Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0D04158g2.290ON27227213580.0
Smik_9.862.290ON2642747591e-101
Skud_9.802.290ON2642747511e-99
YIL093C (RSM25)2.290ON2642747405e-98
ZYRO0A01958g2.290ON2632417336e-97
Suva_9.1062.290ON2642507311e-96
NCAS0B062402.290ON2602547266e-96
TDEL0G022002.290ON2612547197e-95
Kpol_1003.402.290ON2612577136e-94
TBLA0B059602.290ON2662387084e-93
Ecym_33292.290ON2582417004e-92
SAKL0E07590g2.290ON2602376953e-91
NDAI0B035402.290ON2612706911e-90
KAFR0J013502.290ON2642386911e-90
KLLA0E08273g2.290ON2612306781e-88
KLTH0G10450g2.290ON2612556711e-87
Kwal_27.115092.290ON2612366692e-87
TPHA0C034202.290ON2682426503e-84
KNAG0A054102.290ON2662396103e-78
ADL211C2.290ON2251805525e-70
Skud_13.4608.853ON96991731.1
Kwal_23.49332.263ON68936693.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D04158g
         (272 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   527   0.0  
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   296   e-101
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   293   1e-99
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   289   5e-98
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   286   6e-97
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   286   1e-96
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   284   6e-96
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   281   7e-95
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   279   6e-94
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   277   4e-93
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   274   4e-92
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   272   3e-91
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   270   1e-90
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   270   1e-90
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   265   1e-88
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   263   1e-87
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   262   2e-87
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   254   3e-84
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   239   3e-78
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   217   5e-70
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...    33   1.1  
Kwal_23.4933 s23 (932420..934489) [2070 bp, 689 aa] {ON} YIL108W...    31   3.1  

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/272 (94%), Positives = 258/272 (94%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
           KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 
Sbjct: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240
                        MFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA
Sbjct: 181 QELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240

Query: 241 GDASAVSSEKQVEDDVVNFDESTDADQEVLHF 272
           GDASAVSSEKQVEDDVVNFDESTDADQEVLHF
Sbjct: 241 GDASAVSSEKQVEDDVVNFDESTDADQEVLHF 272

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/274 (52%), Positives = 192/274 (70%), Gaps = 12/274 (4%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNAVNVL+RTSAYL++G++K+TPAWYNVVASIPP TKFTREPH  NPS    +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  KDP-DLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119
            D  + +  N NGLYKTR N  ++++  K++YKPPKL Y+ED++RTLFYKQHPWEL+RPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 120 IVSENEI-NTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLR 178
           I+ ENEI + + DW +MLQLG+PLDGE+V+QRT+YLLKTK+  N  +AYD AR EFY LR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 179 MXXXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASK 238
           M              MFGS+FG S IEHG+ KEQ+V+  W++    ++EL++A+  N + 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 239 AAGDASAVSSEKQVEDDVVNFDESTDADQEVLHF 272
           +  D + + + ++ E +            E LHF
Sbjct: 241 SWKDDTTLHTAQEEESNTA----------ESLHF 264

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  293 bits (751), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 193/274 (70%), Gaps = 12/274 (4%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNAVNVL+RTSAYL++G++KETPAWYNVVASIPP TKFTREP   NPS    + EL
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  KD-PDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119
            D    +  N+NGLYKTR N  +++V+ K++YKPPKL Y+ED++R LFYKQHPWEL+RPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 120 IVSENEI-NTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLR 178
           I+ ENEI + + DW  MLQLG+PLDGE+VVQRT++LLKTK+  ++ +AYD AR EFY LR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 179 MXXXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASK 238
           M              MFGS+FG S IEHG+ KEQ+V++ W++    ++EL++AK  N + 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 239 AAGDASAVSSEKQVEDDVVNFDESTDADQEVLHF 272
           +  D + +        D    +E T A  E LHF
Sbjct: 241 SWKDDTTL--------DTAQDEEPTTA--ENLHF 264

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  289 bits (740), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 142/274 (51%), Positives = 197/274 (71%), Gaps = 12/274 (4%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNAVNVL+RTSAYL++G++KETPAWYNVVASIPP TKFTREP   NPS    + +L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  KD-PDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119
            D  +    N  GLYKTR N+ +++V  K++Y+PPKL Y+ED++R+LFYKQHPWEL+RPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 120 IVSENEI-NTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLR 178
           I+ ENEI + N DW +MLQ+G+PLDGE+V+QRT+YL+KTK+  ++ +AYD AR EFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 179 MXXXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASK 238
           M              MFGS+FG S IEHG+ KEQ+V++ W++    ++EL++A+  N + 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 239 AAGDASAVSSEKQVEDDVVNFDESTDADQEVLHF 272
           +  D + +++ ++        +EST +  E LHF
Sbjct: 241 SWKDDTTLNTAQE--------EESTTS--ENLHF 264

