Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0C05203g3.165ON47547524550.0
NCAS0C035803.165ON49150116450.0
Smik_15.963.165ON49149716160.0
YOL062C (APM4)3.165ON49150016110.0
Suva_15.1033.165ON49149916000.0
NDAI0G029203.165ON48649315940.0
Skud_15.913.165ON49149615910.0
TDEL0D045803.165ON48248915800.0
ZYRO0B04840g3.165ON47649015720.0
Kpol_1045.443.165ON46947715530.0
SAKL0C07414g3.165ON48248714740.0
KLTH0F06534g3.165ON46647814430.0
Kwal_33.141823.165ON46748114080.0
KNAG0K011503.165ON47448914080.0
TPHA0P006603.165ON47348213710.0
TBLA0F008403.165ON48148613370.0
Ecym_52393.165ON46449312741e-173
KLLA0C03894g3.165ON47549411731e-157
KAFR0C010203.165ON42848110911e-145
ADR315W3.165ON49244710761e-142
SAKL0F05346g7.127ON4474855337e-62
KLLA0D14311g7.127ON4434855311e-61
Kwal_55.208437.127ON4414855283e-61
KLTH0F12584g7.127ON4414855283e-61
ADL017C7.127ON4434835013e-57
Smik_6.4667.127ON4765085007e-57
KNAG0L009507.127ON4614984981e-56
Suva_16.457.127ON4785114972e-56
Ecym_83507.127ON4454854943e-56
YPL259C (APM1)7.127ON4755084954e-56
CAGL0K00539g7.127ON4564904935e-56
ZYRO0C05236g7.127ON4474794873e-55
NDAI0E036807.127ON4444894812e-54
KAFR0L004707.127ON4655024781e-53
TBLA0A009507.127ON4695054762e-53
Skud_16.197.127ON4765094762e-53
TPHA0C043207.127ON4544884743e-53
TDEL0H028907.127ON4424854691e-52
NCAS0E021407.127ON4814864642e-51
Kpol_1062.567.127ON4504894509e-50
KLTH0D07502g2.555ON5044672682e-24
SAKL0D13090g2.555ON4994862495e-22
Kwal_26.81462.555ON5054652424e-21
KLLA0F25432g2.555ON5073572336e-20
ZYRO0E05874g2.555ON5493292248e-19
ABR047W2.555ON4984262202e-18
Ecym_45912.555ON5014672193e-18
TDEL0B064302.555ON5255052142e-17
KAFR0A020602.555ON5403502113e-17
CAGL0K03223g2.555ON5984051937e-15
Kpol_1056.132.555ON5413351911e-14
KNAG0C055502.555ON5823731902e-14
NCAS0A126502.555ON5883541873e-14
TPHA0I023902.555ON5593611839e-14
TBLA0B067602.555ON6572531821e-13
Skud_8.262.555ON5963591821e-13
Smik_8.232.555ON6033741793e-13
Suva_8.332.555ON5963711776e-13
YHL019C (APM2)2.555ON6053741671e-11
KLTH0D06556g2.522ON4563401642e-11
NDAI0B016102.555ON6722381642e-11
KLLA0E18789g2.522ON4971341392e-08
Kwal_26.79572.522ON4563391374e-08
KAFR0D035602.522ON4553151356e-08
TPHA0C041302.522ON5331401277e-07
TBLA0I006202.522ON6091681242e-06
SAKL0A09218g2.522ON4731841204e-06
TDEL0A029702.522ON4961401133e-05
AGL061W2.522ON4111411124e-05
Kpol_1018.422.522ON5751471125e-05
NDAI0K019302.522ON6121631091e-04
NCAS0A048702.522ON4892051072e-04
Ecym_72662.522ON5171661044e-04
ZYRO0B01738g2.522ON492330990.001
CAGL0L02145g2.522ON543156990.002
Smik_2.4302.522ON484323910.015
Skud_2.4192.522ON484135890.025
Suva_4.5482.522ON484333840.11
YBR288C (APM3)2.522ON483134820.16
NCAS0F040103.575ON54778810.25
Suva_5.221.491ON15262711.6
KNAG0L015907.251ON86639732.5
Ecym_14035.587ON148597723.8
KNAG0A069702.522ON505144713.9
KNAG0C039607.315ON688176704.9
KAFR0B017808.76ON19050668.5
CAGL0C00253gsingletonON160862689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C05203g
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   950   0.0  
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   638   0.0  
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   627   0.0  
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   625   0.0  
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   620   0.0  
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   618   0.0  
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   617   0.0  
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   613   0.0  
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   610   0.0  
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   602   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   572   0.0  
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   560   0.0  
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   546   0.0  
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   546   0.0  
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   532   0.0  
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   519   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   495   e-173
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   456   e-157
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   424   e-145
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   419   e-142
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   209   7e-62
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   209   1e-61
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   207   3e-61
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   207   3e-61
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   197   3e-57
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   197   7e-57
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   196   1e-56
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   196   2e-56
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   194   3e-56
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   195   4e-56
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   194   5e-56
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   192   3e-55
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   189   2e-54
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   188   1e-53
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   187   2e-53
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   187   2e-53
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   187   3e-53
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   185   1e-52
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   183   2e-51
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   177   9e-50
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   107   2e-24
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   100   5e-22
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...    98   4e-21
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    94   6e-20
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    91   8e-19
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...    89   2e-18
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...    89   3e-18
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...    87   2e-17
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    86   3e-17
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    79   7e-15
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    78   1e-14
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    78   2e-14
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    77   3e-14
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    75   9e-14
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    75   1e-13
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    75   1e-13
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    74   3e-13
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    73   6e-13
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    69   1e-11
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    68   2e-11
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    68   2e-11
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    58   2e-08
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    57   4e-08
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    57   6e-08
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    54   7e-07
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    52   2e-06
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    51   4e-06
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    48   3e-05
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    48   4e-05
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    48   5e-05
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    47   1e-04
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    46   2e-04
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    45   4e-04
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    43   0.001
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    43   0.002
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    40   0.015
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    39   0.025
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    37   0.11 
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    36   0.16 
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    36   0.25 
Suva_5.22 Chr5 complement(40406..40864) [459 bp, 152 aa] {ON} YE...    32   1.6  
KNAG0L01590 Chr12 (282307..284907) [2601 bp, 866 aa] {ON} Anc_7....    33   2.5  
Ecym_1403 Chr1 complement(835068..839525) [4458 bp, 1485 aa] {ON...    32   3.8  
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    32   3.9  
KNAG0C03960 Chr3 (776556..778622) [2067 bp, 688 aa] {ON} Anc_7.3...    32   4.9  
KAFR0B01780 Chr2 (348976..349548) [573 bp, 190 aa] {ON} Anc_8.76...    30   8.5  
CAGL0C00253g Chr3 complement(18884..23710) [4827 bp, 1608 aa] {O...    31   9.2  

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/475 (97%), Positives = 463/475 (97%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
           VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSNN 180
           NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSNN
Sbjct: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSNN 180

Query: 181 SSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTHLSG 240
           SSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTHLSG
Sbjct: 181 SSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTHLSG 240

Query: 241 TPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDKDR 300
           TPVCQFGLNDSLSVKNDDYGDSFDY            GSVLLEDCKFHQCVSLEKFDKDR
Sbjct: 241 TPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFHQCVSLEKFDKDR 300

Query: 301 IIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAKNV 360
           IIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAKNV
Sbjct: 301 IIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAKNV 360

Query: 361 TMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAPRLN 420
           TMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAPRLN
Sbjct: 361 TMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAPRLN 420

Query: 421 IQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESERYKTVKWIRYVSKSGSYEIRY 475
           IQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESERYKTVKWIRYVSKSGSYEIRY
Sbjct: 421 IQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESERYKTVKWIRYVSKSGSYEIRY 475

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/501 (63%), Positives = 394/501 (78%), Gaps = 36/501 (7%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MI+A+L+F++RGEL+VSK FK ++KRSI+DIFRIQVINNLDVRSPILTLGSTTF HI+S 
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKS- 59

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVML-G 119
             GD+LW+V+V+R+N++  A+WEFLYK D +L+ YGLN+EE+LKEEFM+ +ELLDVM+ G
Sbjct: 60  TRGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCG 119

Query: 120 ENGTPMDTDPATVIKKMSVKPSKETIE-------NFAISVQNKNSTLPKI----PKFLRR 168
             G PM T+ + VI +MSVKPSK  +E       +   +  N N+ +P +    PK LRR
Sbjct: 120 SGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPKLLRR 179

Query: 169 TSSFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYV 228
            S+ L+Q+ S        +  +  WRPKGI HKKNE+ L+VNE+I+ILVSK+GS+LK+YV
Sbjct: 180 NSASLSQDLS--------ILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYV 231

Query: 229 DGTIDLVTHLSGTPVCQFGLNDSLSV------------KNDDYGD-SFDYXXXXXXXXXX 275
           DG+IDL THLSGTP+CQFGLNDSLSV             N  +GD +FD           
Sbjct: 232 DGSIDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFD-KTDKKQLSMA 290

Query: 276 XXGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYS 335
             GSV+LEDCKFHQCVSL+KFDKDRIIKFVPPDGSMELMKYHVR N+NLPFKVSPIVT +
Sbjct: 291 SVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNT 350

Query: 336 SSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTF 395
            +GTA+EYRIT+KSLFP +L+AKNV + IPVPP T+DCKI+V+NGSCKF PEE AM+W F
Sbjct: 351 RNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRF 410

Query: 396 NKYNGLTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKE-SE 454
           NK+NGLTENTLSAVTI +KD  +L++QQW KPP+SLDFEI+MFSNSGLVVRYFTI E  +
Sbjct: 411 NKFNGLTENTLSAVTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQ 470

Query: 455 RYKTVKWIRYVSKSGSYEIRY 475
           +YK VKWI+Y+S+SGSYEIRY
Sbjct: 471 KYKAVKWIKYISRSGSYEIRY 491

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/497 (61%), Positives = 384/497 (77%), Gaps = 28/497 (5%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MIS VL++SSRGEL+++KFFKN+LKRSISDIFR+QVINNLDVRSP+LTLGSTTF HIRS 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
            HGD+LWLV++TRSN N  A+WEFLYK D ++  Y L+ EE LKEEFM+ +E+LD+MLG 
Sbjct: 61  -HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLP------------KIPKFLRR 168
           NG P+DT+  +VI +MSVKP + T     +   + N  L               PKFL++
Sbjct: 120 NGIPIDTELNSVIAQMSVKPVRNT--GGLLDSPDGNDMLSSSSSPSSVSGELHFPKFLKK 177

Query: 169 TSS-FLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSY 227
           +SS FL Q    +S+  F    ++ WRPKGI+HKK+E+FLYVNE+++ILVS++GSILKSY
Sbjct: 178 SSSSFLGQ---GDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSY 234

Query: 228 VDGTIDLVTHLSGTPVCQFGLNDSLSVKNDD--------YGDSFDYXXXXXXXXXXXXGS 279
           VDGTID+ THLSGTP+C+FGLNDSL ++++D           S               GS
Sbjct: 235 VDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGS 294

Query: 280 VLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGT 339
           VLLEDCKFH+CVSL+KF+K+  I+FVPPDGSMELMKYHVR NINLPFK++PIVT+S+   
Sbjct: 295 VLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDN 354

Query: 340 AVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYN 399
            ++YRITLKSLFP KL+AK+VT+ IPVPP T+DCKI VSNG CKF PEE AM+W FNKYN
Sbjct: 355 EIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYN 414

Query: 400 GLTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTI-KESERYKT 458
           GLTENTLSAVT+++ D  +LN+QQW +PP+SLDFE+MMFSNSGLVVRYFTI  +  +++ 
Sbjct: 415 GLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRA 474

Query: 459 VKWIRYVSKSGSYEIRY 475
           VKWI+Y+S+SGSYE+RY
Sbjct: 475 VKWIKYISRSGSYEVRY 491

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/500 (61%), Positives = 383/500 (76%), Gaps = 34/500 (6%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MIS VLV+SSRGEL+++KFFKN+LKRSISDIFR+QVINNLDVRSP+LTLGSTTF HIRS 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
            HGD+LWLV++TRSN N  A+WEFLYK D ++  Y L+ EE LKEEFM+ +E+LD+MLG 
Sbjct: 61  -HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLP------------KIPKFL-R 167
           NG P+DT+  +VI +MSVKP +       +   + N  L               PKFL +
Sbjct: 120 NGIPIDTELNSVIAQMSVKPVRNM--GGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLTK 177

Query: 168 RTSSFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSY 227
           R+SSFL Q    +S+  F    ++ WRPKGI HKK+E+FLYVNE+I+ILVS++GSILKSY
Sbjct: 178 RSSSFLGQ---GDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSY 234

Query: 228 VDGTIDLVTHLSGTPVCQFGLNDSLSVKNDD-----------YGDSFDYXXXXXXXXXXX 276
           VDGTID+ THLSGTP+C+FGLNDSL ++++D            G  F             
Sbjct: 235 VDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFG---NKNFIPKAA 291

Query: 277 XGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSS 336
            GSVLLEDCKFH+CVSL+KF+++ II+FVPPDGSMELMKYHVR NINLPFKV+PIVT+S+
Sbjct: 292 AGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHST 351

Query: 337 SGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFN 396
               ++YRITLKSLFP KL+AK+V + IPVPP T+DCKI VSNG CKF PEE AM+W FN
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFN 411

Query: 397 KYNGLTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIK-ESER 455
           KYNGLTENTLSAVT+++ D  +LN+QQW +PPISL+FE+MMFSNSGLVVRYFTI  +  +
Sbjct: 412 KYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSK 471

Query: 456 YKTVKWIRYVSKSGSYEIRY 475
           ++ VKWI+Y+SK+GSYE+RY
Sbjct: 472 HRAVKWIKYISKAGSYEVRY 491

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/499 (61%), Positives = 387/499 (77%), Gaps = 32/499 (6%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MIS VLV+SSRGELI++KFFKN+LKRSISDIFR+QVINNLDVRSP+LTLGSTTF HIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRS- 59

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
           + GD+LWLV++TRSN N  A+WEFLYK D ++  Y L+ EE LKEEFM+ +E+LD+MLG 
Sbjct: 60  MRGDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNST--------------LPKIPKFL 166
           NG P+DT+  +VI +MSVKP    I N    +++ +S                   PKFL
Sbjct: 120 NGIPIDTELNSVIAQMSVKP----IRNVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFL 175

Query: 167 R-RTSSFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILK 225
           + R+SSFL Q  S++    F+   ++ WRPKGI HKK+E+FLYVNE+++ILVS++GSILK
Sbjct: 176 KKRSSSFLGQGDSHSD---FSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 226 SYVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGD--------SFDYXXXXXXXXXXXX 277
           SYVDGTID+ THLSGTPVC+FGLNDSL ++++D  +        S +             
Sbjct: 233 SYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAA 292

Query: 278 GSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSS 337
           GSVLLEDCKFH+CVS++KF+K+ II+FVPPDGSMELMKYHVR NINLPFK++PIV +S+ 
Sbjct: 293 GSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSAR 352

Query: 338 GTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNK 397
              V+YRITLKSLFP KL+AK+V + IPVPP T+DCKI VSNG+CKF PEE AM+W FNK
Sbjct: 353 DNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNK 412

Query: 398 YNGLTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RY 456
           +NGLTENTLSAVT+++ D  +L++QQW +PP+SLDFE+MMFSNSGLVVRYFTI   + ++
Sbjct: 413 FNGLTENTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKH 472

Query: 457 KTVKWIRYVSKSGSYEIRY 475
           + VKWI+Y+SKSGSYE+RY
Sbjct: 473 RAVKWIKYISKSGSYEVRY 491

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/493 (61%), Positives = 375/493 (76%), Gaps = 25/493 (5%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MI+ +L++S RGELIVSK FK  LKRSI+DIFRIQVINNLDVRSPILTLGSTTF HIRS+
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
              D+LWLV+ TR+N N  A+WEFLYK D ML  YGLN EE+LKEEFM+ +ELLDVMLG 
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAI----SVQNKNSTLPKIPKFLRRTSSFLNQE 176
            G P++T+P+ VI KMSVKP+K    N +      + +K +    +PKFL+R  S     
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDS----S 176

Query: 177 SSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVT 236
            S++S+ +FN   +  WRPK I HKKNE+ L+VNEKI+ILV+K+GSILK+YVDG+IDL T
Sbjct: 177 QSHDSNFSFN---DFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQT 233

Query: 237 HLSGTPVCQFGLNDSLSVKNDDYGDS-------------FDYXXXXXXXXXXXXGSVLLE 283
            LSGTPVCQFGLNDSL++ ++D   S              D             G+V+LE
Sbjct: 234 RLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILE 293

Query: 284 DCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEY 343
           DCKFHQCVSL+KFD++RIIKFVPPDGS+ELMKYH+R+N+NLPFK++PIVT S +G A++Y
Sbjct: 294 DCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDY 353

Query: 344 RITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTE 403
           RI LKSLFP +L+AK V + IPVPP  +DC I VSNG+CKF P E AM+W FNKYNGLTE
Sbjct: 354 RIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTE 413

Query: 404 NTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESER-YKTVKWI 462
           NTLSAVT+ SK+  +  +QQW +PP+SLDFEI+MFSNSGLVVRYFTI E  + YK VKWI
Sbjct: 414 NTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWI 473

Query: 463 RYVSKSGSYEIRY 475
           +YVSKSGSYE+R+
Sbjct: 474 KYVSKSGSYEVRF 486

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/496 (60%), Positives = 384/496 (77%), Gaps = 26/496 (5%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MIS VLV+SSRGELI++KFFKN+LKRSISDIFR+QVINNLDVRSP+LTLGSTTF HIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
            HGD+LWLV++TRSN N  A+WEFLYK D ++  Y L+ EE LKEEFM+ +E+LD+MLG 
Sbjct: 61  -HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119

