Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0C03850g7.126ON20920910311e-144
SAKL0F05368g7.126ON2312206124e-80
TDEL0H028807.126ON3541526061e-77
Suva_9.1947.126ON2152095932e-77
Kpol_1062.577.126ON2191515932e-77
KLLA0D14333g7.126ON2052095801e-75
Smik_9.1847.126ON2142075811e-75
Skud_9.1627.126ON2172115811e-75
NDAI0H013107.126ON2611765823e-75
YIL010W (DOT5)7.126ON2152085705e-74
KAFR0K012007.126ON2022165522e-71
ZYRO0C05214g7.126ON2701475573e-71
Kwal_55.208397.126ON3051695595e-71
TBLA0A009407.126ON2881525481e-69
KNAG0G010207.126ON2072065375e-69
TPHA0C043307.126ON2092085332e-68
Ecym_83517.126ON2242185272e-67
NCAS0F008107.126ON2311475092e-64
ADL018W7.126ON2441495067e-64
KLTH0F12562g7.126ON2931624863e-60
Ecym_20553.54ON187107770.11
Kpol_1004.598.300ON176125681.9
SAKL0C06094g1.205ON28965682.1
ZYRO0F10340g8.321ON818100673.4
NDAI0D03540na 1ON110737674.2
Smik_6.3035.192ON39496656.3
TPHA0E010507.368ON59331639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C03850g
         (209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   401   e-144
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   240   4e-80
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   238   1e-77
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   233   2e-77
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   233   2e-77
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   228   1e-75
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   228   1e-75
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   228   1e-75
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   228   3e-75
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   224   5e-74
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   217   2e-71
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   219   3e-71
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   219   5e-71
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   215   1e-69
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   211   5e-69
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   209   2e-68
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   207   2e-67
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   200   2e-64
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   199   7e-64
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   191   3e-60
Ecym_2055 Chr2 complement(89845..90408) [564 bp, 187 aa] {ON} si...    34   0.11 
Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON} (12783...    31   1.9  
SAKL0C06094g Chr3 (570643..571512) [870 bp, 289 aa] {ON} similar...    31   2.1  
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...    30   3.4  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    30   4.2  
Smik_6.303 Chr6 complement(475316..476500) [1185 bp, 394 aa] {ON...    30   6.3  
TPHA0E01050 Chr5 complement(215811..217592) [1782 bp, 593 aa] {O...    29   9.9  

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  401 bits (1031), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/209 (94%), Positives = 198/209 (94%)

Query: 1   MELRRSTRLSAKHGNEVKDEGPIXXXXXXXXXXXVNTKEPVKKPNTKEEKVSSDEAILEV 60
           MELRRSTRLSAKHGNEVKDEGPI           VNTKEPVKKPNTKEEKVSSDEAILEV
Sbjct: 1   MELRRSTRLSAKHGNEVKDEGPIKKKAKSVLKEKVNTKEPVKKPNTKEEKVSSDEAILEV 60

Query: 61  GDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHG 120
           GDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHG
Sbjct: 61  GDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHG 120

Query: 121 LVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGKL 180
           LVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGKL
Sbjct: 121 LVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGKL 180

Query: 181 KFKRLKISPEISVADGKKEVLELAKQYSN 209
           KFKRLKISPEISVADGKKEVLELAKQYSN
Sbjct: 181 KFKRLKISPEISVADGKKEVLELAKQYSN 209

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  240 bits (612), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 155/220 (70%), Gaps = 15/220 (6%)

Query: 1   MELRRSTRLSAKH----GNEVKDEGP-----IXXXXXXXXXXXVNTKEPVK-KPNTKEEK 50
           +ELRRS RL+A      G +   E P     I             T++ V+ KP  K E 
Sbjct: 2   VELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSED 61

Query: 51  VSSDE-----AILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQ 105
             ++E     + LEVGDDIPD+ L+NQD KD+SLK LAK+N++++ F YPKASTPGCTRQ
Sbjct: 62  EPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQ 121