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  286 bits (733), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 179/241 (74%), Gaps = 1/241 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MK+QTNAVNVLERTSAYLR+G+++ETPAWY VVAS+PP TKFTRE   INPST KK  + 
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
           K+ D E +NR G YKTR ++ +RK  + ++YK PKL +LED++R +FY+QHPWE +RPK+
Sbjct: 61  KEFD-EGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           + ENEIN N DW  M QLG+PLDGE+VVQRT+YLL+   +  I DAYD+ R EFYRLRM 
Sbjct: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240
                        MFGSVF  S I++GV +EQ+VI+ WK+ A  ++ELL+A++ + +++ 
Sbjct: 180 EEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239

Query: 241 G 241
           G
Sbjct: 240 G 240

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  286 bits (731), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 186/250 (74%), Gaps = 2/250 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNAVNVL+RTSAYL++G++K+TPAWYNVVASIPP TKFTREP   NPS  + + +L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  KD-PDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119
            D  + +  N NGLYKTR N  +R+V  K++YKPPKL Y+ED++R LFYKQHPWEL+RPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 120 IVSENEI-NTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLR 178
           I+ ENE+ + N DW +MLQLG+ LDGE+V+QRT++LLKT++  ++ +AYD AR EFY LR
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 179 MXXXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASK 238
           M              MFGS+FG S+IEHG+ KEQ+V++ W++    ++EL++A+  N + 
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPAG 240

Query: 239 AAGDASAVSS 248
           +  D + + +
Sbjct: 241 SWKDDATLDT 250

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  284 bits (726), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 135/254 (53%), Positives = 190/254 (74%), Gaps = 2/254 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           M++QTNA+N++ERTSAYL++G++K TPAWY VVA IPP  KFTREP  INPST++ ++ L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
           +D + E+VN+ G YKTR N L+RKV + ++YKPPKL Y+ED++RTLF+ QHPWEL+RPKI
Sbjct: 61  RD-NREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           + EN +    DW ++ QLG+PLDGE+VVQRT+YLLKT +   IT AY+QAR EFYR R+ 
Sbjct: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMIT-AYNQARFEFYRFRIQ 178

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240
                        MFGSVF  S I+ G+ KEQ+VI++WK+ AE ++EL++A++ N S + 
Sbjct: 179 QEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSW 238

Query: 241 GDASAVSSEKQVED 254
             A A ++E+ +++
Sbjct: 239 ISAEAGATEENLDE 252

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  281 bits (719), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 134/254 (52%), Positives = 184/254 (72%), Gaps = 1/254 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNAVNVLERTSAYLR+G+++ TPAWY+VVASIPP TKFTREP  INPS  KK++ L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
           KD   +  N  G +KTR + L++K+ N ++Y+ PKL ++ED++R +FYKQHPWEL+RPK+
Sbjct: 61  KD-HADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           + EN+     DW ++ QL +PLDGE+V+QRTL+LLK  E  ++T+AYDQAR EFYRLRM 
Sbjct: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240
                        MFGS++GPS I+ GV +EQ+ I+ WK+ A  +++LL+A++ N S+A 
Sbjct: 180 QEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239

Query: 241 GDASAVSSEKQVED 254
                   +K +ED
Sbjct: 240 AAGEEQPDKKDLED 253

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  279 bits (713), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 179/257 (69%), Gaps = 2/257 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQ NAVNVLERTSAYLR G++ + PAWYNVVAS+PP+ KF R P   NPS D+   +L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
              D  S   NG++KTR+ A +R  A+KQ+Y   KL Y+ED++R +FYKQHPWEL+RPKI
Sbjct: 61  HSLD-SSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           + EN  +   DW +M Q+G+PLDGE+VVQRTLYL+K KE  ++  AYD AR EFYRLRM 
Sbjct: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKA- 239
                        MFGSVFGPS IE+G+ KEQ+VI+ WKR A +Q+E+++A++ N S++ 
Sbjct: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239

Query: 240 AGDASAVSSEKQVEDDV 256
           A D         +E+DV
Sbjct: 240 ATDEKDPKKNDDIEEDV 256

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  277 bits (708), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 137/238 (57%), Positives = 171/238 (71%), Gaps = 2/238 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQ NAVNVLERTSAYL+ G+IK+ P WY+VVA+ PP  KFTREP  INPST+K+  E 
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  KDPDLESVNRN-GLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119
           K P  + +NR  GLYKTR N++++K A   +YK PKL Y+EDK+R LFY+QHPWEL RPK
Sbjct: 61  K-PLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPK 119