Query: 121 NGTPMDTDPATVIKKMSVKPSKET-----------IENFAISVQNKNSTLPKIPKFLRRT 169
           NG P+DT+  +V+ +MSVKP + T           I + + S  +    L   PKFL+++
Sbjct: 120 NGIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGEL-HFPKFLKKS 178

Query: 170 SS-FLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYV 228
           SS FL Q    +S+  F  + ++ WR  GI HKK+E+FLYVNE+++ILVS++GSILKSYV
Sbjct: 179 SSSFLGQ---GDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYV 235

Query: 229 DGTIDLVTHLSGTPVCQFGLNDSLSVKNDD--------YGDSFDYXXXXXXXXXXXXGSV 280
           DGTID+VTHL+GTPVC+FGLNDSL ++++D        +  S               GSV
Sbjct: 236 DGTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSV 295

Query: 281 LLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTA 340
           LLEDCKFH+CVS+EKF+K+ II+F+PPDGSMELMKYHVR NINLPFK++PIV++S+    
Sbjct: 296 LLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNE 355

Query: 341 VEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNG 400
           ++YRITLKSLFP KL+AK+V + IPVPP T+DCKI VSNG CKF PEE AM+W FNKYNG
Sbjct: 356 IDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNG 415

Query: 401 LTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIK-ESERYKTV 459
           LTENTLSA T+++ D  +L+ QQW +PP+SLDFE+MMFSNSGLVVRYFTI  +  +++ V
Sbjct: 416 LTENTLSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAV 475

Query: 460 KWIRYVSKSGSYEIRY 475
           KWI+Y+SKSGSYE+RY
Sbjct: 476 KWIKYISKSGSYEVRY 491

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/489 (61%), Positives = 371/489 (75%), Gaps = 21/489 (4%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MISA+L+FSSRGELIV+K  K++LK+SISDIFRIQVINNLDVRSPILTLGSTTF HIRS+
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
              D LWLV+V+RSN N GA+WEFLYK + ++++YGL  E  LKE FM CYE+LD +L E
Sbjct: 61  -GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEE 119

Query: 121 NGTPMDTDPATVIKKMSVKPSKE------------TIENFAISVQNKNSTLPKIPKFLRR 168
            G P+DT+  +VI KM+VKP K+            T+ +  +S    +S+   +PKFL R
Sbjct: 120 GGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTR 179

Query: 169 TSSFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYV 228
            +  ++Q+  +N          L WRP GI +KKNE+ L VNEKISILVS++GSILKSYV
Sbjct: 180 NNRSMSQDLGSN------YPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYV 233

Query: 229 DGTIDLVTHLSGTPVCQFGLNDSLSVK-NDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKF 287
           DGTIDL THLSG P+CQFGLNDSLSV+  DD     +             G V+LEDCKF
Sbjct: 234 DGTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKF 293

Query: 288 HQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITL 347
           HQCVSL+KF+KDR+IKFVPPDGSMELMKY VR N+NLPFKV+PIVT    G  ++YR+TL
Sbjct: 294 HQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTL 353

Query: 348 KSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLS 407
           KSLFP KL+AK+V+++IPVPP T+DC+I+VSNG CKF PEE AM+W F KY GLTENTLS
Sbjct: 354 KSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLS 413

Query: 408 AVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKE-SERYKTVKWIRYVS 466
           AVT+ S D  +L +QQW +PP+SL+FEIMMFSNSGLVVRYF + +  ERY+T KWI+Y+S
Sbjct: 414 AVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYIS 473

Query: 467 KSGSYEIRY 475
           KSGSYEIRY
Sbjct: 474 KSGSYEIRY 482

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/490 (61%), Positives = 376/490 (76%), Gaps = 29/490 (5%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MI+A+ ++S+RGELIVSK F N+LKRSISDIFRIQVINNLDVRSPILTLGSTTF HIRSN
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
              D LW+V+V+R+N N GA+WEFLYKF+ +L+ Y L  EE LKE+FM+CYE+LDV++G 
Sbjct: 61  -GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGA 119

Query: 121 NGTPMDTDPATVIKKMSVKPSKE----------TIENFAISVQNKNSTLPKIPKFLRRTS 170
            G PMDT+  ++  K+SVKP K           T+ NF  S  N +++   +PKFL R +
Sbjct: 120 GGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGS--NLSTSNLSMPKFLTRNN 177

Query: 171 SFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDG 230
             ++Q+   N    F      PWRP GI +KKNE+FLYVNEKI+ILVS++GSILK+YVDG
Sbjct: 178 RSMSQDLGTNYPSNF------PWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDG 231

Query: 231 TIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSF----DYXXXXXXXXXXXXGSVLLEDCK 286
           TID+ THLSGTP+CQFGLNDS SV   ++GDS                   GSV+LEDCK
Sbjct: 232 TIDMTTHLSGTPICQFGLNDSPSV---EFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCK 288

Query: 287 FHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRIT 346
           FHQCVSL+KF+K+RIIKFVPPDG+MELMKY VR N+NLPFK++P+VT    G+ VEYRIT
Sbjct: 289 FHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVT--PCGSTVEYRIT 346

Query: 347 LKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTL 406
           LKSLFP+KL+AK+V + IPVPP T+DCKI++SNG CKF  EE AM+W FNKY+GLTENTL
Sbjct: 347 LKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTL 406

Query: 407 SAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKE-SERYKTVKWIRYV 465
           SAVT+ + D  +L +QQW +PP+SL FEIMMFSNSGLVVRYF + +  E+Y+ VKWI+Y+
Sbjct: 407 SAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYI 466

Query: 466 SKSGSYEIRY 475
           SKSGSYE+RY
Sbjct: 467 SKSGSYEVRY 476

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/477 (62%), Positives = 369/477 (77%), Gaps = 10/477 (2%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MI+ VLV++ +GELIVSKF K+N KRSISDIFR+QVINNLDVRSPILTLGSTTF HIRSN
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
              D LWLV+VTRSN N GA+WEFLYKFD +L  +GL+NE  LKEEFM CYELLD+ML  
Sbjct: 61  SR-DHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNV 119

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSNN 180
           +G P+DT+ ++V  KMS KP   +I + + S  + +S+   I KFL R +  ++ ++ N 
Sbjct: 120 DGVPLDTELSSVSAKMSTKP-LHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDTMNT 178

Query: 181 SSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTHLSG 240
               +      PWRP GI +KKNEIFL +NEKISILVSK+ +ILK+YVDGT+DL +HLSG
Sbjct: 179 EPSNY------PWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSG 232

Query: 241 TPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXX-XXXXGSVLLEDCKFHQCVSLEKFDKD 299
           TP CQFGLNDSLSV   +Y +S D              G+V+LEDCKFH+CVSL+KF++D
Sbjct: 233 TPTCQFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLDKFNRD 292

Query: 300 RIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAKN 359
           RIIKFVPPDG +ELMKYHVR NINLPFKV+P V  S S T ++YRITLKSLFPSKL+A +
Sbjct: 293 RIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSAND 352

Query: 360 VTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAPRL 419
           V +KIPVP  T+DCK++VSNG C+F PEE  ++W F KYNGLTEN LSAVT++S D  +L
Sbjct: 353 VVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVTVSSNDTTQL 412

Query: 420 NIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKE-SERYKTVKWIRYVSKSGSYEIRY 475
            +QQW +PPISLDFEIMMFSNSGLVVRY  I E  ++Y+TVKWI+Y+S+SGSYE+RY
Sbjct: 413 MLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSGSYEVRY 469

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/487 (57%), Positives = 361/487 (74%), Gaps = 17/487 (3%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           M++A+ VFS +GEL+VSK  ++ +KRS+++IFRIQVINNLDVRSP+LTLGSTTF HIRS+
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
               +LW+V+VTRSN +  A+WEFLYKF+ +LE YGLN+EE LKEEFM CYELLDV+L E
Sbjct: 61  ---SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVL-E 116

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLP------KIPKFLRRTSSFLN 174
           NG P+DT+ ++V  KMS +P   ++EN  ++ +   S         ++PKFL + S   +
Sbjct: 117 NGVPVDTELSSVASKMSRRPVV-SLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234
             SS  +          PWR  GI +KKNEIFL VNE+I+ILVSK+GSILKSYVDG++DL
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 235 VTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXX-----XXXXXXXXXGSVLLEDCKFHQ 289
            THLSGTP+CQFGLNDSLS+         D+                 GSV LEDCKFHQ
Sbjct: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQ 295

Query: 290 CVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKS 349
           CV L +F+ DRII+FVPPDGS ELM+YHVR N+NLPFK++PI +  S+  AVEYR+ LKS
Sbjct: 296 CVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKS 355

Query: 350 LFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV 409
           LFPSKLTAK+V ++IPVPP T+DCKI+ SNG C+F PEE A+LW F KY GLTENTLSA+
Sbjct: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSAL 415

Query: 410 TITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESER-YKTVKWIRYVSKS 468
           T+   +   LN+QQW +PP+SL FEI+MFSNSGLVVR+F + E +  Y TVKW++Y+S+S
Sbjct: 416 TVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRS 475

Query: 469 GSYEIRY 475
           G+YE+RY
Sbjct: 476 GAYEVRY 482

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/478 (57%), Positives = 358/478 (74%), Gaps = 15/478 (3%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           M+SA+ +FS RGEL++SK  ++++ +S+S+IFRIQVINNLDVRSP+LTLGSTTF H++S 
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKS- 59

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
               +LW+V+V+RSN +  A+WEFLYK   +LE +GL++E  LKE+FM CYELLD++L E
Sbjct: 60  --PGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVL-E 116

Query: 121 NGTPMDTDPATVIKKMSVKPSK--ETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESS 178
           +G P+DT+ ++V  KMSVKPS   E I  F  S     + +  + +FLR  SS     SS
Sbjct: 117 DGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSS-----SS 171

Query: 179 NNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTHL 238
           N       +   +PWR  GI +KKNE+FL VNE+ISILVSK+GSILKSYVDGT++  THL
Sbjct: 172 NLHDSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231

Query: 239 SGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDK 298
           SG PVC+FGLNDSLSV +  +GD+               GSV+LEDCKFHQCV L+KF  
Sbjct: 232 SGMPVCRFGLNDSLSV-STPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS 290

Query: 299 DRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAK 358
           +R I F+PPDGS ELMKYHVR N+NLPFK++P+VT   + + ++YR+T+KSLFPSKLTAK
Sbjct: 291 ERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANS-IDYRVTIKSLFPSKLTAK 349

Query: 359 NVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAPR 418
           +V ++IPVPPET+DC I  SNG CKF PEE A++W F+KY GLTEN+LSA  +  KD+  
Sbjct: 350 DVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSA- 408

Query: 419 LNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESER-YKTVKWIRYVSKSGSYEIRY 475
           LNI QW KPP+SL FEI+MFSNSGLVVR+F + E +R YK VKWI+Y+SKSG+YE+RY
Sbjct: 409 LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY 466

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/481 (56%), Positives = 359/481 (74%), Gaps = 20/481 (4%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           M++A+ ++S RGEL++SK  K ++++S+S+IFRIQVINNLDVRSP+LTLGSTTF HI+S 
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
               +LW+V+V+RSN +  A+WEFLY+ + +LE + L +E  LKE FM+CYELLD++L E
Sbjct: 60  --AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVL-E 116

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQN----KNSTLPKIPKFLRRTSSFLNQE 176
           +G P+DT+ ++V  KMSVKP+   ++NF +  +N     N  LP + +FLR   S     
Sbjct: 117 DGLPVDTELSSVASKMSVKPNA-GVDNFNMFAENGHGGTNRILP-VSQFLRGRPS----- 169

Query: 177 SSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVT 236
           + N    A      +PWR  GI +KKNE+FL VNE+ISILVSK+GSILKSYVDGT++  T
Sbjct: 170 AGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATT 229

Query: 237 HLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXX-XXXXGSVLLEDCKFHQCVSLEK 295
           HLSG PVC+FGLND+LSV +  +GD  +Y             GSV+LEDCKFHQCV L+K
Sbjct: 230 HLSGMPVCRFGLNDALSV-STPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDK 288

Query: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355
           F  +R I F+ PDGS ELMKYHVR N+NLPFKV+PIVT   S + ++Y+IT+KSLFPSKL
Sbjct: 289 FQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKL 347

Query: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKD 415
           TAK+V ++IPVPPET+ C I  SNG CKF PEE A++W F+KY GLTEN++SA  +  KD
Sbjct: 348 TAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKD 407

Query: 416 APRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESER-YKTVKWIRYVSKSGSYEIR 474
           +  LNI+QW +PPISL FEI+MFSNSGLVVR+F + E +R YK VKWI+Y+SKSG+YE+R
Sbjct: 408 S-TLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVR 466

Query: 475 Y 475
           Y
Sbjct: 467 Y 467

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/489 (56%), Positives = 349/489 (71%), Gaps = 29/489 (5%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MI+AVLV+S+RGELIVSK FK  LKRS+ DIFR+QVIN+LDVRSPILTLGSTTF ++R+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRT- 59

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
             G+ LW+VSV+R+N N  A WEFLYKF  ML  Y L++EE LKEEFM+ +ELLD M+  
Sbjct: 60  -PGEGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEG 118

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLP-----KIPKFLRRTSSFLNQ 175
            G P +TDP  +I  MSVKP+   ++  A + Q + +T         P+ L R S+    
Sbjct: 119 GGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNPGGI 178

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
               +++G             G   K+NEI + V E ISILVSK+GSILK+YVDG IDL 
Sbjct: 179 SILPHATG------------DGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLT 226

Query: 236 THLSGTPVCQFGLNDSLSVKND-----DYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQC 290
           T L G  VCQFGLNDSLS  N      D   S +             G+VLL DCKFHQC
Sbjct: 227 TKLEGAAVCQFGLNDSLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQC 286

Query: 291 VSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSL 350
           VSLE+FD+DRII+F PP+G++ELMKYHVR N+NLPFKV+ +V   ++    +YR+T+KSL
Sbjct: 287 VSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVI-PTANNETDYRVTIKSL 345

Query: 351 FPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVT 410
           FP KL+AKNVTM+IPVPP TLDCKI+VSNG+CKF PEE AM+W F+KYNGLTEN LSA+T
Sbjct: 346 FPGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSAIT 405

Query: 411 ITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE----RYKTVKWIRYVS 466
           + ++D  +L +QQW +PPISLDFEI+M+SN+GLVVRYFT+ +      ++KTVKWI+YVS
Sbjct: 406 VPTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVS 465

Query: 467 KSGSYEIRY 475
            SGSYE+RY
Sbjct: 466 HSGSYEVRY 474

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/482 (55%), Positives = 354/482 (73%), Gaps = 16/482 (3%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MI+ VL++SSRG+LIV    K++LKR+ISDIF+IQVIN+L+++SPILTLGSTTF HIRS+
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
                LW+V++TRSN N G +WEFLYK D ML  Y LNNEE L E+FMV YE++DVML  
Sbjct: 61  SESK-LWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTS 119

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSNN 180
           N  P++T+ +++  K+S +  K TI N   + +N N+ L  IPKFL R S  ++QE SN 
Sbjct: 120 NAMPINTELSSIASKISYRLPK-TISNSPTNEKNNNNGL-SIPKFLTRNSRSMSQEFSNI 177

Query: 181 SSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTHLSG 240
           +        ++PWRP GI +KKNE+FLYVNEKI+ILVSK+ +ILK+YVDG+IDLV+HLSG
Sbjct: 178 T------QSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSG 231

Query: 241 TPVCQFGLNDSLSVKNDDY---GDSFDYX---XXXXXXXXXXXGSVLLEDCKFHQCVSLE 294
           TP+CQFGLND LS+  ++    GD F +                SV +EDC FHQCVSL+
Sbjct: 232 TPICQFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLD 291

Query: 295 KFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSK 354
           KF+ +R+I FVPPDGS ELM+YHVR ++N+PFKV+P V+ SSS  ++ Y+I LKSLFP+ 
Sbjct: 292 KFNDERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYKIILKSLFPTS 351

Query: 355 LTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSK 414
           L+A +  +KIP+PP T+DCKI+ S+G C F+  +   +W FNKY GLTEN L   T+ S 
Sbjct: 352 LSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILETVPSS 411

Query: 415 DAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKES-ERYKTVKWIRYVSKSGSYEI 473
               L++QQW +PP+S++FEI+MFSNSGLVV+Y  + E  ++Y+ VKWI+YVSKSGSYEI
Sbjct: 412 STDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSGSYEI 471

Query: 474 RY 475
           RY
Sbjct: 472 RY 473

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/486 (50%), Positives = 352/486 (72%), Gaps = 16/486 (3%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MI+AV++F+ RGEL+V K FK+++KR+ISDIFR+QVINN ++RSPILTLGSTTF  IR+ 
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
             G  LWLV+VTRSN + GA+WE+LYK + ++E+YGL +E+ LK+EF+VC+ELLD+ LG 
Sbjct: 61  A-GSKLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGM 119

Query: 121 NGTPMDTDPATVIKKMSVKPS--------KETIENFAISVQNKNSTLPKIPKFLRRTSSF 172
           NG PMDT+ ++VI KM++KP+        +  I   +++    NST   +PKFL R S  
Sbjct: 120 NGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSRNS-- 177

Query: 173 LNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTI 232
            N+  +      F+    +PWR + I +KKNE+ + V EKI++LV K+ +IL++YVDGTI
Sbjct: 178 -NRSVTQEFESQFS-PSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 233 DLVTHLSGTPVCQFGLNDSLSVKNDD--YGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQC 290
           D+  HLSG P+CQ G+ND  +++  +  +  + D               V+LE  KFHQC
Sbjct: 236 DITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFHQC 295

Query: 291 VSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSL 350
           V+L+K++KD +I F+PPDG  ELMKYHV +N+NLPF+++P VT +S GTA+ Y I LKSL
Sbjct: 296 VALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLKSL 355