Query: 106 ACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPA 165
            CG+RDN++DLKEH  V GLS DT  AQ  F+ K SLPYDLL DP REFIG+LGAKKTP 
Sbjct: 122 VCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQ 181

Query: 166 SGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAK 205
           SG IRSH+VF++GKL+FKR+KISPE SVADGKKEVLELAK
Sbjct: 182 SGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAK 221

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  238 bits (606), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 129/152 (84%)

Query: 58  LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLK 117
           L++GD+IPD+TLQNQDGKDVSL+ +AKE+K+IIIF YPKASTPGCTRQACG+RDN+D+LK
Sbjct: 202 LDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDELK 261

Query: 118 EHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFAD 177
           EH  V GLS D  +AQ KF+ K SLP+DLLCDP R  IG LGAKKT  SG++RSH+VF D
Sbjct: 262 EHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFFD 321

Query: 178 GKLKFKRLKISPEISVADGKKEVLELAKQYSN 209
           GKLK+KR+K+SPE+S+ DGKKEVLELA    N
Sbjct: 322 GKLKYKRVKVSPEVSIQDGKKEVLELAASLQN 353

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  233 bits (593), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 150/209 (71%), Gaps = 5/209 (2%)

Query: 3   LRRSTRLSAKHGNEVKDEG----PIXXXXXXXXXXXVNTKEPVKKPNTKEEKVSSDEAIL 58
           LRRS R+ A     +++EG    P+              K  +++P  +E+  S     L
Sbjct: 5   LRRSARI-ATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGANEL 63

Query: 59  EVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKE 118
           +VGDDIPD++L N+D   VSLK +AKENK+++ F+YPKASTPGCTRQACGFRDN++DLKE
Sbjct: 64  KVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKE 123

Query: 119 HGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADG 178
           H  V GLS D+  +Q KF+ K  LPY LL DP REFIG+LGAKKTP SGSIRSHFVF DG
Sbjct: 124 HAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDG 183

Query: 179 KLKFKRLKISPEISVADGKKEVLELAKQY 207
           KL+FKR+KISPE+SV D KKEV+ELA+++
Sbjct: 184 KLRFKRVKISPEVSVGDAKKEVMELAEKF 212

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  233 bits (593), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 102/151 (67%), Positives = 128/151 (84%)

Query: 58  LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLK 117
           +E+GD+IPD+ L+NQDG  +SL+ LAK+N +++ F YP+A TPGCTRQACGFRD +DDLK
Sbjct: 68  VEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDLK 127

Query: 118 EHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFAD 177
           +H  V GLS D+  +Q KF++KYSLPYDLL DP REFIG+LGAKKTP SG IRSHF+F D
Sbjct: 128 KHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFVD 187

Query: 178 GKLKFKRLKISPEISVADGKKEVLELAKQYS 208
           GKL+FKR+KISPEISV DGKKEVLE+ +++S
Sbjct: 188 GKLRFKRIKISPEISVNDGKKEVLEIVEEFS 218

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  228 bits (580), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 112/209 (53%), Positives = 147/209 (70%), Gaps = 11/209 (5%)

Query: 1   MELRRSTRLSAKHGNEVKDEGPIXXXXXXXXXXXVNTKEPVKKPNTKEEKVSSDEAI--- 57
           +ELRRS R+SAK       + P+             T+  V KPN K+E  + D A    
Sbjct: 2   VELRRSNRISAK-------KEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLA 54

Query: 58  -LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDL 116
            L++GDDIPD+TL NQD + +SLK +A +NK+++ F YPKASTPGCTRQACG+RDN+ +L
Sbjct: 55  ELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSEL 114

Query: 117 KEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFA 176
           KEH  V GLS D P +Q  F+ K +LP+DLL DP REFIG LGAKKT  SG +RSH++F 
Sbjct: 115 KEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFK 174

