKLYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNV 456

Query: 430 THLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCR 489
            HL +IF+H+NKIPQ+QHDADFSRI+MWYINDQAK FRQT+IFT++ +P ANSL+N KCR
Sbjct: 457 LHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCR 516

Query: 490 NLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNIT 549
           N  GRWKNH IV +E SS+  +G++ R +FQRF+V G +  DEPD+RFK F SV++ NI 
Sbjct: 517 NYAGRWKNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIV 576

Query: 550 KSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKV 609
           +STGY+DG L+YIP+Y+D++RVRNY++EKT+ILFGDI+EYSEQR LT+NR LF QGR+KV
Sbjct: 577 QSTGYEDGILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKV 636

Query: 610 LLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCY 669
           LLYTERLHHFRRYE+KGVK V+FYKPP++PEF++E VRY+ K+ FLG ADLNIS VRC Y
Sbjct: 637 LLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLY 696

Query: 670 SKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           SKLDGLALE+IVGT+R  +LTHG NETYEFK
Sbjct: 697 SKLDGLALERIVGTERAAILTHGPNETYEFK 727

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 32/74 (43%)

Query: 3  KRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXXXXYNAL 62
          K GRK+LRSIR+A R   +   D  VE+    +                       Y AL
Sbjct: 21 KGGRKQLRSIRKASRYDSKKPEDEPVETPEEEINEVEDVHEERTEVSRKQESNGEAYAAL 80

Query: 63 LTILKSEHKEDKVK 76
          LT+LK+EH   K K
Sbjct: 81 LTLLKAEHGTGKKK 94

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/568 (64%), Positives = 465/568 (81%), Gaps = 7/568 (1%)

Query: 134 FDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIE-GETP 192
           FD HFN +      + + N   + K++Y S K+++   ++D      I+S P ++ G   
Sbjct: 155 FDIHFN-QVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFF----IYSKPIVDDGNKH 209

Query: 193 KIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTYGK 252
           K+E P  K SL SYF+KKRL I NNLLD + N LT LQ+ +VDPM QY DIL+EY+ YG 
Sbjct: 210 KVESPIKKSSLDSYFIKKRLEITNNLLDGKDN-LTKLQKSLVDPMFQYVDILHEYENYGS 268

Query: 253 DEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAY 312
           DE EYR+LYTLH+LNH+YKTRDK++K+NQ+LQ+N +SEFLDQGFTRPKVLI+ PTRD+AY
Sbjct: 269 DEQEYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAY 328

Query: 313 QIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVLGVKFTRK 372
            +V  +I KSGLDQV+KKGKF+ QF++            Q IFKGNTND+FVLG+KFTRK
Sbjct: 329 NVVETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRK 388

Query: 373 AIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHL 432
           A+KLYSNFYQSD+I+CSPLGL MI ENTDKKK+QDDFLSS+E+TI+DQ HS+EYQN +H+
Sbjct: 389 ALKLYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHI 448

Query: 433 FTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRNLE 492
             IF+HLNKIP+EQHDADFSRIRMWYINDQA+ FRQTMIFTKY+SP AN+++N KCRN+ 
Sbjct: 449 MNIFEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIA 508

Query: 493 GRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITKST 552
           GRW+N   ++SE+SS+G +GLK+RQIFQRF+++G ++ADEPD+RFKFF SVV+++I KST
Sbjct: 509 GRWRNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKST 568

Query: 553 GYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLY 612
           GY+DG L+YIP YSDY+RVRNYMKEKT++LFGDINEYS+QR L SNR+LF QGR+KVLLY
Sbjct: 569 GYEDGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLY 628

Query: 613 TERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKL 672
           TERLHH+RRYE+KGVK+V+FY PP++PEFY EVVR+IGK  FLG+ D+NI+TVR  YSKL
Sbjct: 629 TERLHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKL 688

Query: 673 DGLALEKIVGTKRTGVLTHGQNETYEFK 700
           D L+LE+IVGT+R  VL+  +NE YEFK
Sbjct: 689 DSLSLERIVGTQRAAVLSRAENEVYEFK 716

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/575 (64%), Positives = 463/575 (80%), Gaps = 23/575 (4%)

Query: 132 DPFDTHFNGEEAAKHGE----ALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYI 187
           DPF++HF     +K+ E    A     KD  ++YKS K  V        +E  I+S P +
Sbjct: 147 DPFESHF-----SKYSESRLYAFDKGFKDKTVKYKSSKTDVSE------EESLIYSKPCL 195