Query: 351 FPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVT 410
           FP KL+A+NV ++IPVPP TLDCKI+ S+G CKF PEE  M+W+F+++NG TEN L+A T
Sbjct: 356 FPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNAQT 415

Query: 411 ITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG 469
           + ++     +I+QW +PP+SLDF+++MFSN+GL+VRY  ++E    Y T+KWI+Y+S +G
Sbjct: 416 VPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYISAAG 475

Query: 470 SYEIRY 475
           SYE+RY
Sbjct: 476 SYEVRY 481

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  495 bits (1274), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 257/493 (52%), Positives = 336/493 (68%), Gaps = 47/493 (9%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MISA+ ++S RG+LI+SK  K+N+K  +S+IFRIQVINNLDVRSPILTLGSTTF HIRSN
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
                LWLV+V+R N +   +WEFLY F+ +LE+Y +N+E+ L+ +FM+CYE+LD++L +
Sbjct: 61  ---GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVL-D 116

Query: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSNN 180
           NG P DT+   ++  +S KP  E                      L  +   LN  S   
Sbjct: 117 NGIPRDTELTHIMPYISKKPLSEN---------------------LLGSDDILNTPSWLV 155

Query: 181 SSGAFNMAGE---------LPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGT 231
            +GA  M+ E           WR +GI +KKNE++L V E ISILV+K+G+ILKSYVDG+
Sbjct: 156 KAGARGMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGS 215

Query: 232 IDLVTHLSGTPVCQFGLNDSLS-------VKNDDYGDSFDYXXXXXXXXXXXXGSVLLED 284
           +  V HLSG PVCQFG ND LS         ND + +                GSV+LED
Sbjct: 216 VQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEE---ENGTKAIKNAITGSVILED 272

Query: 285 CKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYR 344
           CKFHQCV L+KFD++R+I+FVPPDG  ELMKYHVR N+NLPFKV+P+VT +  G +VEYR
Sbjct: 273 CKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSVEYR 331

Query: 345 ITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTEN 404
           ITLKSLFPSKL AK+V + IP PP+T++ KI+VS+G  KF PEE A++W  +KY+GLTEN
Sbjct: 332 ITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTEN 391

Query: 405 TLSAVTITSKDA-PRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWI 462
             SAV +   +    LN++QW +PPIS+ FEI MFSNSGLVVRY  + E +  Y TVKW+
Sbjct: 392 VFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWV 451

Query: 463 RYVSKSGSYEIRY 475
           +Y+SKSG+YE+RY
Sbjct: 452 KYISKSGAYEVRY 464

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  456 bits (1173), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 237/494 (47%), Positives = 337/494 (68%), Gaps = 38/494 (7%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQH-IRS 59
           M+SA+ +++++G+L++SK  K+++KRS++D+FR QVIN+  VRSPILTLGSTTFQH IR 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 60  NVHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLG 119
           +     +WLV+V+RSN++   +WE+L+K   ++E +G+N+E+ LK+EFM+ YE+L++ L 
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTL- 119

Query: 120 ENGTPMDTDPATVIKKMSVKPSKETIENFAISVQN------KNSTLPKIPKFLRRTSSFL 173
           ENG P  TD A +I ++S KP    IEN  IS           S + K PK  +R+SS  
Sbjct: 120 ENGIPQTTDLAQIIPRVSRKP----IENNTISKSPDLDDFLSGSNILKAPKLSKRSSS-- 173

Query: 174 NQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTID 233
                   S A +   E PWRP G+ +KKNE++L +NEKI+ILV K+GSI+KS+VDG++D
Sbjct: 174 --------SIALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVD 225

Query: 234 LVTHLSGTPVCQFGLNDSLSVKNDDYGD--------SFDYXXXXXXXXXXXXGSVLLEDC 285
            V+HLSG P+CQ GLND+ S+  ++  +         +D             GSV+LEDC
Sbjct: 226 CVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYD-IKNKKAIPNAAAGSVILEDC 284

Query: 286 KFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRI 345
           KFHQCV L K++ + +I+FVPPDG  +LM+Y V  NIN+PF V P V    + T + Y++
Sbjct: 285 KFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNST-LNYKV 343

Query: 346 TLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENT 405
           TL+SLFPS ++AK+VT+KIPVPP T+ C  +VS G CK+   EK M+W +NKY G TENT
Sbjct: 344 TLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENT 403

Query: 406 LS---AVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKW 461
           LS   A+  TS D    ++ +W +PPIS+ FEI+MFSNSGLVVR+   +E +  Y+ VKW
Sbjct: 404 LSGKVAIPATSHDLS--DLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKW 461

Query: 462 IRYVSKSGSYEIRY 475
           I+Y+S SG+YEIRY
Sbjct: 462 IKYISHSGAYEIRY 475

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  424 bits (1091), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 227/481 (47%), Positives = 309/481 (64%), Gaps = 59/481 (12%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MISA+L+++ RGELIVSK ++NN+KRSIS+IFRIQVINN +VRSPILTLGSTTF HIRS 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  VHG---DDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVM 117
            +    D+LWLV V R+N N  A+WEFL K + +L+ YG+ +E  LK+EFM  +E+LD M
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 118 LGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQES 177
           L   G   +TD  +++ KMSVKP   T           N T      FL+R ++ L    
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPISRT-----------NETTSTQTGFLKRRNTILTTPG 169

Query: 178 SNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTH 237
           +N S    N         +  +HKKNEIF +VNE +++LVSK+GSILK+YVDG I++ +H
Sbjct: 170 ANFSLIPTN---------RHDAHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSH 220

Query: 238 LSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFD 297
           L+G P CQF L D                               + D KF QC+  EK  
Sbjct: 221 LNGNPTCQFELVDD---------------------------QTKITDFKFDQCI--EKV- 250

Query: 298 KDRIIKFVPPDGSMELMKYHVRSN-INLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLT 356
           + R ++    DG +E++ YHVR + IN+PFK++PIV  S+    V+YRI+LKSLFP  L+
Sbjct: 251 QSRTVRVAATDGELEIVNYHVRDDKINIPFKITPIV--STVKDTVDYRISLKSLFPKNLS 308

Query: 357 AKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDA 416
           A +V + IPVPP T+DCKI+VSNG CKF  E+ A++WTFNK+NG TENTLSA+TI +   
Sbjct: 309 ATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITI-ADGR 367

Query: 417 PRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTI--KESERYKTVKWIRYVSKSGSYEIR 474
             +N++ W +P I L FEI M+S SGL++R   I  K+  RYK  +WI+Y+S++GSYE+R
Sbjct: 368 QIMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAGSYEMR 427

Query: 475 Y 475
           +
Sbjct: 428 F 428

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  419 bits (1076), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 212/447 (47%), Positives = 297/447 (66%), Gaps = 29/447 (6%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60
           MI A  VF+ RG LIVSK      K S+S++FR+QVIN L++RSP+LTLGSTTFQHIR++
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120
                LW+V V R N +  A+WEFLY  + +L+ Y +N EE L ++FM+CYELLDV+L +
Sbjct: 61  ---GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVL-D 116

Query: 121 NGTPMDTDPATVIKKMSVKPS---KETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQES 177
           +G P DT+ + ++  +S KP+     + ++F  S +            LRRT +   +  
Sbjct: 117 SGLPQDTELSHIVPLLSRKPATGESASGDDFLNSAR------------LRRTGT---KNV 161

Query: 178 SNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTH 237
           S  +   F+     PWR +GI +KKNE++L V EK+S+LV+++G+ILK+YVDGT+    H
Sbjct: 162 SVETLDHFSR-DVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAH 220

Query: 238 LSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFD 297
           LSG P+C FG NDS S++       +               SV+LEDCKFHQCV L KFD
Sbjct: 221 LSGMPLCHFGFNDSQSLRQRSPRRQY----APRVFGTDERESVVLEDCKFHQCVQLNKFD 276

Query: 298 KDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTA 357
           ++R+I+FVPPDG  ELMKYH+R ++  PFKV+P+V+  +   ++EYRITL+SLFP+KL+A
Sbjct: 277 QERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNE-RSIEYRITLQSLFPTKLSA 335

Query: 358 KNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAP 417
           K+V + IP PP T+  K++VS G CKF PEE A++W  +K++GLTENTLSAVTI  +   
Sbjct: 336 KDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGH 395

Query: 418 RLNI-QQWQKPPISLDFEIMMFSNSGL 443
              +  QW +PPIS+  EIMMFS + L
Sbjct: 396 YAQVLDQWPRPPISMKLEIMMFSTAAL 422

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  209 bits (533), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 148/485 (30%), Positives = 249/485 (51%), Gaps = 51/485 (10%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLD---VRSPILTLGSTTFQHI 57
           M S +    S+G+ I+S+ +K+++  +  D F + ++       V  P L      +  +
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115
           + N    DL+++++TRS + N   ++ FLYK   +L  Y  +  EE +++ F++ YELLD
Sbjct: 61  QHN----DLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            M+ + G P  T+   ++K+   + S + +++   + ++KN   P I             
Sbjct: 117 EMM-DYGIPQITE-TKMLKQYITQKSFKLMKS---AKKSKNVIRPPIA------------ 159

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
                      +   + WRP+GI +KKNE FL V E I++L++++G +L+S + G + + 
Sbjct: 160 -----------LTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVK 208

Query: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEK 295
           +HLSG P  + GLND     N   G   D              ++ LED KFHQCV L K
Sbjct: 209 SHLSGMPDLKLGLNDKGIFSNHVSGGVED-EADDLSATGKKKANIELEDLKFHQCVRLSK 267

Query: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355
           F+ ++II F+PPDG  ELM Y + + I  P     I     S + +E     K+    K 
Sbjct: 268 FENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKAQIKKKS 326

Query: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411
           TA NV + IPVP +    K   S+GS K+APE+ A+LW    + G  E +++A     ++
Sbjct: 327 TANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSV 386

Query: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG- 469
           +  + P +      K P+ + F+I  F+ SG+ VRY  I E + +Y++  W+RY+++SG 
Sbjct: 387 SDFEEPVM------KRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGD 440

Query: 470 SYEIR 474
            Y IR
Sbjct: 441 DYTIR 445

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  209 bits (531), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 138/485 (28%), Positives = 251/485 (51%), Gaps = 54/485 (11%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57
           M S V    S+G+ ++S+ +++++ +S  + F+   ++      V  P        + ++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELYGLN-NEEFLKEEFMVCYELLD 115
           + N    D++++++TRS ++N   ++ F+YK  +++E Y     EE +++ +++ YELLD
Sbjct: 61  QYN----DVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            M+ + G P  T+   + + ++ K  K                       L R++    +
Sbjct: 117 EMM-DKGVPQVTETKMLKQYITQKSFK-----------------------LTRSA----K 148

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
           +  N +     +   + WRP+GI +KKNE FL V E I++L++++G +L+S + GT+ + 
Sbjct: 149 KQKNVARPPTELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVR 208

Query: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEK 295
           + LSG P  + GLND      +D  DS +              ++ LED KFHQCV L K
Sbjct: 209 SRLSGMPDLKLGLNDKGIFTTNDQEDSPE----PVVSSKKKNSNIELEDLKFHQCVRLSK 264

Query: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355
           F+ ++II F+PPDG  +LM Y + + I  P     +     SG+ +E     K+    K 
Sbjct: 265 FENEKIITFIPPDGEFDLMTYRLSTPIK-PLIWCDVKVQVHSGSRIEIHCRAKAQIKKKS 323

Query: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411
            A NV + IP+P +        S G+ K+ PE+ A+LW F+ + G  E +++A     ++
Sbjct: 324 VANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSV 383

Query: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG- 469
           +  + P+L      K P+ + F+I  F+ SG+ VRY  I+E + +Y +  W+RY+++SG 
Sbjct: 384 SDAEPPKL------KRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGD 437

Query: 470 SYEIR 474
            Y IR
Sbjct: 438 DYTIR 442

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  207 bits (528), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 147/485 (30%), Positives = 250/485 (51%), Gaps = 57/485 (11%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57
           M S +    + G++I+S+ +++++  S  + F    ++      V  P LT     +  I
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115
           + N    D+++++++RS +IN   V+ FLYK   +L  Y     EE +++ F++ YELLD
Sbjct: 61  QHN----DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            ML + G P  T+   ++K+   + S + I++     ++KN   P  P  L ++ S    
Sbjct: 117 EML-DYGIPQITE-TKMLKQYITQKSYKLIKSVK---KSKNVVRP--PAQLTKSVS---- 165

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
                            WRP+GI++KKNE FL V E I++L++  G +L+S + G + + 
Sbjct: 166 -----------------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVR 208

Query: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEK 295
           + LSG P  + GLND     +++ G++ +              ++ LED +FHQCV L K
Sbjct: 209 SRLSGMPDLKLGLNDKGIFTSEEGGNNAE-------GGSGKKSNIELEDLQFHQCVRLSK 261

Query: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355
           F+ ++II F+PPDG  +LM Y + + I  P           S + +E     K+    K 
Sbjct: 262 FENEKIISFIPPDGDFDLMNYRLSTPIK-PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKS 320

Query: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411
           TA NV + IPVP +    K   S+GS K+ PE+ A+LW    +NG  E + +A     ++
Sbjct: 321 TANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSM 380

Query: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG- 469
           T  + P+       K PI + F+I  F+ SG+ VRY  + E + +Y++  W+RY+++SG 
Sbjct: 381 TDVEVPK------AKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGD 434

Query: 470 SYEIR 474
            Y IR
Sbjct: 435 DYTIR 439

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  207 bits (528), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 149/485 (30%), Positives = 247/485 (50%), Gaps = 57/485 (11%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57
           M S +    ++G++I+S+ +++++  S  + F    ++      +  P LT     +  I
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115
           + N    D+++++++RS +IN   V+ FLYK   +L  Y     EE +++ F++ YELLD
Sbjct: 61  QHN----DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            ML + G P  T+   ++K+   + S + I++   + ++KN   P  P  L ++ S    
Sbjct: 117 EML-DYGIPQITE-TKMLKQYITQKSYKLIKS---AKKSKNVIRP--PSQLTKSVS---- 165

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
                            WRP+GI++KKNE FL V E I++L++  G +L+S + G +++ 
Sbjct: 166 -----------------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVNVR 208

Query: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEK 295
           + LSG P  + GLND           +                ++ LED KFHQCV L K
Sbjct: 209 SRLSGMPDLKLGLNDKGIF-------TSVESASSSEATEGKKSNIELEDLKFHQCVRLSK 261

Query: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355
           F+ ++II F+PPDG  ELM Y + + I  P           S + +E     K+    K 
Sbjct: 262 FENEKIITFIPPDGDFELMNYRLSTPIK-PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKS 320

Query: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411
           TA NV + IPVP +    K   S+GS K+ PE+ A+LW    +NG  E + +A     ++
Sbjct: 321 TANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPSM 380

Query: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG- 469
           T  + PR       K PI + F+I  F+ SG+ VRY  I E + +Y++  W+RY+++SG 
Sbjct: 381 TDAEVPR------AKRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGD 434

Query: 470 SYEIR 474
            Y IR
Sbjct: 435 DYTIR 439

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  197 bits (501), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 145/483 (30%), Positives = 239/483 (49%), Gaps = 50/483 (10%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57
           M S +    S+G+L++S+ +K+++  +  + F    I+      V  P  +     +  I
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115
           + N    DL+++++T+S +IN   V+ +L+K   +LE Y  +  EE +K+ F++ YELLD
Sbjct: 61  QHN----DLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            M+ ++G P  TD   + + ++ K  K       I    K   + + P  L  + S    
Sbjct: 117 EMM-DHGIPQITDTKMLRQYITQKSFK------LIRSAKKKKNVVRPPATLTNSVS---- 165

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
                            WRP+GI +KKNE FL V E I++L++++G +L+S + G + + 
Sbjct: 166 -----------------WRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVK 208

Query: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEK 295
           + LSG P  + GLND    K        D              ++ LED KFHQCV L K
Sbjct: 209 SRLSGMPDLKLGLND----KGIFAQGDDDDDEEGASGGTKKKSNIELEDLKFHQCVRLTK 264

Query: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355
           F+ ++II F+PPDG  ELM Y + + I  P     +     S + +E     K+    K 
Sbjct: 265 FENEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKS 323

Query: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKD 415
           TA NV + IPVP +    K   S+G+ K+ P + A+LW    + G  + +++A       
Sbjct: 324 TANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA----EMG 379

Query: 416 APRL--NIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG-SY 471
            P +  N     K P+ + F+I  F+ SG+ VRY  I E + +Y +  W+RY+++SG  Y
Sbjct: 380 LPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDY 439

Query: 472 EIR 474
            IR
Sbjct: 440 TIR 442

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  197 bits (500), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 250/508 (49%), Gaps = 68/508 (13%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56
           M SAV      G+ ++S+ +++++  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114
           I+ N    DL+LV++  S   N  A++ FL+K   +L  Y     EE +++ F++ YELL
Sbjct: 60  IQHN----DLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115

Query: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174
           D ++ + G P  T+   ++K+   + S + +++   + + +N+T P +            
Sbjct: 116 DEVM-DYGIPQITE-TKMLKQYITQKSFKLVKS---AKKKRNATRPPVA----------- 159

Query: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234
                       +   + WRP+GI+HKKNE FL + E I++L++++G +L+S + G + +
Sbjct: 160 ------------LTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207

Query: 235 VTHLSGTPVCQFGLND----------------SLSVKNDDYGDSFDYXXXXXXXXXXXXG 278
            + LSG P  + G+ND                ++S    D     D              
Sbjct: 208 NSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSAVSAATSDNNTDTDKKPSITSSSTTSKR 267

Query: 279 SV--LLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSS 336
            V   LED KFHQCV L KF+ ++II F+PPDG  +LM Y + + I  P     +     
Sbjct: 268 KVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVH 326

Query: 337 SGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFN 396
           S + +E     K+    K TA NV + IPVP +        S+GS K+ PE+ A+LW   
Sbjct: 327 SNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLR 386