Query: 120 IVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179
           IV EN      DW  +LQLG+PLDGE+VVQRTL+LLKTKE   + DAY+QAR EFYRLRM
Sbjct: 120 IVMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRM 179

Query: 180 XXXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENAS 237
                         MFG+VFG +TIE G+ KEQ++I+ WK +A  ++E+  AK+   S
Sbjct: 180 AEEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKES 237

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  274 bits (700), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 127/241 (52%), Positives = 167/241 (69%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNA N+LERTS++LR G++  TP WY+V+   PP TKF R+P  +NPST    ++L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
           ++      + +G YKTR N  E++V+   +Y+ PKL Y EDK+R+LFYKQHPWEL+RPKI
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           + EN+ +   DW  + QLG+PLDGE+VVQRTLYLL + E +N+ DAYDQAR EFYRLRM 
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240
                        M GSVFGPS +E G+ KEQ+VI+ WK+ A  Q EL+SAK+ + S   
Sbjct: 181 QELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSANW 240

Query: 241 G 241
           G
Sbjct: 241 G 241

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  272 bits (695), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 168/237 (70%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MK+QTNAVN+LERTSAYLR G++ + PAWYNVVAS+PP   F REP   NPS +K ++ L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
            +       +NG YKTR +  +RKV+  ++YK PKL Y EDK+R LFY+QHPWEL+RPK+
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           + EN    + DW  + QLG+PLDGE+VVQRTLYLLK K+Q  + +AYDQAR EFYR+R+ 
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENAS 237
                        MFGSVFG S+IE+G+ KEQ+VIE WK+ A  Q+EL++A+    S
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  270 bits (691), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 134/270 (49%), Positives = 185/270 (68%), Gaps = 11/270 (4%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNAVN++ERTSAYL +G+++ TPAWY+VVASIPP  KFTREP   NP+T +  +  
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
           KD D   VN  GLYKTR N ++RK +   +YKPPKL+YLED++R+LF++QHPWEL+RPKI
Sbjct: 61  KD-DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKI 119

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           + EN +  N DW ++ Q  + LDGE+VVQRTLYLLK +   N+  AY++AR EFYRLR+ 
Sbjct: 120 LIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQ 179

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240
                        MFGS+F  ++ EHG+ KEQ+VIE+WK+ A  +++L+  +  N S   
Sbjct: 180 QDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPS--- 236

Query: 241 GDASAVSSEKQVEDDVVNFDESTDADQEVL 270
            D+ A   E+ +E+D       T+ + E+L
Sbjct: 237 -DSWAAPEEQDLEEDF------TEGEPEIL 259

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  270 bits (691), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 171/238 (71%), Gaps = 2/238 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNA N+LERTSAYL+ G+++  PA+Y+V+A +PP TKFTREP  +NPST +  +  
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
           ++   + VN  GLYKTR+ A +R  +  ++YK  +L YLED +R LFY QHPWEL+RPKI
Sbjct: 61  REL-TDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119

Query: 121 VSENEI-NTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179
           V EN I N++ DW N+ QLG+P+DGE+VVQRTL+L+K K+  N+ D YDQAR EFY++RM
Sbjct: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179

Query: 180 XXXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENAS 237
                         MFGS+FGP+ +E+G+ +EQ VI KWK+ A  ++ELL AK+ N S
Sbjct: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPS 237

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  265 bits (678), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 165/230 (71%), Gaps = 1/230 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MK+Q  AVNVLERTSAYL++G++K+TPAWYNV+A +PP  KF R P   +P   K  + L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
            D      N +GLYKTR N+LE+K    ++Y+ PKLVY+EDK+R LF++QHPWEL+RPKI
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 121 VSENEINTNP-DWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179
           + EN + T   DW ++ QLG+PLDGE+VVQRTL+LLK+ E+  + DAYDQAR EFYRLR+
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 180 XXXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELL 229
                         MFGSVF  ++IE+G+ KEQ+VI+ WKR A  Q+EL+
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELM 230

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  263 bits (671), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 127/255 (49%), Positives = 177/255 (69%), Gaps = 1/255 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MK+Q NAVNVLERTS+YL+ G++K+TPAWY+VVA +PP  +F REP  +NPST+K+ ++L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
            +   +    N  YKTR +  ER+V+  +++  PKL Y EDK+R +FY+QHPWEL+RPK+
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           + EN    + DW  + QLG+PLDGE+VVQRTLYLL+TK    +  AYDQAR EFYRLR+ 
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKA- 239
                        MFGSVFGPS I+ G+ KEQ++I+ WK+ A  Q+E++SA+  N S++ 
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240