Query: 177 DGKLKFKRLKISPEISVADGKKEVLELAK 205
           +GKL+ KR+++SPE+S+ +GKKEVLELAK
Sbjct: 175 NGKLEVKRVQVSPEVSIEEGKKEVLELAK 203

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  228 bits (581), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 148/207 (71%), Gaps = 3/207 (1%)

Query: 3   LRRSTRLSAKHGNEVKDEG---PIXXXXXXXXXXXVNTKEPVKKPNTKEEKVSSDEAILE 59
           LRRSTR++A   +   +E    PI            + K  V +   + +  +S    L+
Sbjct: 5   LRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTSTELK 64

Query: 60  VGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEH 119
           +GD IPD++L ++D   +SLK +A+ENK+++ F+YPKASTPGCTRQACGFRDN+DDLK+H
Sbjct: 65  IGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDLKKH 124

Query: 120 GLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGK 179
             V GLS D+  +Q +F+ K +LPY LL DP REFIG+LGAKKTP SGSIRSHFVF DGK
Sbjct: 125 SAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGK 184

Query: 180 LKFKRLKISPEISVADGKKEVLELAKQ 206
           L+FKR+KISPE+SV D KKE+LELA++
Sbjct: 185 LRFKRVKISPEVSVNDAKKEILELAEK 211

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  228 bits (581), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 116/211 (54%), Positives = 147/211 (69%), Gaps = 11/211 (5%)

Query: 3   LRRSTRLSA-------KHGNEVKDEGPIXXXXXXXXXXXVNTKEPVKKPNTKEEKVSSDE 55
           LRRSTR++A       +    V    P            V T EPVK     E+   S  
Sbjct: 5   LRRSTRIAASKRLLEDEESKLVPISPPEVPKKKVKTAPKVKTSEPVKS----EDDSLSAA 60

Query: 56  AILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDD 115
             LE+GD IPD++L ++D   +SLK +AKENK+++ F+YPKASTPGCTRQACGFRDN++D
Sbjct: 61  TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120

Query: 116 LKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVF 175
           LK+H  V GLS D   +Q KF+ K +LPY L+ DP REFIG+LGAKKTP SGSIRSHFVF
Sbjct: 121 LKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 176 ADGKLKFKRLKISPEISVADGKKEVLELAKQ 206
            +GKL+FKR+KISPE+SV+D KKEVLE+A++
Sbjct: 181 VNGKLRFKRIKISPEVSVSDAKKEVLEIAER 211

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  228 bits (582), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 107/176 (60%), Positives = 139/176 (78%), Gaps = 6/176 (3%)

Query: 39  EPVKKPNTKEEKVSSDEAI------LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIF 92
           E VKK    E++VS   A       LE+GDDIPDITL NQ+GK++SLK +AK NK+I+IF
Sbjct: 84  EEVKKVKFDEQQVSDKSANNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIF 143

Query: 93  LYPKASTPGCTRQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTR 152
            +P+ASTPGCTRQACGFRDN+D+LK++ +V GLS D  ++Q KF+EK  LPYDLL DP R
Sbjct: 144 AFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKR 203

Query: 153 EFIGMLGAKKTPASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAKQYS 208
           + IG+LGAKKTP SG++RS+++F +GKL  KR+K+SPEISVA+ KKEV+E AK+ S
Sbjct: 204 QLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKLS 259

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  224 bits (570), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 110/208 (52%), Positives = 144/208 (69%), Gaps = 3/208 (1%)

Query: 3   LRRSTRLSAKHGNEVKDE---GPIXXXXXXXXXXXVNTKEPVKKPNTKEEKVSSDEAILE 59
           LRRSTR++       ++E    PI              K    +   +E   SSD   LE
Sbjct: 5   LRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDVNELE 64