Query: 397 KYNGLTENTLSA-----VTITSKDAPRL---NIQQWQKPPISLDFEIMMFSNSGLVVRYF 448
            + G  E ++SA        TSKD  R    +  +  K P+ + F+I  F+ SG+ VRY 
Sbjct: 387 SFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNAKLLKGPVQIKFQIPYFTTSGIQVRYL 446

Query: 449 TIKESE-RYKTVKWIRYVSKSG-SYEIR 474
            I E + +YK+  W+RY+++SG  Y IR
Sbjct: 447 KINEPKLQYKSYPWVRYITQSGDDYTIR 474

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  196 bits (498), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 146/498 (29%), Positives = 250/498 (50%), Gaps = 63/498 (12%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLD---VRSPILTLGSTTFQHI 57
           M SAV     +G+ ++S+ +K+++  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHML-ELYGLNNEEFLKEEFMVCYELLD 115
           + N    DL++V++  S  +N   V+ FL+K   +L E      EE +++ F++ YEL+D
Sbjct: 61  QHN----DLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            M+ + G P  T+P  + K ++ K       +F +   +K           +R ++    
Sbjct: 117 EMM-DYGIPQITEPRMLKKYITQK-------SFKLEKAHKK----------KRNAARPPS 158

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
           E +N+ S          WR +GI +KKNE FL + E I++L++++G +L+S + G + + 
Sbjct: 159 ELNNSVS----------WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIK 208

Query: 236 THLSGTPVCQFGLND----SLSVKNDDYG----DSFDYXXXXXXXXXXXXG-----SVLL 282
           + LSG P  + G+ND    +  ++ ++ G    D  ++            G     ++ L
Sbjct: 209 SRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIEL 268

Query: 283 EDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVE 342
           ED KFHQCV L KF+ ++II F+PPDG  +LM Y + ++I  P     +     S + +E
Sbjct: 269 EDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVHSKSRIE 327

Query: 343 YRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLT 402
            R   K+    K  A NV + IPVP +        S+GS K+ PE+ A+LW    + G  
Sbjct: 328 IRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGK 387

Query: 403 ENTLSA----VTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYK 457
           E  + A     ++ S + P++      K P+ + FEI  F+ SG+ VRY  I E + +YK
Sbjct: 388 EYAMFAEMGLPSMDSYEEPKV------KRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYK 441

Query: 458 TVKWIRYVSKSG-SYEIR 474
           +  W+RY+++SG  Y IR
Sbjct: 442 SYPWVRYITQSGDDYTIR 459

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  196 bits (497), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 149/511 (29%), Positives = 253/511 (49%), Gaps = 72/511 (14%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56
           M SAV      G+ ++S+ +++++  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114
           I+ N    DL+LV++  S + N  A++ FL+K   +L  Y     EE +++ F++ YELL
Sbjct: 60  IQHN----DLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115

Query: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174
           D ++ + G P  T+   ++K+   + S + +++   + + +N+T P +            
Sbjct: 116 DEVM-DYGIPQITE-TKMLKQYITQKSFKLVKS---AKKKRNATRPPVA----------- 159

Query: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234
                       +   + WRP+GISHKKNE FL + E I++L++++G +L+S + G + +
Sbjct: 160 ------------LTNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207

Query: 235 VTHLSGTPVCQFGLND----------------SLSVKNDDYGDSFDYXXXXXXXXXXXXG 278
            + LSG P  + G+ND                + S    D     D              
Sbjct: 208 NSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTAS 267

Query: 279 ----SVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTY 334
               ++ LED KFHQCV L KF+ ++II F+PPDG  +LM Y + + I  P     +   
Sbjct: 268 KRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQ 326

Query: 335 SSSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWT 394
             S + +E     K+    K TA NV + IPVP +        S+GS K+ PE+ A+LW 
Sbjct: 327 VHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWK 386

Query: 395 FNKYNGLTENTLSA----VTIT-----SKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVV 445
              + G  E ++SA     +I+     SK  P+ N  +  K P+ + F+I  F+ SG+ V
Sbjct: 387 LRSFPGGKEYSMSAELGLPSISNGNDGSKTIPK-NNAEILKGPVQIKFQIPYFTTSGIQV 445

Query: 446 RYFTIKESE-RYKTVKWIRYVSKSG-SYEIR 474
           RY  I E + +YK+  W+RY+++SG  Y IR
Sbjct: 446 RYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  194 bits (494), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 146/485 (30%), Positives = 242/485 (49%), Gaps = 52/485 (10%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVI---NNLDVRSPILTLGSTTFQHI 57
           M S +    ++G+L++S+ +K+++  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115
           + N    DL+++++TRS   N   V+ FL+    +L+ Y  +  EE +K+ F++ YELLD
Sbjct: 61  QHN----DLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            ++ ++G P  TD   + + ++ K  K       I    K   + + P  L    S    
Sbjct: 117 EVM-DSGIPQITDTKMLRQYITQKSFK------LIRSAKKKKNVVRPPSSLTTAVS---- 165

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
                            WRP+GI +KKNE FL V E I+++++++G +L+S + G + + 
Sbjct: 166 -----------------WRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVR 208

Query: 236 THLSGTPVCQFGLNDS--LSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSL 293
           + LSG P  + GLND    +  N++  D                 ++ LED KFHQCV L
Sbjct: 209 SRLSGMPDLKLGLNDKGIFTQSNEEEEDE----PSSQPSITRKKSNIELEDLKFHQCVRL 264

Query: 294 EKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPS 353
            KF+ ++II F+PPDG  ELM Y + + I  P           S + VE     K+   +
Sbjct: 265 SKFENEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDAKIQVHSRSRVEVHCRAKAQIKA 323

Query: 354 KLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITS 413
           K TA NV + IPVP +    K   S+GS K+ PE+ A+LW    + G  + +++A     
Sbjct: 324 KSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAA----E 379

Query: 414 KDAPRLN-IQQWQ-KPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSGS 470
              P +N I  +  K P+ + F+I  F+ SG+ VRY  I E + +Y +  W+RY+++SG 
Sbjct: 380 MGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGE 439

Query: 471 -YEIR 474
            Y IR
Sbjct: 440 DYIIR 444

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  195 bits (495), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 253/508 (49%), Gaps = 69/508 (13%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56
           M SAV      G+ ++S+ +++++  S  D F I ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114
           I+ N    DL++V++  S + N  A++ FL+K   +L  Y     EE +++ F++ YELL
Sbjct: 60  IQHN----DLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115

Query: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174
           D ++ + G P  T+   ++K+   + S + +++   + + +N+T P +            
Sbjct: 116 DEVM-DYGIPQITE-TKMLKQYITQKSFKLVKS---AKKKRNATRPPVA----------- 159

Query: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234
                       +   + WRP+GI+HKKNE FL + E I++L++++G +L+S + G + +
Sbjct: 160 ------------LTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207

Query: 235 VTHLSGTPVCQFGLND---------------SLSVKNDDYGDSFDYXXXXXXXXXXXXGS 279
            + LSG P  + G+ND               S S    D     D               
Sbjct: 208 NSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKK 267

Query: 280 V--LLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSS 337
           V   LED KFHQCV L KF+ ++II F+PPDG  +LM Y + + I  P     +     S
Sbjct: 268 VNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHS 326

Query: 338 GTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNK 397
            + +E     K+    K TA NV + IPVP +        S+GS K+ PE+ A+LW    
Sbjct: 327 NSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRS 386

Query: 398 YNGLTENTLSA----VTIT-----SKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYF 448
           + G  E ++SA     +I+     ++  P+ N  +  K P+ + F+I  F+ SG+ VRY 
Sbjct: 387 FPGGKEYSMSAELGLPSISNNEDGNRTMPKSN-AEILKGPVQIKFQIPYFTTSGIQVRYL 445

Query: 449 TIKESE-RYKTVKWIRYVSKSG-SYEIR 474
            I E + +YK+  W+RY+++SG  Y IR
Sbjct: 446 KINEPKLQYKSYPWVRYITQSGDDYTIR 473

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  194 bits (493), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 146/490 (29%), Positives = 244/490 (49%), Gaps = 52/490 (10%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVIN---NLDVRSPILTLGSTTFQHI 57
           M SA+    ++G  ++S+ +++++  S  D F I + N     ++  P +      F  I
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  RSNVHGDDLWLVSVTRSNINCGA--VWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114
           + N    DL+LV++  S I+C A  ++ FL+K   +L  Y     EE +++ F++ YELL
Sbjct: 61  QHN----DLYLVAIATS-ISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELL 115

Query: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174
           D M+ + G P  T+P  + + ++ K  K            +  T                
Sbjct: 116 DEMM-DYGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPT---------------- 158

Query: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234
                      ++   + WRP+GI HKKNE FL + E I++L++++G +L+S + G + +
Sbjct: 159 -----------SLTNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKV 207

Query: 235 VTHLSGTPVCQFGLND----SLSVKNDDYGDSF---DYXXXXXXXXXXXXGSVLLEDCKF 287
            + LSG P  + G+ND    S  ++ D+ G      D              ++ LED KF
Sbjct: 208 KSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKF 267

Query: 288 HQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITL 347
           HQCV L KF+ ++ I F+PPDG  ELM Y + + I  P     +   + S + +E     
Sbjct: 268 HQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIEIFCRA 326

Query: 348 KSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLS 407
           K+    K TA NV + IPVP +        S+GS K+ PE+ A+LW    + G  E +++
Sbjct: 327 KAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMA 386

Query: 408 A-VTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYV 465
           A + + S +A   +  +  K P+ + F+I  F+ SG+ VRY  I+E   +YK+  W+RY+
Sbjct: 387 AEMGLPSTNAGEES--EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYI 444

Query: 466 SKSG-SYEIR 474
           +KSG  Y IR
Sbjct: 445 TKSGDDYTIR 454

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  192 bits (487), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 141/479 (29%), Positives = 236/479 (49%), Gaps = 51/479 (10%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57
           M+SAV     +G  I+S+ +++++  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELYGLN-NEEFLKEEFMVCYELLD 115
           + N    DL++V++  S   N   V+ FL+K   +LE Y  +  EE +++ F++ YELLD
Sbjct: 61  QHN----DLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            M+ + G P  T+   + + ++ K  K       +    K+   P+ P            
Sbjct: 117 EMM-DYGIPQITETKMLKQYITQKSFK------LMKAVKKSKAAPRPP-----------T 158

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
           E +N+ S          WR   I HKKNE FL + E I++L++++G +L+S + G I + 
Sbjct: 159 EVTNSVS----------WRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVK 208

Query: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEK 295
           + LSG P  + G+ND         GDS                ++ LED KFHQCV L K
Sbjct: 209 SKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKT--NIELEDLKFHQCVRLSK 266

Query: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355
           F+ ++II F+PPDG+ ELM Y +   +  P     +     S + +E     ++    + 
Sbjct: 267 FENEKIITFIPPDGAFELMNYRLSMPVK-PLIWCDVNVQVHSQSRIEIHCRARAQIKKRS 325

Query: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411
            A +V + IPVP +        ++GS K+ P++ A+LW    + G  E ++SA     +I
Sbjct: 326 IANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSI 385

Query: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG 469
            + D P++      K P+ + F+I  F+ SG+ VRY  I E +  YK+  W+RY+++SG
Sbjct: 386 NALDKPKV------KRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  189 bits (481), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 145/489 (29%), Positives = 245/489 (50%), Gaps = 62/489 (12%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56
           M SA+     +G  ++S+ +++++  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59

Query: 57  IRSNVHGDDLWLVSVT---RSNINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYE 112
           I+ +    D++LV++T   R+NI    V+ FLYK   +L  Y     EE +++ +++ YE
Sbjct: 60  IQHS----DIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYE 113

Query: 113 LLDVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSF 172
           LLD ++ + G P  T+   + + ++ K  K       +    K     + P  L  + S 
Sbjct: 114 LLDELM-DYGIPQITETKMLKQYITQKSFK------LVKAAKKKQNAARPPSALTDSVS- 165

Query: 173 LNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTI 232
                               WR +GI +KKNE FL + E I++L++++G IL+S + G +
Sbjct: 166 --------------------WRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVV 205

Query: 233 DLVTHLSGTPVCQFGLND----SLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFH 288
            + + LSG P  + G+ND    S  +  DD  ++                 + LED KFH
Sbjct: 206 KIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNN---------ATSKKQNKIELEDLKFH 256

Query: 289 QCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLK 348
           QCV L KF+ ++II F+PPDG  ELM Y + ++I  P     +     S + +E     K
Sbjct: 257 QCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIHCRAK 315

Query: 349 SLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSA 408
           +    K TA NV + IPVP +        S+GS K+ PE+ A+LW    + G  E +++A
Sbjct: 316 AQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAA 375

Query: 409 -VTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVS 466
            + + S  +    +Q   K P+ + F+I  F+ SG+ VRY  I E + +YK+  W+RY++
Sbjct: 376 ELCLPSTSSKSEEVQ--NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 433

Query: 467 KSG-SYEIR 474
           +SG  Y IR
Sbjct: 434 QSGDDYTIR 442

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  188 bits (478), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 141/502 (28%), Positives = 250/502 (49%), Gaps = 66/502 (13%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56
           M SAV     +G+ ++S+ +++++  S  D F   ++++ +  S    P ++     +  
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFS-SLLSDKEEESNLLPPCISHNGIQYMF 59

Query: 57  IRSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114
           I+ N    DL+L ++  S   N   ++ FL+K   +L+ Y     EE +++ F++ YELL
Sbjct: 60  IQHN----DLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELL 115

Query: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174
           D M+ + G P  T+   + K ++ K       +F +   +K           +R ++   
Sbjct: 116 DEMM-DYGLPQITETKMLKKYITTK-------SFKLEKAHKK----------KRNAARPP 157

Query: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234
            E +N+ S          WRP+GI +KKNE FL + E I++L++++G +L+S + G + +
Sbjct: 158 TELTNSVS----------WRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVRV 207

Query: 235 VTHLSGTPVCQFGLND---------------SLSVKNDDYGDSFDYXXXXXXXXXXXXGS 279
            + LSG P  + G+ND               + +  ++D  D+ +              +
Sbjct: 208 KSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAKNGDDEDADDTNNESSIVSEGSNKRKTN 267

Query: 280 VLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNIN-LPFKVSPIVTYSSSG 338
           + LED KFHQCV L KF+ ++II F+PPDG  +LM Y + ++I  L +    I TY    
Sbjct: 268 IELEDLKFHQCVRLSKFENEKIISFIPPDGEFDLMNYRLSTSIKPLIWCDVSIQTYR--- 324

Query: 339 TAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKY 398
             +E     K+    K  A NV + IPVP +        S+G  K+ PE+  +LW  + +
Sbjct: 325 --IEIHCKAKAQIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKISSF 382

Query: 399 NGLTENTLSAV----TITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE 454
            G  E +++A     +I+ +D     +    K P+ + F+I  F+ SG+ VRY  + E +
Sbjct: 383 PGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQVRYLKVNEPK 442

Query: 455 -RYKTVKWIRYVSKSG-SYEIR 474
            +YKT  W+RY+++SG  Y IR
Sbjct: 443 LQYKTYPWVRYITQSGDDYTIR 464

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  187 bits (476), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 143/505 (28%), Positives = 245/505 (48%), Gaps = 70/505 (13%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57
           M+S++    S+G+ ++S+ +++++  +  D F    +++     V  P LT     +  I
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELYGLN-NEEFLKEEFMVCYELLD 115
           + N    DL++V++T S + N   V+ FL+K   ++  Y  +  EE +++ F++ YELLD
Sbjct: 61  QHN----DLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            M+ + G P  T+   + + ++ K       +F +    K       P           Q
Sbjct: 117 EMM-DYGIPQITETKMLKQYITQK-------SFKLVKAAKKKRNAARPP----------Q 158

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
             +N+ S          WRP+GI +KKNE FL + E I++L++++G +L+S + G + + 
Sbjct: 159 ALTNSVS----------WRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVR 208

Query: 236 THLSGTPVCQFGLNDS--------------------LSVKNDDYGDSFDYXXXXXXXXXX 275
           + LSG P  + G+ND                      +  N     +             
Sbjct: 209 SRLSGMPDLKLGINDKGIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQDEGSSR 268

Query: 276 XXGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYS 335
              +V LED KFHQCV L KF+ ++II F+PPDG+ ELM Y + + I  P     +  + 
Sbjct: 269 KTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-PLIWCDVNIHV 327

Query: 336 SSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTF 395
            S + VE     K+    K  A NV + IPVP +        S+GS K+ PE+ A+LW  
Sbjct: 328 HSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKI 387

Query: 396 NKYNGLTENTLSAV----TITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIK 451
             + G  E +++A     +I   + P+L      K P+ + F+I  F+ SG+ VRY  + 
Sbjct: 388 RSFAGGKEYSMAAQLGLPSIDDNEKPKL------KRPVQIKFQIPYFTTSGIQVRYLKVN 441

Query: 452 ESE-RYKTVKWIRYVSKSG-SYEIR 474
           E + +YK+  W+RY+++SG  Y IR
Sbjct: 442 EPKLQYKSYPWVRYITQSGDDYTIR 466

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  187 bits (476), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 145/509 (28%), Positives = 251/509 (49%), Gaps = 70/509 (13%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56
           M SAV      G+ ++S+ +++++  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114
           I+ N    DL+LV++  S   N  A++ FL+K   +L  Y     EE +++ F++ YELL
Sbjct: 60  IQHN----DLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115

Query: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174
           D ++ + G P   +   ++K+   + S + +++   + + +N+T P +            
Sbjct: 116 DEVM-DYGIPQICE-TKMLKQYITQKSFKLVKS---AKKKRNATRPPVA----------- 159

Query: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234
                       +   + WRP+GI HKKNE FL + E I++L++++G +L+S + G + +
Sbjct: 160 ------------LTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207