Query: 188 EGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNAL--TDLQRKIVDPMMQYKDILY 245
           + E  ++   K K +LSSYF+K++L++ N   D ++N L  T++Q+++VDPM QYKD+LY
Sbjct: 196 DDE--EVLPVKGKQTLSSYFIKQKLKLAN---DFQNNGLPLTEIQKELVDPMFQYKDMLY 250

Query: 246 EYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIA 305
           EYD Y  DED+YRDLY+LH LNHVYKTRD+I+KNNQKLQ+N D E LDQGFTRPKVLI+ 
Sbjct: 251 EYDDYA-DEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVV 309

Query: 306 PTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQHIFKGNTNDYFVL 365
           PTRD+A++IV K++EKSGLDQ DKK KF DQF++            QHIF+GNTND+FVL
Sbjct: 310 PTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVL 369

Query: 366 GVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIE 425
           G+KFTRK++K+YSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFLSS+EV IIDQ HSIE
Sbjct: 370 GLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIE 429

Query: 426 YQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLN 485
           YQN  H+ TIF H+NKIP++Q +ADFSRIRMWYIN+QAKFFRQT++FTKYISP ANS+LN
Sbjct: 430 YQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILN 489

Query: 486 IKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVI 545
            KCRNL GRWKNH+ +  E SS+G +GLKVRQIFQRF++ G +  DEPDYRFKFFTSV++
Sbjct: 490 GKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIV 549

Query: 546 SNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQG 605
            +I KSTGY+DG L+YIP+Y+D++RVRNY+KEKT+I+FG+INEYS Q+ LTSNR  F  G
Sbjct: 550 PSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHG 609

Query: 606 RLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTV 665
           ++KVLLYTERLHHFRRYE+K VK+V+FYKPP +PEFY EVVR IGK VFLG+ D+NISTV
Sbjct: 610 KVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTV 669

Query: 666 RCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           RC YSK+DGL+LE++VG+KR  VL HGQNE YEFK
Sbjct: 670 RCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

 Score = 38.5 bits (88), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 3  KRGRKELRSIRRA--KRTKIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXXXXXXYN 60
          K GRK+LR I RA  KR + + EA     +  +  ++  A                  YN
Sbjct: 9  KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQHRGQAYN 68

Query: 61 ALLTILKSEHKE 72
          ALLT+LKSEH E
Sbjct: 69 ALLTLLKSEHPE 80

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/707 (55%), Positives = 483/707 (68%), Gaps = 24/707 (3%)

Query: 3   KRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAXXXXXXXXXXXXXX------XX 56
           KRGRK+LR+I R  R     E +A      +V EA                         
Sbjct: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGARES 72

Query: 57  XXYNALLTILKSEHKEDKVKTHRDHXXXXXXXXXXXXXXXXYNXXXXXXXXXXXXXXXXX 116
             Y ALLT+L +EH + + K  R                                     
Sbjct: 73  QSYGALLTLLSAEHGKQRKKRLR----KAEAEAAEAAEAGEDPEEAITAALENSAQDAED 128

Query: 117 XXXXXXXXXXXXXXKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQV 176
                         +D FD HFN   AA   + L  A K+ + +Y+  K       E + 
Sbjct: 129 AEDAFDDSGESDEEQDHFDVHFNRVSAADVAQ-LDAAFKNGRAQYRVQK-------EARG 180

Query: 177 QEDAIFSVPYI--EGETPKIEDPKLKCSLSSYFLKKRLRIQNNL-LDTESNALTDLQRKI 233
           +E+ ++S P    EG    +  P    SL  Y +K+RLR+ N L  D     LT  Q+ +
Sbjct: 181 EEEILYSKPVASSEGTEGPVRVPAR--SLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVL 238

Query: 234 VDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLD 293
           +DPM QY+DILYEY+ Y + E EYR+LYTLH+LNHVYKTRD+I+KNNQKLQDNPD E LD
Sbjct: 239 LDPMFQYQDILYEYEGYDR-EREYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLD 297

Query: 294 QGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXXXXXQH 353
           QGFTRPK L++ PTR +AY +V  L+++SG++QVDKK KF+DQFYD            QH
Sbjct: 298 QGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQH 357

Query: 354 IFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSV 413
           +FKGNTND+FVLG+KFTRKAI+LYSNFYQSD+IVCSPLGLQ+I+ENTDKKKRQDDFLSS+
Sbjct: 358 VFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSI 417

Query: 414 EVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFT 473
           EV ++DQ HSIE+QN  H+  IF H+NKIPQ+Q DADFSRIRMWYI DQAK FRQTM+FT
Sbjct: 418 EVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFT 477

Query: 474 KYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEP 533
           +YISP AN+LLN KC N  GR K+H++VS+E S +G +GLK+RQIFQRF VLG S  DEP
Sbjct: 478 RYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEP 537