Query: 240 AGDASAVSSEKQVED 254
           +   S   S+ + ED
Sbjct: 241 SAQESQPQSDAKAED 255

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  262 bits (669), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 169/236 (71%), Gaps = 2/236 (0%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MK+Q NAVNVLERTS+YLR G++K+TPAWY VVA IPP  +F REP  +NPST+ ++++L
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  KDPDLESVN-RNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119
            +   ES N  N  YKTR +  +++V+  ++YK PKL Y EDK+R LF++QHPWEL+RPK
Sbjct: 61  SEFR-ESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPK 119

Query: 120 IVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179
           ++ EN    + DW  + QLG+PLDGE+VVQRTLYLLK+K+   +  AYDQAR EFYRLR+
Sbjct: 120 MLVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 179

Query: 180 XXXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKEN 235
                         M GSVFGPS I+ G+ KEQ++I+ WK+ A  QSELLSA+  N
Sbjct: 180 QEEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTN 235

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  254 bits (650), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 169/242 (69%), Gaps = 3/242 (1%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQ NAVNVLERTS+YLR+G++ + PAWYNVVA IPP  KF R P   NPS +KK++EL
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  KDPDLESV-NRNG--LYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELAR 117
           +  D   V +RNG  L+K+R+N L++K ++K +YKP KL Y+ED++R +FY QHPWEL+R
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 118 PKIVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRL 177
           PKIV EN  +   DW ++ QLG+ LDGENVVQR +YL+K K          +AR EFYR+
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180

Query: 178 RMXXXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENAS 237
           RM              MFGSVFGPSTIE G+ +EQ+VI+ WKR A  ++EL+ AK+ N S
Sbjct: 181 RMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240

Query: 238 KA 239
           + 
Sbjct: 241 ET 242

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  239 bits (610), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 116/239 (48%), Positives = 162/239 (67%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNAVN+LERTSA+L +GVI++ PAWYNVVA+ PP  KF R+P  +NPST K    L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120
           K       N + +YKTR++  +++V++  +Y+PPKLVYLED++R LFY QHPWE +RP I
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMX 180
           + EN +    DW  + QLG+ LDGE+VVQR L+LL+     +++ AYD+AR EFYR+RM 
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 181 XXXXXXXXXXXXXMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKA 239
                        M+GSV+  S IE G+ KE +VIE WKR    ++E + A++ + S++
Sbjct: 181 QELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSES 239

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  217 bits (552), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 135/180 (75%), Gaps = 4/180 (2%)

Query: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60
           MKIQTNAVNVL+RTS YL+ G++K+TPAWYNVVA IPPVTKF REP   +P + K   EL
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  KDPDLESVNRNG-LYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119
            D   + +NRN   YKTR  + +R+ A   ++KP KL ++EDK+R+LF++QHPWEL+RPK
Sbjct: 61  -DIMTDRLNRNTETYKTRAGSSDRQTA--AVHKPSKLRFIEDKLRSLFFQQHPWELSRPK 117

Query: 120 IVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179
           ++ EN  N   DW  MLQLG+PLDGE+VVQRTLYLLK+     +  AYDQAR EFYRLRM
Sbjct: 118 VLVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 11/91 (12%)

Query: 64  DLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYK------QHPW-ELA 116
           D+ES+N++ L++T+   LE  +  KQ+ +  +    + + R  + K       + W  LA
Sbjct: 69  DIESINKDFLHRTK--GLEPNIELKQLSQIKE--EFQQRYRDRYIKPSETWYTNSWRSLA 124

Query: 117 RPKIVSENEINTNPDWKNMLQLGQPLDGENV 147
           +PKI S N IN+N      L+   PL+ + V
Sbjct: 125 KPKISSHNLINSNIQLDAQLKFSNPLEFQPV 155

>Kwal_23.4933 s23 (932420..934489) [2070 bp, 689 aa] {ON} YIL108W -
           Hypothetical ORF [contig 6] FULL
          Length = 689

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 5/36 (13%)

Query: 53  TDKKVSELKDPDLESVNRN-----GLYKTRFNALER 83
           ++K VSE++DPDL   NRN     GL+    +AL +
Sbjct: 180 SEKSVSEIRDPDLAQQNRNAKNAGGLFGIAMDALRK 215

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,375,289
Number of extensions: 1149748
Number of successful extensions: 5050
Number of sequences better than 10.0: 49
Number of HSP's gapped: 5174
Number of HSP's successfully gapped: 49
Length of query: 272
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 164
Effective length of database: 41,097,471
Effective search space: 6739985244
Effective search space used: 6739985244
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)