Query: 235 VTHLSGTPVCQFGLND-----------------SLSVKNDDYGDSFDYXXXXXXXXXXXX 277
            + LSG P  + G+ND                 + +  +D+  D+               
Sbjct: 208 NSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNITDTDKKPSITSSSTTSKR 267

Query: 278 G-SVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSS 336
             ++ LED KFHQCV L KF+ ++II F+PPDG  +LM Y + + I  P     +     
Sbjct: 268 KVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVH 326

Query: 337 SGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFN 396
           S + +E     K+    K TA NV + IPVP +        S+GS K+ PE+ A+LW   
Sbjct: 327 SNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLR 386

Query: 397 KYNGLTENTLSA---VTITSKD------APRLNIQQWQKPPISLDFEIMMFSNSGLVVRY 447
            + G  E ++SA   +   S D       P+ N  +  K P+ + F+I  F+ SG+ VRY
Sbjct: 387 SFPGGKEYSMSAELGLPSISNDIEGHRAIPKSN-AEILKGPVQIKFQIPYFTTSGIQVRY 445

Query: 448 FTIKESE-RYKTVKWIRYVSKSG-SYEIR 474
             I E + +YK+  W+RY+++SG  Y IR
Sbjct: 446 LKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  187 bits (474), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 137/488 (28%), Positives = 244/488 (50%), Gaps = 51/488 (10%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57
           M+S +    + G+ I+++ +++++  +  D F    +Q+     V  P +      +  I
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115
           + +    D+++V++T S   N   ++ FL++   +LE Y  +  EE +++ F++ YELLD
Sbjct: 61  KHS----DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            M+ + G P  T+   ++KK   + S + I+      +   +  P               
Sbjct: 117 EMM-DFGIPQITE-TKMLKKYITQKSFKLIKTSTSKKKKNAARPPA-------------- 160

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
           E +N+ S          WRP+GI++KKNE FL + E I++LV+++G +L+S + G + + 
Sbjct: 161 ELTNSVS----------WRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVR 210

Query: 236 THLSGTPVCQFGLNDSLSVKN---DDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVS 292
           + LSG P  + G+ND     N   ++  D                  + LED KFHQCV 
Sbjct: 211 SRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVR 270

Query: 293 LEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFP 352
           L KF+ ++II F+PPDG  +LM Y + + I  P     +     S + +E     K+   
Sbjct: 271 LSKFENEKIITFIPPDGEFDLMNYRLTTPIK-PLIWCDVNIQVHSKSRIEIHCRAKAQIK 329

Query: 353 SKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV--- 409
            K  A NV + IPVP +    +   S+GS K+ PE+ A+LW    + G  E ++SA    
Sbjct: 330 KKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHL 389

Query: 410 -TITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSK 467
            ++   + P++      + P+ + F+I  F+ SG+ VRY  + E + +YK+  W+RY+++
Sbjct: 390 PSVDGVEPPKV------RRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQ 443

Query: 468 SGS-YEIR 474
           SG  Y IR
Sbjct: 444 SGEDYTIR 451

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  185 bits (469), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 138/485 (28%), Positives = 242/485 (49%), Gaps = 56/485 (11%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPIL--TLGSTTFQHIR 58
           M+S +     +G  I+S+ +++++  S  D F   ++ +L+  S ++   L     Q++ 
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYL- 58

Query: 59  SNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLDV 116
             +  +DL++V+++ S   N   V+ FL+K    L  Y     EE +++ F++ YELLD 
Sbjct: 59  -FIEHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDE 117

Query: 117 MLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQE 176
           M+ + G P  T+   ++K+   + S + I+            + K+    R  +   N  
Sbjct: 118 MM-DYGIPQITE-TKMLKQYITQKSFKLIK-----------AVKKVKATARPPTGLTNSV 164

Query: 177 SSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVT 236
           S               WR  GI++KKNE FL + E I+++++++G +L+S + G + + +
Sbjct: 165 S---------------WRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIGQVIVRS 209

Query: 237 HLSGTPVCQFGLND-SLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEK 295
            LSG P  + G+ND  +  ++ + G+S                S  LED KFHQCV L K
Sbjct: 210 RLSGMPDLKLGINDKGIFTRDPETGES-------QVTAGKKKSSAELEDLKFHQCVRLSK 262

Query: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355
           F+ ++II F+PPDG  ELM Y + + +  P     +     S + +E     K+    K 
Sbjct: 263 FENEKIITFIPPDGEFELMSYRLTTPVK-PLIWCDVNVQVHSKSRIEIHCRAKAQIKKKS 321

Query: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411
            A NV + IPVP +        S+GS K+ PE+ A+LW    + G  E +++A     +I
Sbjct: 322 VANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPSI 381

Query: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG- 469
              + P+       K P+ + F+I  F+ SG+ VRY  I E + +YK+  W+RY++++G 
Sbjct: 382 NGVEKPKF------KRPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGD 435

Query: 470 SYEIR 474
            Y IR
Sbjct: 436 DYTIR 440

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  183 bits (464), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 141/486 (29%), Positives = 243/486 (50%), Gaps = 50/486 (10%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56
           M SAV    S+G  ++++ +++++  S  + F   ++++L+  +    P L+     +  
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90

Query: 57  IRSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114
           I+ N    D++LV++  S + N   ++ FLYK   +L  Y     EE +++ F++ YELL
Sbjct: 91  IQHN----DVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELL 146

Query: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174
           D  + + G P  T+   + + ++ K       +F +    K       P           
Sbjct: 147 DETM-DYGIPQITETKMLKQYITQK-------SFKLVKAAKKKRNAARPP---------- 188

Query: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234
            E+  NS         + WR   I +KKNE FL + E I++L++++G IL+S + G + +
Sbjct: 189 -EALTNS---------VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKV 238

Query: 235 VTHLSGTPVCQFGLNDS--LSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVS 292
            + LSG P  + G+ND    S   DD   + +              ++ LED KFHQCV 
Sbjct: 239 KSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVR 298

Query: 293 LEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFP 352
           L KF+ ++II F+PPDG  ELM Y + ++I  P     +     S + +E     K+   
Sbjct: 299 LSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQSRIEIHCRAKAQIK 357

Query: 353 SKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTIT 412
            K TA NV + IPVP +    +   S+GS K+ PE+  ++W    + G  E ++SA    
Sbjct: 358 KKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSA---- 413

Query: 413 SKDAPRL-NIQQWQ-KPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG 469
               P + NI++ + K P+ + F+I  F+ SG+ V+Y  I E + +YK+  W+RY+++SG
Sbjct: 414 QMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSG 473

Query: 470 -SYEIR 474
             Y IR
Sbjct: 474 DDYTIR 479

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  177 bits (450), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 135/489 (27%), Positives = 239/489 (48%), Gaps = 54/489 (11%)

Query: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLD---VRSPILTLGSTTFQHI 57
           M+S V    + G+ I+S+ +++++  S  D F   ++ + +   V  P L      +  I
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELYGLN-NEEFLKEEFMVCYELLD 115
           + +    D+++V++T S   N   ++ FL++   +L  Y  +  EE +++ F++ YELLD
Sbjct: 61  QHS----DIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLD 116

Query: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175
            M+ + G P  T+   + + ++ K       +F +    K       P            
Sbjct: 117 EMM-DYGIPQITETKMLKQYITQK-------SFKLIKAAKKKRNAARP------------ 156

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235
                      +   + WR +GI +KKNE +L + E I++L++++G +L+S + G + + 
Sbjct: 157 --------PVALTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVK 208

Query: 236 THLSGTPVCQFGLND----SLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCV 291
           + LSG P  + G+ND    S  ++N++                    ++ LED KFHQCV
Sbjct: 209 SRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCV 268

Query: 292 SLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLF 351
            L KF+ ++II F+PPDG  ELM Y + + I  P     I     S + +E     K+  
Sbjct: 269 RLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKSRIEIHCRAKAQI 327

Query: 352 PSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV-- 409
             K  A NV + IPVP +        S+GS K+ PE+ A+LW    + G  E +++A   
Sbjct: 328 KKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLG 387

Query: 410 --TITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVS 466
             ++   + P++      K P+ + F+I  F+ SG+ VRY  I E + +YK+  W+RY++
Sbjct: 388 LPSVDGIEPPKV------KRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYIT 441

Query: 467 KSG-SYEIR 474
           +SG  Y IR
Sbjct: 442 QSGDDYTIR 450

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  107 bits (268), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 114/467 (24%), Positives = 195/467 (41%), Gaps = 98/467 (20%)

Query: 64  DDLWLVSVTRSNI--NCGAVWEFLYKFDHMLELYGLNNE---EFLKEEFMVCYELLDVML 118
           D L+ VSV+   +  N   +  +L  F  +L  Y   N+     + + F + YEL D  L
Sbjct: 58  DGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDESL 117

Query: 119 GENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSS------- 171
            + G P  TD   +   + ++ +   + + + +  ++ S     P+ L+   +       
Sbjct: 118 -DYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESG----PEILQSKENKDKADIH 172

Query: 172 -FLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVS-KEGSILKSYVD 229
            F + E   NS         + WRPKGI + KNE+F+ + E+ S L+  K   + +++V 
Sbjct: 173 GFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVY 232

Query: 230 GTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQ 289
           G I+  ++LSG P+ +  +N  L  K+                       + L   KFHQ
Sbjct: 233 GKINCRSYLSGMPIVRVCINKMLKDKD-----------------------LFLGSSKFHQ 269

Query: 290 CVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVT---YSSSGTAVEYRIT 346
           CVSLE       I+F+PPDG  +L +Y ++ +IN     SPI+    Y  +    ++R+ 
Sbjct: 270 CVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHIN----DSPIIKLIDYKINERQKKHRLH 325

Query: 347 LKSLFPSKLTAKN--VTMKIPVPPETL--DCKIDVS--------NGSCKFAPEEKAMLWT 394
           L         A+N    +KI +P   L  + KID++        +GS  F   ++ +LW 
Sbjct: 326 LSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWD 385

Query: 395 FNKYNGLTENTLSAVTI------------------TSKDAPRL----------------- 419
                G    T  ++ +                   S D P L                 
Sbjct: 386 AQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNK 445

Query: 420 -NIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
               Q+Q   I+ +FE+  +++SGL V Y  I E   +Y++  W+RY
Sbjct: 446 EGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRY 492

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 113/486 (23%), Positives = 202/486 (41%), Gaps = 108/486 (22%)

Query: 45  PILTLGSTTFQHIRSNVHGDDLWLVSVT---------RSNINCGAVWEFLYKFDHMLELY 95
           P+       F +IR     D  + +S           +S+ N  A+  +L  F  +L+ Y
Sbjct: 44  PVFHYKGIHFVYIRR----DGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRY 99

Query: 96  GLN---NEEFLKEEFMVCYELLDVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISV 152
             +   N   + + F + YELLD  L + G P  TD   +   + V+       N    +
Sbjct: 100 FNSQKLNRWLIVDNFHLIYELLDESL-DFGVPQLTDYNIIQDYIKVQV------NLHDEL 152

Query: 153 QNKNSTLPKIPKFLRRTSSFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEK 212
            + +  + K          F + ES  NS  A      + WRPKGI + KNE FL V E+
Sbjct: 153 ADSSKKISKKEDL----HGFEDDESYMNSFIARTTTSAISWRPKGIHYTKNEFFLDVIEE 208

Query: 213 ISILVS-KEGSILKSYVDGTIDLVTHLSGTPVCQFGLN---DSLSVKNDDYGDSFDYXXX 268
           I   +   +  I K++V G I   ++LSG P  + GL+    SL  + + +         
Sbjct: 209 IEYCMDFNKSKIRKNFVHGRIRCRSYLSGMPKLKIGLSKITSSLPKEREQF--------- 259

Query: 269 XXXXXXXXXGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKV 328
                        + + KFHQCVSLE   K+ I+ F+PPDG  +L +Y ++ ++  P   
Sbjct: 260 -------------MNNAKFHQCVSLEDLQKN-IVSFIPPDGEFQLCEYKLKRHVRDP--- 302

Query: 329 SPIVTYSSSGTAVEYR--------ITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVS-- 378
            P++         E +        +T+ + F S+ +   + ++IP+     + +ID++  
Sbjct: 303 -PVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKP 361

Query: 379 ------NGSCKFAPEEKAMLWTFNKYNG---LTENTL-SAVTITSKDAPRLNIQQWQK-- 426
                  G+  F   +  +LW      G    TE+++     +  ++  +  +++ +   
Sbjct: 362 PRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSM 421

Query: 427 -PP--------------------------ISLDFEIMMFSNSGLVVRYFTIKESE-RYKT 458
            PP                          +S++FEI  ++ SGL V+Y  I+E + +Y +
Sbjct: 422 DPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHS 481

Query: 459 VKWIRY 464
             W+RY
Sbjct: 482 FPWVRY 487

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score = 97.8 bits (242), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 106/465 (22%), Positives = 195/465 (41%), Gaps = 93/465 (20%)

Query: 64  DDLWLVSVTRSNINCGAVWEFLYKFD-HML-----ELYGLNNEEFLKEEFMVCYELLDVM 117
           D L+ VS++  ++    +   +Y  D HML      +  L+    + + F + YELLD  
Sbjct: 58  DGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIV-DNFNLIYELLDES 116

Query: 118 LGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPK---IPKFLRRTS--SF 172
           L + G P  TD   +   + ++P+       A S  + + +  +   + +   +++   F
Sbjct: 117 L-DFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 173 LNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVS-KEGSILKSYVDGT 231
            + E   NS         + WRPKGI + KNE+F+ V E  + ++  K   + K+++ G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 232 IDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCV 291
           I   ++LSG PV +  +N  L  ++                         L   KFHQCV
Sbjct: 236 IICRSYLSGMPVVKICINKMLKDRDQ-----------------------FLSSAKFHQCV 272

Query: 292 SLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPI-------VTYSSSGTAVEYR 344
           SLE       I+F+PPDG  +L +Y ++ +I+     SP+       V        ++  
Sbjct: 273 SLESLSSQDFIEFIPPDGDFQLCEYKIKRHIS----DSPVIKLIEYKVVEKPKKHKLQIS 328

Query: 345 ITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSN--------GSCKFAPEEKAMLWTFN 396
           + ++  F ++ +A  + +++P+       KID++         GS  F   +  +LW  N
Sbjct: 329 MKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKAN 388

Query: 397 KYNGLTENTLSAVTIT----SKDAPRLNIQQWQK---PP--------------------- 428
              G    T  ++ +       +A R   ++ +    PP                     
Sbjct: 389 GMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQ 448

Query: 429 --------ISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
                   I+ +FE+  F++SGL V Y  I+E + +Y++  W+RY
Sbjct: 449 INNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRY 493

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 92/357 (25%), Positives = 140/357 (39%), Gaps = 95/357 (26%)

Query: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVS-KEGSILKSYVDGTIDL 234
           E+  NS     M   + WRPKGI + KNE FL V EK+  ++  +EG +  + ++GTI  
Sbjct: 164 ETFINSYILRTMTSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIIC 223

Query: 235 VTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLE 294
            ++LSG P    GLN  L  KN  +                      ++  KFH+CV L 
Sbjct: 224 RSYLSGMPQLSIGLN-KLMQKNVHF----------------------MKRLKFHECVDLH 260

Query: 295 KFDKDR--IIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYR-------- 344
              K+   +IKF+PPDG  EL  Y     +N P    P++   S G + + R        
Sbjct: 261 TLIKEESPVIKFIPPDGEFELCNY----KLNRPLLDEPVIKLQSFGLSQKPRKNQETQDK 316

Query: 345 ----ITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSN--------GSCKFAPEEKAML 392
                 + + F ++ +AK + +KIP+        ID+          G   F     +++
Sbjct: 317 LLLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSII 376

Query: 393 WTFNKYNGLTEN------------------TLSAVTITSKDAPRLNI-----QQWQK--- 426
           W  N   G   N                   L      S D P L       + W +   
Sbjct: 377 WKINNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHG 436

Query: 427 ------------------PPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
                               I++ FEI  ++ SGL V YF I+E +  Y++  W+RY
Sbjct: 437 KTTEYDGNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRY 493

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 90.9 bits (224), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 82/329 (24%), Positives = 136/329 (41%), Gaps = 86/329 (26%)

Query: 193 WRPKGISHKKNEIFLYVNEKISILVS-KEGSILKSYVDGTIDLVTHLSGTPVCQFGLNDS 251
           WR KGI + KNE FL V EK+  L   KE  + K+ + G I   ++LSG P  +  LN  
Sbjct: 238 WRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALNKL 297

Query: 252 LSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSM 311
           L                          +  +   KFHQCV+LE  + ++ ++F+PPDG  
Sbjct: 298 LQ-----------------------RDAQFMSHSKFHQCVALETLN-EKELEFIPPDGEF 333

Query: 312 ELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYR-------ITLKSLFPSKLTAKNVTMKI 364
            L +Y ++ ++N     +PI+  +S     + +       +T+++ F ++ +   + +KI
Sbjct: 334 ILCEYELKRHVN----DTPILKITSFEIKPQLKKFKLRILLTIETHFKTRNSTSILNVKI 389

Query: 365 PVPPETLDCKIDVSN--------GSCKFAPEEKAMLWTFNKYNGLTENT----------- 405
           P+     D  ID+S         G   F   +  +LW   +  G    T           
Sbjct: 390 PLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSLF 449

Query: 406 -----------------------------LSAVTITSKDAPRLNIQQWQKPPISLDFEIM 436
                                        L A T + KD P + ++  Q   + +DFEI 
Sbjct: 450 NKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKD-PEVLVKSIQSQLVGMDFEIP 508

Query: 437 MFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
             + SGL V Y  I+E + +Y++  W+RY
Sbjct: 509 YTTCSGLKVEYLKIEEEQLQYQSFPWVRY 537

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/426 (24%), Positives = 163/426 (38%), Gaps = 90/426 (21%)