Query: 534 DYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQR 593
           D+RFKFFTSVV+  I K+TGYD G L+YIPEY+D++RVRNY+K+KT ILFGDINEYS+QR
Sbjct: 538 DFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQR 597

Query: 594 SLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTV 653
            LTSNR LF  GR+KVLLYTERLHHFRR+ELKGVK+V+ YKPPS+PEFY+E++RYIGK+ 
Sbjct: 598 QLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSA 657

Query: 654 FLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           FLG ADLNI+TVRC YSK+D LALE+IVGTKR  VLTHGQNE YEFK
Sbjct: 658 FLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/712 (53%), Positives = 485/712 (68%), Gaps = 21/712 (2%)

Query: 3   KRGRKELRSIRRAKRTKIEPEADAGV-----ESSGSVLEAGPAXXXXXXXXXXXXXXXXX 57
           KRGRK+LR I R  R + E +A+         + G                         
Sbjct: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERTAH 63

Query: 58  XYNALLTILKSEHKEDKVKTHRDHXXXXXXXXXXXXXXXXYNXXXXXXXXXXXXXXXXXX 117
            Y ALL+IL S H E + K  +                  Y                   
Sbjct: 64  VYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASLDDSVDKD 123

Query: 118 XXXXXXX------XXXXXXKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSA 171
                              +DPF+ HFN + +      L  A K+  ++Y+S KL     
Sbjct: 124 EEVEEDDGVYSDGEDSEDERDPFEYHFN-QISEMDTNKLDAAFKEKTVQYESTKLPYMHD 182

Query: 172 DEDQVQEDAIFSVPYIEG--ETPKIED-PKLKCSLSSYFLKKRLRIQNNLLDTESNALTD 228
           +E       IFS P IEG   +  + D P  K ++ SYF+KK+L++ N LLD +   LT 
Sbjct: 183 NEG-----FIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLTP 237

Query: 229 LQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPD 288
           L + +VDP+ QY+D+L+EY+ + + E EYRDLYTLH+LNH+YKTRD+I+KNN KLQ+N D
Sbjct: 238 LSKTLVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDD 296

Query: 289 SEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDXXXXXXXXX 348
            E LDQGFTRPKVL++APTR++AY I+ K+I+KSGLDQVDKK KF+DQFY+         
Sbjct: 297 QELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKP 356

Query: 349 XXXQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDD 408
              QH+FKGNTND+FVLG+KFTRK +KLYSNFYQSD+IVCSPLG+Q+I+ENTDKKKRQDD
Sbjct: 357 KSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDD 416

Query: 409 FLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQ 468
           FLSS+E+ ++DQ HS+E+QN  H+ +IF H+NKIPQ+QHD+DFSRIRMWYINDQA+ FRQ
Sbjct: 417 FLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQ 476

Query: 469 TMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNS 528
           T+IFTKY+SP ANSL+N KC N  GR+KN + +S E S++  +GLKVRQ+F RF++   S
Sbjct: 477 TLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGS 536

Query: 529 VADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINE 588
             DEPDYRFKFFTSV +  I KSTGY+DG L+YIP+Y+D++RVRNY K++T ILFG+I E
Sbjct: 537 SVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITE 596

Query: 589 YSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRY 648
           YS+QR +TSNR LF QG++KVLLYTERLHHFRRY++KGVK+V+FYKPPS+PEFY+E++R 
Sbjct: 597 YSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRC 656

Query: 649 IGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700
           IGK  FLG+ADLNISTVRC Y KLD L+LE+IVG+KR  VLT  QNE YEFK
Sbjct: 657 IGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>Skud_16.122 Chr16 (218437..221712) [3276 bp, 1091 aa] {ON} YPL160W
           (REAL)
          Length = 1091

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 625 KGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTK 684
           +  KN+ + K      FYK VV   GK  F+G     I   +  Y +L  L +E ++ TK
Sbjct: 349 RAFKNMSYQKLTPKRSFYKPVVTIPGKA-FIG---TKIHAPQSVYPELRILPMETVIATK 404

Query: 685 RTGVLT 690
            TGV+T
Sbjct: 405 GTGVVT 410

>KLLA0C01738g Chr3 complement(138679..139272) [594 bp, 197 aa] {ON}
           similar to uniprot|P14306 Saccharomyces cerevisiae
           YLR178C TFS1 Carboxypeptidase Y inhibitor (putative)
           lipid binding protein supressor of a cdc25 mutation
          Length = 197