Query: 99  NEEFLKEEFMVCYELLDVMLGENGTPMDTDPATVIK---KMSVKPSKETIENFAISVQNK 155
           N + + + F + YEL+D  + + G P  TD   +I+   K+ V    E  E  A   + K
Sbjct: 95  NRQLIMDNFHLVYELMDESI-DMGIPQLTD-HNIIRDYVKVQVVRRAEDGEKHAGKHKAK 152

Query: 156 NSTLPKIPKFLRRTSSFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISI 215
                K  K           E   NS  A      + WRP+GI + KNE FL V E++  
Sbjct: 153 RD---KAGKEEEEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEY 209

Query: 216 LVSKEGSILK-SYVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXX 274
           L+  E + ++ + V G I+  ++LSG P    GLN  ++   D                 
Sbjct: 210 LMDFERAQVRLNQVHGAINCRSYLSGMPQLTVGLNKMVAQDRD----------------- 252

Query: 275 XXXGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTY 334
                       FHQCV LE+   DR I FVPPDG  +L  Y +    N      P++  
Sbjct: 253 ------FTSQVHFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGAN----EQPLIKL 302

Query: 335 SSSGTAVEYR------------ITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVS---- 378
                AV+ R            +++ + F  +     + +++P+       K+D+S    
Sbjct: 303 EECRAAVKPRRRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPR 362

Query: 379 ----NGSCKFAPEEKAMLW------------------TFNKYNGLTENTLSAVTITSKDA 416
                G   F   +  +LW                   F+ Y+    +   A   TS D 
Sbjct: 363 FKCDAGCVMFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDP 422

Query: 417 -PRLNIQQWQK--------------PPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVK 460
            P    QQ +                 + +DFE+   + SGL V +  I E + +Y++  
Sbjct: 423 LPAHPGQQLEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFP 482

Query: 461 WIRYVS 466
           WIRY S
Sbjct: 483 WIRYKS 488

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 108/467 (23%), Positives = 190/467 (40%), Gaps = 93/467 (19%)

Query: 61  VHGDDLWLVSVTR--SNINCGAVWEFLYKFDHMLELY-GLN-NEEFLKEEFMVCYELLDV 116
           +  D L+ +S++   +N+    V+ +L +   + + Y G N N+  +   F + +EL+D 
Sbjct: 53  IQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLITGNFHLIHELIDE 112

Query: 117 MLGENGTPMDTDPATV---IKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFL 173
            +   GTP  TD   +   IK   VK S E     A     K +      K    T +  
Sbjct: 113 SIFM-GTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDSKKKEEDTEA-- 169

Query: 174 NQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKS-YVDGTI 232
             E+  NS  A      + WRPKGI + KNE +L V E +  LV  +   +KS  V G I
Sbjct: 170 TDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYI 229

Query: 233 DLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVS 292
              ++LSG P+   GLN  L+ +N+ +                      +    FHQCV+
Sbjct: 230 QCRSYLSGMPMLTIGLN-KLNSENEYF----------------------MRRANFHQCVN 266

Query: 293 LEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYR-------- 344
           L++   D++I F PPDG  +L  Y +  N++ P    P++        ++ R        
Sbjct: 267 LDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDP----PMIKLEDCKVKLKPRKTKDGLDR 322

Query: 345 ----ITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVS--------NGSCKFAPEEKAML 392
               +T+ + F  + +   + +K+P+     D  +D+S         G   F   +  +L
Sbjct: 323 LILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLL 382

Query: 393 WTFNKYNG-------------LTENTLSAVTITSKDAPRLNIQQWQKPP----------- 428
           W   K  G                N      I  + +  ++ +  ++ P           
Sbjct: 383 WEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHE 442

Query: 429 ----------ISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
                     + ++FEI  ++ SGL V +  I+E + ++++  W+RY
Sbjct: 443 LNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 118/505 (23%), Positives = 204/505 (40%), Gaps = 117/505 (23%)

Query: 44  SPILTLGSTTFQHIRSNVHGDDLWLVSVTRS---NINCGAVWEFLYKFDHMLELY---GL 97
            P+++  S  F HI+ +     L  VSV  +   + N   +  FL +F  +L+ Y     
Sbjct: 42  QPVISASSFHFVHIKRS----SLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSA 97

Query: 98  NNEEFLKEEFMVCYELLDVMLGENGTPMDTDPATVIKKMSVK---PSKETIENFAISVQN 154
            ++  + +  ++  EL+D  + + G    TD + +   + VK   P  +TI++ ++   +
Sbjct: 98  LDKNMVLDNVLLIMELIDESI-DFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSD 156

Query: 155 ----------KNSTLPKIPKFLRRTSSFLNQ-------------ESSNNSSGAFNMAGEL 191
                     + S  P + KFLR      ++             E S NS  A      +
Sbjct: 157 TDEEDNKKTKRRSGKPNLYKFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPV 216

Query: 192 PWRPKGISHKKNEIFLYVNEKISILVS-KEGSILKSYVDGTIDLVTHLSGTPVCQFGLND 250
            WR KGI + +NE FL V E++  L+    G I K+ + G I   ++LSG P  +   N 
Sbjct: 217 SWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN- 275

Query: 251 SLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGS 310
            LS K++ +                      +   KFHQCV+      ++ I+F+PPDG 
Sbjct: 276 KLSQKDEQF----------------------ISHSKFHQCVTWPS-SNEKEIEFIPPDGD 312

Query: 311 MELMKYHVRSNINLPFKVSPIVTYSSSGTA---VEYRITLKSLFPSKLTAKNVT----MK 363
             L +Y ++ ++    K  P++   S G      +Y+I +     +   A+N T    +K
Sbjct: 313 FVLCQYELKRHV----KDQPMLKLVSFGVKPKLKKYKIQMSCTIETHFKARNSTSTLNLK 368

Query: 364 IPVPPETLDCKIDV--------SNGSCKFAPEEKAMLWTFNKYNGLTENT-LSAVTITS- 413
           IP+     + +ID+         +G   F   +  +LW      G   +T LS     S 
Sbjct: 369 IPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSL 428

Query: 414 ----------------------KDAPRL-----NIQQWQKPP------ISLDFEIMMFSN 440
                                 +D P+L      +   + P       +S+ FEI   + 
Sbjct: 429 FNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTC 488

Query: 441 SGLVVRYFTIKESE-RYKTVKWIRY 464
           SGL V Y  I E + +Y++  W+RY
Sbjct: 489 SGLQVEYLKIDEEQLQYQSFPWVRY 513

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 87/350 (24%), Positives = 141/350 (40%), Gaps = 82/350 (23%)

Query: 172 FLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILK-SYVDG 230
            +++++  NS  A      + WR KGI + KNE FL V EK+   +    +I+K + + G
Sbjct: 204 LVDEDTYINSYIAKTTIMSVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHG 263

Query: 231 TIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQC 290
            I   + LSG P  +  LN  +      Y D                    L  CKFHQC
Sbjct: 264 EIICKSFLSGMPTLKVSLNKII------YQDK-----------------QFLSSCKFHQC 300

Query: 291 VSLEKFDKDRIIKFVPPDGSMELMKYHVRSNIN-LPFKVSPIVTYSSSGTAVEYR----I 345
           V  +  D+ ++++FVPPDG   L KY ++ ++N LP  +  +++Y       +Y+    +
Sbjct: 301 VMPDSVDEGKVLEFVPPDGDFVLCKYELKRHVNDLP--LLKLISYEVKPKLDKYKLKLFV 358

Query: 346 TLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVS--------NGSCKFAPEEKAMLWTFNK 397
           T++S F    +   + +KIP+        ID+S         G   F   +  +LW    
Sbjct: 359 TIESTFKKTNSTTKLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGA 418

Query: 398 YNGL-TENTLSAVTITSKDAPRLNIQQWQK----PP------------------------ 428
             G  ++  + A      +   L  Q+  K    PP                        
Sbjct: 419 MKGGNSQLKMGADFALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFT 478

Query: 429 -------------ISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
                        I +DFEI   ++SGL V Y  I+E   +Y+   W+RY
Sbjct: 479 RKGESSDETKGNLIKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRY 528

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 79.0 bits (193), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 100/405 (24%), Positives = 157/405 (38%), Gaps = 117/405 (28%)

Query: 152 VQNKNSTLPKIPKFLRRTSSFLNQESSN----NSSGAFNMAGELPWRPKGISHKKNEIFL 207
           +++  + L KI KF R    + +  + N    NS  A      + WR KGI + KNE FL
Sbjct: 207 IKDNINELEKIGKF-RGKDEYDDDANENETFINSYIAKTTIMPVSWRAKGIHYAKNEFFL 265

Query: 208 YVNEKISILVSKE-GSILKSYVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYX 266
            V EK+  LV  E G + +S + G I   ++LSG P  +  LN  L  +ND         
Sbjct: 266 DVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLNKLL--QND--------- 314

Query: 267 XXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDK----------------------DRIIKF 304
                          +   +FHQCVSL+  +K                      +  I+F
Sbjct: 315 ------------KQFISQVQFHQCVSLDSIEKVIKYAEEHSDELKTLKHTEHNAESEIEF 362

Query: 305 VPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAKNVT--- 361
           +PPDG   L  Y ++ +I  P  V  + ++  +    +Y++ + +   +     N T   
Sbjct: 363 IPPDGDFTLCSYELKRHIRDPPMVK-LCSFEITPKWKKYKLKISAAVETHFKPTNSTSKL 421

Query: 362 -MKIPVPPETLDCKIDV--------SNGSCKFAPEEKAMLWTF-----NKYNGLTEN--- 404
            +KIP+     D +ID+        SNG   +   +  +LW        K +G  E+   
Sbjct: 422 DVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWEIGVIKGGKMHGSKEDISK 481

Query: 405 -----TLSA---------------VTITSKDAPRLNI-------------------QQWQ 425
                T++A                  TS + P L                        Q
Sbjct: 482 FDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKLEDIYKETHEENDGYNSVGQ 541

Query: 426 KPP-----ISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
           KP      +S+DFEI   + SGL V Y  I E + +Y++  W+RY
Sbjct: 542 KPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWVRY 586

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 138/335 (41%), Gaps = 86/335 (25%)

Query: 193 WRPKGISHKKNEIFLYVNEKISILVS-KEGSILKSYVDGTIDLVTHLSGTPVCQFGLNDS 251
           WR KGI + KNE FL V EK+  L+    G I K+ + G I    +LSG P  +  LN  
Sbjct: 218 WRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALNK- 276

Query: 252 LSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDK------------D 299
             +KND+                       + + KFHQCVS+    +             
Sbjct: 277 -LIKNDEQ---------------------FISNSKFHQCVSINSLKREINNEEEENTYHG 314

Query: 300 RIIKFVPPDGSMELMKYHVRSNI-NLP-FKVSPI-VTYSSSGTAVEYRITLKSLFPSKLT 356
           + I+F+PPDG   L KY ++ ++ ++P  K+S I +        ++  +T+++ F  + +
Sbjct: 315 KEIEFIPPDGEFVLCKYELKRHVRDVPVIKLSNIEIKPKLKKYKIQIHVTIETHFKKQNS 374

Query: 357 AKNVTMKIPVPPETLDCKIDVSN--------GSCKFAPEEKAMLW---TFNKYNGLTENT 405
              +T+KIP+       KID++         G   F   +  ++W   +    NG ++N 
Sbjct: 375 TSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNN 434

Query: 406 LSAVTITSKDAPRLNIQQWQK----PP-------------------------------IS 430
           + A            +Q+  K    PP                               ++
Sbjct: 435 MVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLT 494

Query: 431 LDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
           + FE+   + SGL V Y  I+E++  Y++  W+RY
Sbjct: 495 MKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRY 529

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/373 (22%), Positives = 145/373 (38%), Gaps = 101/373 (27%)

Query: 172 FLNQESSN----NSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVS-KEGSILKS 226
           FL QE       NS  A      + WR KGI + KNE FL V EK+   +   +  I K+
Sbjct: 230 FLMQEEEEFNFLNSDIAKTTIMPISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKN 289

Query: 227 YVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCK 286
            + G I     LSG P  +  +N    + N+D                       L +CK
Sbjct: 290 LIHGEIRCKCFLSGMPNLKVSIN---KIVNED--------------------KQFLANCK 326

Query: 287 FHQCVSLEKFDKD--RIIKFVPPDGSMELMKYHVRSNIN-------LPFKVSPIVTYSSS 337
           FHQCVSL   +    + ++FVPPDG   L +Y ++ ++        + F+V P +     
Sbjct: 327 FHQCVSLASLESSDHKDVEFVPPDGEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKL 386

Query: 338 GTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVS--------NGSCKFAPEEK 389
              +    T+++ F +      + +++P+     + ++D+S         G+  F   + 
Sbjct: 387 KLLL----TIETHFKTTNATSKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDD 442

Query: 390 AMLWTFNKYNGLTENTLSAVTI------------------TSKDAPRLN----------- 420
            +LW     +G    T  ++ +                  TS + P L            
Sbjct: 443 FLLWEVGSMSGGHGETQLSMGVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQ 502

Query: 421 --------------IQQWQKPP--------ISLDFEIMMFSNSGLVVRYFTIKESE-RYK 457
                         + + +  P        +++DFE+   ++SGL V Y  I+E +  Y+
Sbjct: 503 IHEDDDDDDGNTEPVAEHRLQPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQ 562

Query: 458 TVKWIRYVSKSGS 470
           +  W+RY + S +
Sbjct: 563 SFPWVRYTTLSDA 575

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 83/354 (23%), Positives = 141/354 (39%), Gaps = 107/354 (30%)

Query: 191 LPWRPKGISHKKNEIFLYVNEKISILVS-KEGSILKSYVDGTIDLVTHLSGTPVCQFGLN 249
           + WR KGI + KNE FL V EK+   +  K G I K+ + G I   ++LSG P  +  +N
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 250 DSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKF------------- 296
             L  K D                        L + KFHQCVSL+               
Sbjct: 310 KIL--KQD---------------------VQFLSNVKFHQCVSLDSIRARSNPPAVEEDG 346

Query: 297 -----DKDRI-----IKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSS-------SGT 339
                + D +     I+F+PPDG   L KY ++ ++    K  P++   +          
Sbjct: 347 KKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHV----KDQPMIKLRNFEIIPKLHKF 402

Query: 340 AVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVS--------NGSCKFAPEEKAM 391
            ++  + +++ F +  +   + ++IP+       +ID+S         G+  F   +K +
Sbjct: 403 KIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFL 462

Query: 392 LWTFNKYN-GLTENTLSAVT-----------------ITSKDAPRL-------------- 419
           LW     N G  ENTLS +                   TS + P L              
Sbjct: 463 LWEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIH 522

Query: 420 --------NIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
                   + ++  +  +++DFE+   + SGL + Y  I+E + +Y++  W+RY
Sbjct: 523 EEGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRY 576

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 10/100 (10%)

Query: 45  PILTLGSTTFQHIRSNVHGDDLWLVSVTRSNINCG--AVWEFLYKFDHMLELY---GLNN 99
           PIL      F HI+     D L  +SV  +N  C    V+ +L +F  +L+ Y   G+ N
Sbjct: 46  PILNDIDWQFLHIKR----DSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILN 101

Query: 100 EEFLKEEFMVCYELLDVMLGENGTPMDTDPATVIKKMSVK 139
              L + F+V  EL+D  L + G    TD + +   + VK
Sbjct: 102 RNLLIDNFLVVIELIDESL-DFGVVQFTDSSLIKDYVRVK 140

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 75.1 bits (183), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 88/361 (24%), Positives = 138/361 (38%), Gaps = 103/361 (28%)

Query: 180 NSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVS-KEGSILKSYVDGTIDLVTHL 238
           NS  A      + WR KGI + KNE FL V E +  L++ K+  I ++ + G I   ++L
Sbjct: 214 NSHIARTTTMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYL 273

Query: 239 SGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSL----- 293
           SG P  +  LN  L    DD                       L   KFHQCVSL     
Sbjct: 274 SGMPTLRIALNKILQ---DD--------------------KQFLGHAKFHQCVSLNSINI 310

Query: 294 EKFDKD---------------RIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSG 338
           +  +KD               + I+F+PPDG   L +Y +R ++  P    P++  +S  
Sbjct: 311 KDLEKDLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDP----PVINMTSFD 366

Query: 339 TA-------VEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSN--------GSCK 383
                    V+  + +++ F  + +   +T+KIP+     D KID+S         G   
Sbjct: 367 IKPNFKKFRVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVL 426

Query: 384 FAPEEKAMLWTFNKY---NGLTENTLSAVTITSKDAPRLNIQQWQK-----PPIS----- 430
           F   E  ++W  +     +G  E  + A            +Q+  K     PP+      
Sbjct: 427 FNISEDFLIWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKL 486

Query: 431 --------------------------LDFEIMMFSNSGLVVRYFTIKES-ERYKTVKWIR 463
                                     + FEI   + SGL V Y  I+E   +Y++  W+R
Sbjct: 487 EELYEEMHENEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVR 546

Query: 464 Y 464
           Y
Sbjct: 547 Y 547

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 104/253 (41%), Gaps = 44/253 (17%)

Query: 174 NQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVS-KEGSILKSYVDGTI 232
           N E+  NS  A      + WR KGI + KNE FL V EK   ++  K   I K+ + G I
Sbjct: 270 NDENYINSYIAKTTIMPISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKI 329

Query: 233 DLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVS 292
                LSG P  +  LN  L                             L   +FHQCVS
Sbjct: 330 ICRCFLSGMPKLKIALNKLLQ-----------------------KDQQFLSQLRFHQCVS 366

Query: 293 LEKFDKDRIIKFVPPDGSMELMKYHVRSNINLP-------FKVSPIVTYSSSGTAVEYRI 345
           LE   +++ I+F+PPDG   L +Y ++ ++  P       F++ P +        ++  +
Sbjct: 367 LETI-QNKEIEFIPPDGEFILCEYELKRHVKDPPNIKLISFEIKPKL----KKFKIQINL 421

Query: 346 TLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSN--------GSCKFAPEEKAMLWTFNK 397
           ++ + F  + +   + +KIP+     D KID+          G  KF   +  +LW    
Sbjct: 422 SITTFFKVQNSTSILNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGS 481

Query: 398 YNGLTENTLSAVT 410
             G     + A+T
Sbjct: 482 MKGGHGENIKAMT 494

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 429 ISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
           +++DFEI  ++ SGL V Y  I+E +  Y++  W+RY
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRY 645

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 85/359 (23%), Positives = 135/359 (37%), Gaps = 112/359 (31%)

Query: 191 LPWRPKGISHKKNEIFLYVNEKISILVSKE-GSILKSYVDGTIDLVTHLSGTPVCQFGLN 249
           + WR KGI + KNE FL V E++  L+  E G I K+ + G I   ++LSG P  +  +N
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 250 DSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFD------------ 297
             L+                            + +  FHQCVSL+  +            
Sbjct: 313 KILN-----------------------RDPQFMSNSNFHQCVSLDSINTIEKGQEKEQNT 349

Query: 298 -------KDRIIKFVPPDGSMELMKYHVRSNI-NLP------FKVSPIVTYSSSGTAVEY 343
                    R I+FVPPDG   L +Y ++ ++ + P      F++ P +  S      + 
Sbjct: 350 GDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILTKI 409

Query: 344 RITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVS--------NGSCKFAPEEKAMLWTF 395
           +   K   P+  T+K + +KIP+     D KID+S        NG   F   +  +LW  
Sbjct: 410 QTNFK---PTNSTSK-LNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEI 465

Query: 396 NKYNGLTENTLSAVTITSKDAPR----------LNIQQWQK----------PP------- 428
               G  E   S       D              N +++ +          PP       
Sbjct: 466 QTMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPK 525

Query: 429 ----------------------ISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464
                                 +S+DFEI   + SGL V Y  ++E + +Y++  W+RY
Sbjct: 526 LEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 584

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 83/374 (22%), Positives = 143/374 (38%), Gaps = 112/374 (29%)

Query: 180 NSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKE-GSILKSYVDGTIDLVTHL 238
           N   A  +   + WR KGI + KNE FL V E++  L+  E G I K+ + G I    +L
Sbjct: 249 NGDIAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYL 308

Query: 239 SGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSL----- 293
           SG P  +  +N  L+                         +  L +  FHQCVSL     
Sbjct: 309 SGMPKLKISINKILN-----------------------RDAQFLSNSSFHQCVSLDSIKT 345

Query: 294 -----EKFDKD---------RIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVT---YSS 336
                EK D D         + ++FVPPDG   L +Y ++ ++    K +P++    +  
Sbjct: 346 IEKREEKEDDDTGLQAAADAKELEFVPPDGEFVLCQYELKRHV----KDAPMIKLKDFQI 401

Query: 337 SGTAVEYRITLKSLFPSKLTAKNVT----MKIPVPPETLDCKIDVSN--------GSCKF 384
                +++I +++   +     N T    +KIP+     + +ID+S         G   F
Sbjct: 402 KPKLKKFKIQIETKIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVF 461

Query: 385 APEEKAMLWTFNKYNGLTENTLSAVTITSKDA----------PRLNIQQWQK-------- 426
              +  +LW      G  E+  +  +    D           P  N +++ +        
Sbjct: 462 NLSDDFLLWEIQAMKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTS 521

Query: 427 --PP-----------------------------ISLDFEIMMFSNSGLVVRYFTIKESE- 454
             PP                             +++DFEI   + SGL + Y  ++E + 
Sbjct: 522 MNPPPLRTGPRLEELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQL 581

Query: 455 RYKTVKWIRYVSKS 468
           +Y++  W+RY + S
Sbjct: 582 QYQSFPWVRYKTTS 595

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 90/371 (24%), Positives = 141/371 (38%), Gaps = 113/371 (30%)

Query: 180 NSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKE-GSILKSYVDGTIDLVTHL 238
           N   A  +   + WR KGI + KNE FL V E++  L+  E G I K+ + G I    +L
Sbjct: 241 NGDIAKTIIMPISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYL 300

Query: 239 SGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSL----- 293
           SG P  +  +N  L+                            + + KFHQCVSL     
Sbjct: 301 SGMPKLKISINKLLN-----------------------RDPQFMSNSKFHQCVSLDSINI 337

Query: 294 ---EKFDKD----------RIIKFVPPDGSMELMKYHVRSNI-NLP------FKVSPIVT 333
              E  D D          + I+F+PPDG   L +Y ++ ++ + P      F++ P + 
Sbjct: 338 IEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKLK 397

Query: 334 YSSSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSN--------GSCKFA 385
                   + +   K   P+  T+K + +KIP+     D KID+S         G   F 
Sbjct: 398 KFKIQIITKIQTNFK---PTNSTSK-LNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFN 453

Query: 386 PEEKAMLWTFNKYNGLTENTLSAV-------TITSKDA--PRLNIQQWQK---------- 426
             +  +LW      G  E     V       T+ S  A  P  N +++ +          
Sbjct: 454 LSDDFLLWEIGTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMN 513

Query: 427 PP--------------------------------ISLDFEIMMFSNSGLVVRYFTIKESE 454
           PP                                +S+DFEI   + SGL V Y  ++E +
Sbjct: 514 PPPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQ 573

Query: 455 -RYKTVKWIRY 464
            +Y++  W+RY
Sbjct: 574 LQYQSFPWVRY 584

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 83/374 (22%), Positives = 142/374 (37%), Gaps = 116/374 (31%)

Query: 180 NSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKE-GSILKSYVDGTIDLVTHL 238
           N   A  +   + WR KGI + KNE FL V E++  L+  E G I K+ + G I    +L
Sbjct: 247 NGDIAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYL 306

Query: 239 SGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKF-- 296
           SG P  +  +N  L+                            + +  FHQCVSL+    
Sbjct: 307 SGMPKLKISINKILN-----------------------RDPQFMSNSSFHQCVSLDSINT 343

Query: 297 -DKD-----------------RIIKFVPPDGSMELMKYHVRSNI-NLP------FKVSPI 331
            +KD                 R I+F+PPDG   L +Y ++ ++ + P      F++ P 
Sbjct: 344 IEKDEEKNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPK 403

Query: 332 VTYSSSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSN--------GSCK 383
           +         + +   K   P+  T+K + ++IP+     + KID+S         G   
Sbjct: 404 LKKFKIQIVTKIQTNFK---PTNSTSK-LNVRIPLTKVFQEYKIDLSKQIRFKANIGKVV 459

Query: 384 FAPEEKAMLWTFNKYNGLTENTLSAVTITSKDA-------------PRLNIQQWQK---- 426
           F   +  +LW      G  E++ +  +  + D              P  N +++ +    
Sbjct: 460 FNLSDDFLLWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEE 519

Query: 427 ------PP-----------------------------ISLDFEIMMFSNSGLVVRYFTIK 451
                 PP                             +++DFEI   + SGL V Y  ++
Sbjct: 520 MKTSMNPPPLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVE 579

Query: 452 ESE-RYKTVKWIRY 464
           E + +Y++  W+RY
Sbjct: 580 EPQLQYQSFPWVRY 593

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 133/340 (39%), Gaps = 71/340 (20%)

Query: 169 TSSFLNQESSNNSSGAFNMAGE----------LPWRPKGISHKKNEIFLYVNEKISILVS 218
            SS  N+ S  N+S   N+             +PWR  G+ +  NE+++ V E + +++ 
Sbjct: 154 ASSLSNRISQRNTSQVLNIGDPAKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILR 213

Query: 219 K-----EGSILKSYVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXX 273
           K     E + ++  +DG +D  +HLSG PV       +L ++  D G             
Sbjct: 214 KNEKTGELTSVRGVLDGVVDFRSHLSGNPVIAL----NLRLRGHDLGMP----------- 258

Query: 274 XXXXGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVR-----------SNI 322
                         HQC       +   ++FVPPDG  +LM Y +            SNI
Sbjct: 259 ------------ALHQCCLDSYQGRPDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNI 306

Query: 323 NLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTAK---NVTMKIPVPPETLDCKIDV-- 377
            L   VSP           E+ + L         AK   ++ + +   P   +CKI V  
Sbjct: 307 GL---VSPDYRTELGDLGDEFEVNLN--IAGSQHAKVVDDLVITLSFGPLPSECKIKVLR 361

Query: 378 -SNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIM 436
            ++G  +         W F+K       TL  +    ++A R  ++  Q   +S+ +   
Sbjct: 362 STHGHFENCASNNIGKWVFDKET--PTGTLPVLRGCLENATREQVRALQ---LSVSYTNR 416

Query: 437 MFSNSGLVVRYFTIKE--SERYKTVKWIRYVSKSGSYEIR 474
               SG+ V    I    S+  K  K ++Y++K+G + +R
Sbjct: 417 GELPSGIKVDSVDILSGLSKNIKPFKGVKYIAKTGDFHLR 456

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 101/238 (42%), Gaps = 61/238 (25%)

Query: 191 LPWRPKGISHKKNEIFLYVNEKISILVSKE-GSILKSYVDGTIDLVTHLSGTPVCQFGLN 249
           + WR KGI + KNE FL V EK+   +  E G I K+ + G I    +LSG P  +  +N
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 250 DSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKF------------- 296
             L  +ND                     S  L +  FHQCVSL+               
Sbjct: 355 KIL--QND---------------------SQFLSNAHFHQCVSLDSLHLQSAEDDDGDDN 391

Query: 297 ------------DKDRIIKFVPPDGSMELMKYHVRSNI-NLP------FKVSPIVTYSSS 337
                       D+ + I+F+PPDG   L KY ++ ++ +LP      F + P +    S
Sbjct: 392 ANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL----S 447

Query: 338 GTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTF 395
              ++  + +++ F +      + +KIP+     + +ID+S    KF  ++  +L+  
Sbjct: 448 KYKLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSK-QIKFKCDQGKVLFNL 504

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 400 GLTENTLSAVTITSKDAPRLNIQQWQKPP--ISLDFEIMMFSNSGLVVRYFTIKESE-RY 456
           G  E T +    T ++    ++++  + P  + +DFEI  ++ SGL + Y  I+E + +Y
Sbjct: 593 GSQEATGTHARKTKEERKDKDLRKRTRSPNLLKIDFEIPYYTCSGLKIEYLKIEEPQLQY 652

Query: 457 KTVKWIRY 464
           ++  W+RY
Sbjct: 653 QSFPWVRY 660

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 62/134 (46%), Gaps = 34/134 (25%)

Query: 191 LPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTHLSGTPVCQFGLND 250
           +PWR  GI++  NEIF+ ++E+I+ +V K G +L  ++ G IDL  HLSG P+ +  L  
Sbjct: 210 VPWRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEMKLG- 267

Query: 251 SLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFD--KDRI------I 302
                        D+                  +  FH+C+  +K +   D I      +
Sbjct: 268 -----------LLDHKLSHL-------------NTTFHRCILEDKANSINDLIAGKFTKL 303

Query: 303 KFVPPDGSMELMKY 316
            FVPPDG   L +Y
Sbjct: 304 TFVPPDGRTRLCQY 317

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 74/339 (21%), Positives = 133/339 (39%), Gaps = 69/339 (20%)

Query: 169 TSSFLNQESSNNSSGAF---NMAGEL-------PWRPKGISHKKNEIFLYVNEKISILV- 217
            SS  N+ S  ++S  F   ++ G L       PWR  G+ +  NE+++ V E I +++ 
Sbjct: 154 ASSLSNRISQRDASQMFRISDLTGSLGTKDKLVPWRTAGLKYSNNELYVDVVETIHVILR 213

Query: 218 --SKEGSI--LKSYVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXX 273
              K G +  ++  +DG +D  +HL+G PV    LN    +   D G             
Sbjct: 214 KTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVALKLN----LHGHDLGVP----------- 258

Query: 274 XXXXGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVT 333
                         H C   +       ++FVPPDG   LM+Y     I+L    +    
Sbjct: 259 ------------ALHPCCQAQYTGSPENLQFVPPDGKFRLMQY----TIDLEALQTKSKL 302

Query: 334 YSSSG-TAVEYRITLKSL---FPSKLTAK---------NVTMKIPVPPETLDCKIDV--- 377
           +S+ G  +++Y + L  L   F  K+            ++ + I     T DC+I     
Sbjct: 303 FSNMGLVSLDYFVGLGDLRDEFEIKVNIAGSQHVKLIDDLVVTIKFGKLTSDCRIKALRS 362

Query: 378 SNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMM 437
           ++G  +   E     W+F+K     E     V +          +Q +   +++ +    
Sbjct: 363 THGHFENGFENNIGKWSFDK-----ETPTGTVPVFRGCLENATPEQIKTLSLAISYSNKG 417

Query: 438 FSNSGLVVRYFTIKES--ERYKTVKWIRYVSKSGSYEIR 474
              SG+ V    I     +  K  K ++YV+++G + +R
Sbjct: 418 SLPSGIKVGAVDIISGLPKNTKPFKGVKYVARTGQFNLR 456

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 75/315 (23%), Positives = 123/315 (39%), Gaps = 64/315 (20%)

Query: 191 LPWRPKGISHKKNEIFLYVNEKISILVSKEG------SILKSYVDGTIDLVTHLSGTPVC 244
           +PWR K I   +NEI++ V E + + + K         +L  Y++G++ + + + G P+ 
Sbjct: 173 VPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPML 232

Query: 245 QFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKF--DKDRII 302
           +      +S    D+ D                        KFH CV + +F  +   II
Sbjct: 233 E------VSFGGCDFKDIIP---------------------KFHDCVEVNEFLTNDGNII 265

Query: 303 KFVPPDGSMELMKYHVRS---NINLPFKVSPIVTYSSSGTAVEYRITL---KSLFPSKLT 356
           KF+PPDG  +LM+Y +     N NL   +S   T     +  E+ ITL   KS    K+ 
Sbjct: 266 KFIPPDGKFQLMEYSMALSSFNDNL---ISCNFTNGLGNSNDEFEITLNINKSNKVPKIN 322

Query: 357 AKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNK---------YNGLTENTLS 407
              V +           KI + N   +F  E     W F+            G  E    
Sbjct: 323 NLQVCLNFENREGQSKVKI-LRNTHGRF--EYGKNTWIFDSELLTGTLPVLRGCVEEETK 379

Query: 408 AVTITSKDAPRLNIQQWQKPPI-----SLDFEIMMFSN---SGLVVRYFTIKESERYKTV 459
                  D     I    +P +     S  +E  + S    S + +R  +    +R +  
Sbjct: 380 NEEDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINIRNDSTSNPQRQQLF 439

Query: 460 KWIRYVSKSGSYEIR 474
           K ++YV+K+ +YEIR
Sbjct: 440 KGVKYVTKTSNYEIR 454

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 68/140 (48%), Gaps = 29/140 (20%)

Query: 191 LPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVT-HLSGTPVCQFGLN 249
           +PWR + + H  NE++L + E I +++  +     SY + T+ +VT ++ G  + +  LN
Sbjct: 202 VPWRMRNVDHVNNELYLDLVESIHVVLETKKR-KSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 250 DS--LSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDKD------RI 301
            +  + +K D  G+                    LE    H+CV  +  DKD      ++
Sbjct: 261 GNPIVEMKIDMAGND-------------------LESIFLHECVKSKDVDKDQEFENTKL 301

Query: 302 IKFVPPDGSMELMKYHVRSN 321
           IKF+PPDGS +L  Y++  N
Sbjct: 302 IKFLPPDGSFKLFDYNINLN 321

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 38/168 (22%)

Query: 178 SNNSSGAFNMAGEL-----PWRPKGISHKKNEIFLYVNEKISILVSKEGS---------- 222
            NNSS  F  +G +     PWR   + +  NEI++ V E+I ++  +  S          
Sbjct: 238 GNNSSSGFGNSGTINNKVVPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFN 297

Query: 223 --------ILKSYVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXX 274
                   ++++ + G +++ ++LS  P+ +  L D       +Y D             
Sbjct: 298 RNDNSPMKLIRADIIGELNVRSYLSDNPMVEVTLVDR------NYSDQKTGWSENDLFKQ 351

Query: 275 XXXGSVLLEDCKFHQCVSLE---KFDKD-RIIKFVPPDGSMELMKYHV 318
              G  +     FH CV ++     ++D R IKF+PPDG   LMKY++
Sbjct: 352 LNLGLPM-----FHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 78/184 (42%), Gaps = 42/184 (22%)

Query: 147 NFAISVQNKNSTLPKIPKFLRRT--SSFLNQESSNNSSGA----FNMAGELPWRPKGISH 200
           NFA  +   NST   I K +     +   ++ SSN+  G+     N    +PWR  G+ +
Sbjct: 157 NFARVI---NSTASSIGKTISNAEGNQMFSKHSSNSRIGSSVSYANRDRTVPWRSAGVKY 213

Query: 201 KKNEIFLYVNEKISILVSKEGSI-----LKSYVDGTIDLVTHLSGTPVCQFGLNDSLSVK 255
             NE+++ + E ++I+++K  +      +   +DG +    +LS  P+ +  LN      
Sbjct: 214 TNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVELDLN----TN 269

Query: 256 NDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFD-KDRIIKFVPPDGSMELM 314
             D G                          FH+CV  E  D     ++F+PPDG   LM
Sbjct: 270 GHDLGIP-----------------------AFHRCVRTEGSDFHPGTLRFIPPDGDFCLM 306

Query: 315 KYHV 318
           +Y++
Sbjct: 307 EYNI 310

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 56/140 (40%), Gaps = 39/140 (27%)

Query: 191 LPWRPKGISHKKNEIFLYVNEKISILVSKEG----------SILKSYVDGTIDLVTHLSG 240
           +PWR  G+ +  NE+++ + E I ++  K G           ++   ++G   +  +LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 241 TPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDK-- 298
            P         L +  +D G                          FH+CV L+      
Sbjct: 271 NPTVDL----QLDLAGNDLGVP-----------------------AFHECVELDNHQNPS 303