 Score = 33.1 bits (74), Expect = 1.6,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 141 EEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGETPKIEDPKLK 200
           E A+KH  ALGN L  +  + K  ++KV   ++ Q+  DA++S+   + + P   D K  
Sbjct: 39  EYASKHPVALGNTLSIDGTQEKP-EIKVAGGNDAQLDTDALYSLCLTDPDAPSNSDNKW- 96

Query: 201 CSLSSYFLKKRLRIQNNLLDTESNALTDLQ 230
            S   ++L+  +++    LD ++    DL+
Sbjct: 97  -SEYCHYLETNIKLS---LDPDTPMSLDLK 122

>KLLA0E22463g Chr5 complement(2001004..2003178) [2175 bp, 724 aa]
           {ON} similar to uniprot|P46673 Saccharomyces cerevisiae
           YJR042W NUP85 Subunit of the Nup84p subcomplex of the
           nuclear pore complex (NPC) required for assembly of the
           subcomplex and also for formation of the
           nucleocytoplasmic Gsp1p concentration gradient that
           plays a role in nuclear trafficking
          Length = 724

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 613 TERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRC 667
           T RL HF       + N+ F+   ++ EFY E ++Y  K   +GD +  +S + C
Sbjct: 130 TSRLEHF------SIVNLAFHALVTELEFYIESIKYTNKLQRIGDLEECLSILNC 178

>YGL015C Chr7 complement(465043..465435) [393 bp, 130 aa] {ON}
           Putative protein of unknown function; null mutants
           accumulate cargo in the Golgi
          Length = 130

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 4/73 (5%)

Query: 567 DYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKG 626
           D +R  NY   +TS   G IN      +L S+   F+Q      +  ER+HHFR+++ K 
Sbjct: 3   DTIRPLNYADIETS---GPINLLETTNNLKSSLKKFSQKAKGSHISRERIHHFRKWKNKT 59

Query: 627 VK-NVVFYKPPSD 638
              +    KPP D
Sbjct: 60  ESLSENHLKPPPD 72

>KLLA0A01001g Chr1 (94392..95993) [1602 bp, 533 aa] {ON} highly
           similar to uniprot|P43616 Saccharomyces cerevisiae
           YFR044C
          Length = 533

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 28/43 (65%)

Query: 212 LRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTYGKDE 254
           +++ + L+DT+ N L D  +++V P+++ +D LY+   Y  DE
Sbjct: 301 VQVMSTLVDTKGNILIDGIKEMVAPVLETEDALYDKIDYSVDE 343

>TPHA0B01790 Chr2 complement(396879..403103) [6225 bp, 2074 aa] {ON}
            Anc_4.310 YLR430W
          Length = 2074

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 263  LHVLNHVYKTRDKIIKNNQKLQ-DNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVTKL 318
            L ++ H+  T+D + KN  K+  +   S  L+Q   R KVLI AP+  +  +I  +L
Sbjct: 1373 LGIVGHILTTQDALPKNIIKVPGEQNSSPALEQTLKRKKVLICAPSNAAVDEICLRL 1429

>TDEL0C05360 Chr3 complement(956576..959104) [2529 bp, 842 aa] {ON}
           Anc_3.399 YBR133C
          Length = 842

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 26/112 (23%)

Query: 472 FTKYISPVANSLLNIKCRNLEG----RWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLG- 526
           +T YI+P+A+ LL  K +N EG     W  H I  S  SS      K+ +++   + LG 
Sbjct: 520 YTSYIAPIASPLLYQKLKNREGGQNSPWVMHNIPYSVLSS------KINELWSFQHPLGK 573

Query: 527 ---NSVADEPDYRFK------------FFTSVVISNITKSTGYDDGTLIYIP 563
              N  +   +  FK            +FT+ +  N+  ST  DD  +  +P
Sbjct: 574 NDENQFSKNVNSEFKIKYRGELHGLVGYFTAQLYENVMLSTVPDDSIVKLLP 625

>Kpol_401.11 s401 (27650..29101,29104..30750) [3099 bp, 1032 aa]
           {ON} (27650..29101,29104..30750) [3099 nt, 1033 aa]
          Length = 1032

 Score = 31.6 bits (70), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 392 GLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIF 436
           GL    EN ++KKR +D +S+     + ++  IE+  Y  +F ++
Sbjct: 750 GLINFAENEEEKKRLEDLISAAGAVDLKRYQEIEFYTYADIFELY 794

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,738,136
Number of extensions: 3184294
Number of successful extensions: 9848
Number of sequences better than 10.0: 65
Number of HSP's gapped: 10191
Number of HSP's successfully gapped: 79
Length of query: 700
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 583
Effective length of database: 40,065,477
Effective search space: 23358173091
Effective search space used: 23358173091
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)