Query: 299 DRIIKFVPPDGSMELMKYHV 318
           +  ++F+PPDG   LM+Y +
Sbjct: 304 NCDLRFIPPDGRFNLMQYSI 323

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 57/141 (40%), Gaps = 31/141 (21%)

Query: 181 SSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGS---ILKSYVDGTIDLVTH 237
           ++G       +PWR     +  NEI++ + E ++  + ++GS   ++   + G ID+  +
Sbjct: 130 ATGKVEAGQTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCY 189

Query: 238 LSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFD 297
           LSG P  Q  L  S        G   D                   +   H+CV L +  
Sbjct: 190 LSGNPTVQLKLRTS--------GHPLD-------------------NSALHRCVELGEAG 222

Query: 298 KDRIIKFVPPDGSMELMKYHV 318
               + FVPPDG   L +Y +
Sbjct: 223 V-ATMNFVPPDGRFTLAEYAI 242

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 61/147 (41%), Gaps = 47/147 (31%)

Query: 192 PWRPKGISHKKNEIFLYVNEKISILV------------SKEG--SILKSYVDGTIDLVTH 237
           PWR + + H  NEI++ + E + ++             SK+    I+  Y+ GT  + + 
Sbjct: 202 PWRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSF 261

Query: 238 LSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFD 297
           L+G P+ +      L +  +D G                          FH+CV ++++ 
Sbjct: 262 LNGNPLVEL----QLELSGNDIGHP-----------------------SFHECVDIDEYL 294

Query: 298 KD------RIIKFVPPDGSMELMKYHV 318
           K+        +KF+PPDG   LM Y +
Sbjct: 295 KNIDNSSISSLKFIPPDGKFTLMDYTI 321

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 66/163 (40%), Gaps = 57/163 (34%)

Query: 191 LPWRPKGISHKKNEIFLYVNEKISI-----LVSKEG-------------------SILKS 226
           +PWR   I + KNE+++ + E I +     + +++G                    ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 227 YVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCK 286
           Y+ G ID+ ++L+G P+ +  LN   +  ND                        +    
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLN---TCGND------------------------MGTPS 351

Query: 287 FHQCVSLE---KFDKDRI---IKFVPPDGSMELMKYHVRSNIN 323
            H CV LE     D D++   +KF+PPDG   L +Y V  N N
Sbjct: 352 LHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARYCVDLNKN 394

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 79/205 (38%), Gaps = 67/205 (32%)

Query: 152 VQNKNSTLPKIPKFLRRTS-SFLNQES----SNNSSGAFNMA----GE---LPWRPKGIS 199
           +QN    +  + K L  T+ + +NQ S    S  S  AFN +    GE   +PWR  GI 
Sbjct: 138 IQNVVPPVHDLRKILNETAHTIMNQSSGAMRSAGSGVAFNASSSSRGEDMVVPWRRNGIK 197

Query: 200 HKKNEIFLYVNEKISILVSKEG---------------SILKSYVDGTIDLVTHLSGTPVC 244
             K E+++ + E++ +   K                  ++  ++ GTID+  +L+G P  
Sbjct: 198 DAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVRCYLNGNP-- 255

Query: 245 QFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLE---------- 294
                 ++S+  D  G+                         FH CV  E          
Sbjct: 256 ------TVSLMFDTMGNDLGIP-------------------SFHACVEQEDQVQEQKQEQ 290

Query: 295 ---KFDKDRIIKFVPPDGSMELMKY 316
               F   R+++F+PPDG   L +Y
Sbjct: 291 EPESFQGKRLLRFLPPDGKFRLAQY 315

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 68/166 (40%), Gaps = 41/166 (24%)

Query: 167 RRTSSFLNQESSNNSSGAFNM---------AGELPWRPKGISHKKNEIFLYVNEKISILV 217
           R +S+FL   +S+N +G   +         A  +PWR   +S+  NEI++ + E +++ +
Sbjct: 162 RESSNFLGSSNSSNINGGPTINRSSDSPLDAQVVPWRIPNLSNVNNEIYVDMVETLTLNL 221

Query: 218 SKEG----SILKSYVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXX 273
            +       +    + G IDL  +L G P  Q  L+ +        G +F          
Sbjct: 222 KQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQINLHSA--------GHAF---------- 263

Query: 274 XXXXGSVLLEDCKFHQCVS-LEKFDKDRIIKFVPPDGSMELMKYHV 318
                    +    H+C+           ++F+PPDG   L++Y +
Sbjct: 264 ---------KPSALHRCLDPSSSSFDSSSLRFIPPDGKFTLLEYTI 300

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/330 (19%), Positives = 135/330 (40%), Gaps = 76/330 (23%)

Query: 191 LPWRPKGISHKKNEIFLYVNEKISILVSKEG-----SILKSYVDGTIDLVTHLSGTPVCQ 245
           +PWR   + +  +EI++ + E + ++           ++   ++G +++ ++LSG P  +
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 246 FGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDKDRIIKFV 305
             ++      N+ Y  S                         HQCV + +     +  F+
Sbjct: 252 MDMD---LAGNEMYAPSM------------------------HQCVEMPQGSPSSLC-FI 283

Query: 306 PPDGSMELMKYHVRSNINLPFKV-SPIVTYS---SSGTAV---EYRITLK-SLFPSKLTA 357
           PPDG+  L+ Y +  ++N   KV SP+   S     G  +   E+ + +  S  PS    
Sbjct: 284 PPDGNCNLLNYTIDLDMNPKVKVTSPVGLVSVIYKDGLGLNRDEFEVHVNISNSPSVPHI 343

Query: 358 KNVTMKIPVPPETL-----------DCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTL 406
           +++ ++I + P              D ++D +    + +  E   +      +G  +N++
Sbjct: 344 QDLKLQIELQPRIQELEEQEEEAQRDAEMD-TEAKKERSQLEDGKIKVLRNTHGRFDNSV 402

Query: 407 ----------SAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLV----------VR 446
                     S   + S    R  ++   K P+ +    + ++N G++          VR
Sbjct: 403 HPGRGTWIFDSETPVGSLPVLRGCVED-SKHPVRIQRVGVSYANEGMLPSGIGLRRINVR 461

Query: 447 YFT-IKESERYKTV-KWIRYVSKSGSYEIR 474
             T ++E+ R K + K ++YV ++G YEIR
Sbjct: 462 STTNLRENNRGKRLFKGVKYVCRTGDYEIR 491

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 61/156 (39%), Gaps = 54/156 (34%)

Query: 192 PWR-PKGISHKKNEIFLYVNEKISILVSKEGS-------------------ILKSYVDGT 231
           PWR  K I + +NE++  V E I ++  K+ S                    ++  + G+
Sbjct: 226 PWRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISGS 285

Query: 232 IDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCV 291
           +D+   L+G P+ +  L                             G + +    FH CV
Sbjct: 286 VDMRCFLTGNPLVEIALKQ---------------------------GGLDIGIPGFHDCV 318

Query: 292 ---SLEKFDKDRIIKFVPPDGSMELMKYHVRSNINL 324
              SL K +K   + F+PPDG   LM+Y    NINL
Sbjct: 319 DKTSLLKQEKISKLSFIPPDGRFTLMQY----NINL 350

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 68/323 (21%), Positives = 125/323 (38%), Gaps = 77/323 (23%)

Query: 191 LPWRPKGIS-HKKNEIFLYVNEKISILVSKEGS---ILKSYVDGTIDLVTHLSGTPVCQF 246
           +PWR    S H+ NE++L + E   ++  K+ S   ++   + GT+D+ ++L+ TP+   
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 247 GLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEK---FDKDRIIK 303
            LN   ++ ND                        +     H+CV +     F    I  
Sbjct: 259 KLN---TMGND------------------------IGIPSLHECVEINDGGVFSPSNIT- 290

Query: 304 FVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITL---KSLFPSKLTAKNV 360
           F+PPDG   L++Y V  +++     S +   S    ++ ++  L      F   L  +N+
Sbjct: 291 FIPPDGKFRLLEYCV--DLDSQVIKSGVRMKSIGLVSLHFQNGLGKDSDEFELSLNIENL 348

Query: 361 TMKIPVPPETLDCKIDVSNGSCKFAPEEKAML-----------------WTFNKYNG--- 400
                V    LD + +V N        +  +L                 W F+K      
Sbjct: 349 KNVSQVDDLKLDLQFNVENSDSNEVAYKIKILRNTHGRFENSIIMGQGQWIFDKSTATGT 408

Query: 401 --LTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTI-------K 451
             +    +   T  S D   +++Q      +SL++  +  S SG+ V    I       K
Sbjct: 409 VPVLHGCIEYETGRSNDQKNVDLQ-----TVSLEYSYVGQSASGIYVEAIDILSGLTIGK 463

Query: 452 ESERYKTVKWIRYVSKSGSYEIR 474
            ++ YK  K   Y +++G Y++R
Sbjct: 464 NTKLYKGAK---YKTQTGDYQVR 483

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 60/135 (44%), Gaps = 35/135 (25%)

Query: 191 LPWR-PKGISHKKNEIFLYVNEKISILVSKEGSILK---SYVDGTIDLVTHLSGTPVCQF 246
           +PWR  K   H+ NE+++ + E   ++   + S L+     + GT+D+ ++L+  P+   
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 247 GLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDKDRI---IK 303
            LN   ++ ND                        +     H+CV + K D + +   I 
Sbjct: 259 KLN---TMGND------------------------IGVPTLHECVEI-KDDGEFLPSNIT 290

Query: 304 FVPPDGSMELMKYHV 318
           F+PPDG   L++Y V
Sbjct: 291 FIPPDGKFRLLEYSV 305

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 67/333 (20%), Positives = 128/333 (38%), Gaps = 97/333 (29%)

Query: 191 LPWRPKGIS-HKKNEIFLYVNEKISILVSKEGSILK---SYVDGTIDLVTHLSGTPVCQF 246
           +PWR    S H+ NE+++ + E   +++ K+ + L+     + G +D+ ++L+  P+   
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPL--- 255

Query: 247 GLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLE---KFDKDRIIK 303
                +SVK +  G+                          H+CV +    +F    I  
Sbjct: 256 -----VSVKLNTMGNEIGIP-------------------SLHECVEINDDGEFTPSNIT- 290

Query: 304 FVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITL---KSLFPSKLTAKNV 360
           F+PPDG   L++Y +  N++   K S I   S    +V ++  L      F   L  ++ 
Sbjct: 291 FIPPDGKFRLLEYSI--NLDSQLKKSGIRMNSIGMISVHFQNGLGKDSDEFELSLNVESS 348

Query: 361 TMKIPVPPETLDCKIDVSN-GSCKFAPEEKAM----------------LWTFNK------ 397
                +    LD + ++ N G    A + K +                 W F+K      
Sbjct: 349 KKVSQIEDLKLDLQFNIENTGGSDVAYKVKILRNTHGRFENSVTMGQGQWIFDKATPTGT 408

Query: 398 ---------YNGLTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYF 448
                    Y+G+  N+  ++ + +               +SLD+  +  S SG+ V   
Sbjct: 409 IPVLRGCIEYDGVQPNSTRSIDLHT---------------VSLDYSYVGQSASGISVEAI 453

Query: 449 TI-------KESERYKTVKWIRYVSKSGSYEIR 474
            I       K ++ YK  K   Y +K+G +++R
Sbjct: 454 DILSGLTIGKNTKLYKGAK---YKTKTGDFQVR 483

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 56/134 (41%), Gaps = 34/134 (25%)

Query: 191 LPWRPKGIS-HKKNEIFLYVNEKISILVSKEGS---ILKSYVDGTIDLVTHLSGTPVCQF 246
           +PWR    S H+ NE+++ + E   ++  K+ S   +L   + G +D+ ++L+  P+   
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 247 GLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEK--FDKDRIIKF 304
            LN   ++ ND                        +     H CV +    F    I  F
Sbjct: 259 KLN---TMGND------------------------IGIPSLHDCVEINDGVFSPSNIT-F 290

Query: 305 VPPDGSMELMKYHV 318
           +PPDG   L++Y V
Sbjct: 291 IPPDGKFRLLEYSV 304

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 187 MAGELPWRPKGISHKKNE--------IFLYVNEKISILVSKEGSILKSYVDGTIDLVTHL 238
           M   LP  P  +  +K+E        I + +NE I+  ++++G+I  S + G ++L  + 
Sbjct: 262 MVTRLPQAPAMVGGEKDEEEQRTNNGILITINETINAEITRDGNISSSELKGVLELRIND 321

Query: 239 SGTPVCQFGLNDSLSVKN 256
           +     Q  L DS++VK+
Sbjct: 322 ASLAHSQLALLDSINVKD 339

>Suva_5.22 Chr5 complement(40406..40864) [459 bp, 152 aa] {ON}
           YEL048C (REAL)
          Length = 152

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%), Gaps = 8/62 (12%)

Query: 293 LEKFDKDRIIKFVPPDGSMEL---MKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKS 349
           +++ DK  I+ +VP +   EL   +KY+V SNI+L +  SP++T++S  T    +  LKS
Sbjct: 11  IDELDK-PILIYVPNETENELNDVLKYNVLSNISLDYFESPLITWTSLDT----KPLLKS 65

Query: 350 LF 351
           +F
Sbjct: 66  IF 67

>KNAG0L01590 Chr12 (282307..284907) [2601 bp, 866 aa] {ON} Anc_7.251
           YER069W
          Length = 866

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 141 SKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSN 179
           S E +E FA+ ++N  S +P++ KF+   S++LN  + N
Sbjct: 405 SDEPLEAFAVVIKNGASNIPRVDKFICTDSAWLNNVTDN 443

>Ecym_1403 Chr1 complement(835068..839525) [4458 bp, 1485 aa] {ON}
            similar to Ashbya gossypii AFR460C
          Length = 1485

 Score = 32.3 bits (72), Expect = 3.8,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 3/97 (3%)

Query: 130  ATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSNNSSGAFNMAG 189
            +T +KK +V  +K     F I  ++ N    K+   +RR  SFLN           N   
Sbjct: 1218 STALKKPTVHAAK--THQFHIPTKDSNGNPLKMIPLMRRVKSFLNTTELALLRKEINKER 1275

Query: 190  ELPWRPKGIS-HKKNEIFLYVNEKISILVSKEGSILK 225
            +  WR   +  ++ N++   +N++ ++L  K  S+ K
Sbjct: 1276 KRKWREANVERNRDNDLRSRLNQRANVLFGKGDSMEK 1312

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/144 (19%), Positives = 49/144 (34%), Gaps = 43/144 (29%)

Query: 191 LPWRPKGISHKKNEIFLY------------VNEKISILVSKEGSILKSYVDGTIDLVTHL 238
           +PWR   ++ ++NE ++              +   S        ++   + G +D   +L
Sbjct: 206 VPWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCRCYL 265

Query: 239 SGTPVCQFGLNDSLSVKNDDYGDSFDYXXXXXXXXXXXXGSVLLEDCKFHQCVSLEKFDK 298
           S  P+ +   N+       D G                           H CV L+   +
Sbjct: 266 SRDPIVEVTFNN----HGCDLGTP-----------------------ALHDCVELDGVPE 298

Query: 299 D----RIIKFVPPDGSMELMKYHV 318
                  +KF+PPDG   LM+Y V
Sbjct: 299 GPADHTTLKFIPPDGKFRLMEYSV 322

>KNAG0C03960 Chr3 (776556..778622) [2067 bp, 688 aa] {ON} Anc_7.315
           YDL141W
          Length = 688

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 67/176 (38%), Gaps = 29/176 (16%)

Query: 26  RSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSNVHGDDLWLVSVTRSNINCGAVWEFL 85
           ++I ++ +      LD    ILT          +NV   +L  + V  S +N   + EF 
Sbjct: 232 KNIIELLQSHEKERLDFMRYILTKMGLNCNRDFNNVRAPNLTPIVVASSPMNTSKLIEFK 291

Query: 86  Y----------KFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGENGTPMDTDPATVIKK 135
                      + D+ +E+    +     E F  CYEL    L       D DP TV K 
Sbjct: 292 TLLQSKFPNSKQLDNSIEIKDATDYFHFFEGFERCYELAKDEL------HDQDPETVAKA 345

Query: 136 M------SVKPSKETIENFAISVQ----NKNSTLPKI---PKFLRRTSSFLNQESS 178
           +         PSKET+ NF +       N N+ L  +    + +  TSS LN   +
Sbjct: 346 VVFINENEAYPSKETLHNFDMETYFKHLNPNNNLGSLLMYSEVVTSTSSLLNNNKT 401

>KAFR0B01780 Chr2 (348976..349548) [573 bp, 190 aa] {ON} Anc_8.76
           YPL010W
          Length = 190

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 96  GLNNEEFLKEEFMVCYELLDVMLGENGTPMDTDPATVIKKMSVKPSKETI 145
           G++N+  + E   + Y L+D ++ +NG  ++TDPA++  +++ +P+ +T+
Sbjct: 114 GIDNKN-VSENCDLVYLLIDEII-DNGVILETDPASIASRVTKQPTSDTL 161

>CAGL0C00253g Chr3 complement(18884..23710) [4827 bp, 1608 aa] {ON}
            some similarities with uniprot|P08640 Saccharomyces
            cerevisiae YIR019c STA1
          Length = 1608

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 146  ENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEI 205
            EN AISVQ   STLP +       +S + + S   S G F++  +  +   G  HKK+  
Sbjct: 1537 ENSAISVQTSTSTLPNVSSKSILPTSSIQRTSQRVSEGTFSI--DTLYEASGSHHKKSTT 1594

Query: 206  FL 207
             L
Sbjct: 1595 LL 1596

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,024,735
Number of extensions: 2448568
Number of successful extensions: 7884
Number of sequences better than 10.0: 111
Number of HSP's gapped: 7852
Number of HSP's successfully gapped: 137
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)