Query: 60  VGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEH 119
           +GD IPD++L N+D   +SLK + + N+V++ F+YP+ASTPGCTRQACGFRDN+ +LK++
Sbjct: 65  IGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQELKKY 124

Query: 120 GLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGK 179
             V GLS D+  +Q KF+ K +LPY LL DP REFIG+LGAKKTP SGSIRSHF+F DGK
Sbjct: 125 AAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIFVDGK 184

Query: 180 LKFKRLKISPEISVADGKKEVLELAKQY 207
           LKFKR+KISPE+SV D KKEVLE+A+++
Sbjct: 185 LKFKRVKISPEVSVNDAKKEVLEVAEKF 212

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  217 bits (552), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 110/216 (50%), Positives = 152/216 (70%), Gaps = 23/216 (10%)

Query: 1   MELRRSTRLSAKHGNE-VKDEGPIXXXXXXXXXXXVNTKEPVKKPN---TKEEKVSSDEA 56
           M+LR STR+ AK   E ++D+                 + P KK     +KEE V S   
Sbjct: 1   MQLRNSTRIKAKVLFEDIEDD---------------KERRPEKKRRVTISKEETVESSGN 45

Query: 57  I----LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDN 112
           +    L++GD +PDITL NQD + +SL+ +AK NK++++F YPKASTPGCTRQACGFRDN
Sbjct: 46  VSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDN 105

Query: 113 FDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSH 172
           +D++K+H  V GLS D+  +Q +F+EK +LP++LL DP RE IG+LGAKKTP SG IRSH
Sbjct: 106 YDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSH 165

Query: 173 FVFADGKLKFKRLKISPEISVADGKKEVLELAKQYS 208
           +VF DGKL+F+ +K+SPE S+++ KKEV+ELA++ S
Sbjct: 166 WVFLDGKLRFRNIKVSPERSISESKKEVMELAEKNS 201

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  219 bits (557), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 123/147 (83%)

Query: 61  GDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHG 120
           GD IPDI L+NQDGK++SLK ++ E+K+++IF YPKASTPGCTRQACGFRDN++D+KEH 
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 121 LVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGKL 180
            V GLS DT  AQ KF+EK  LP+DLL DP R  +G+LGAKK+P SG IRSH+VFADG L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 181 KFKRLKISPEISVADGKKEVLELAKQY 207
           K KR+KISPE+S+ +GKKEVLEL KQ+
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQF 241

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  219 bits (559), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 135/169 (79%), Gaps = 3/169 (1%)

Query: 38  KEP-VKKPNTKEEKVSSDEAILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPK 96
           KEP VKKP T +   SS +  LEVGD++PD+ L+NQD ++VSLK +A+ENKV+IIF YPK
Sbjct: 27  KEPEVKKPKTAKSSDSS-QGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPK 85

Query: 97  ASTPGCTRQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIG 156
           ASTPGCT QACGFRDN++DLKE G V GLS DTPAAQ KF++ +SLP+DLL DP RE IG
Sbjct: 86  ASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIG 145

Query: 157 MLGAKKTPASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAK 205
           +LGAKK+P SG+ RSH+VFA+GKL  KR+ +SPE+S+ D K E  E AK
Sbjct: 146 LLGAKKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTEAHEAAK 193

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  215 bits (548), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 124/152 (81%)

Query: 58  LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLK 117
           LEVGD++PD  L+NQ+ + +SLK + +EN++++IF YPKA+TPGCTRQACG RDN++DLK
Sbjct: 127 LEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDLK 186

Query: 118 EHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFAD 177
           ++ +V G+S D+ +AQ  F+EK +LPYDLL D  RE IG LG KKTP SG IRSHF+  +
Sbjct: 187 KYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIVN 246

Query: 178 GKLKFKRLKISPEISVADGKKEVLELAKQYSN 209
           GKLKFKR+KISPE+SV+D KKEVLE++K  S+
Sbjct: 247 GKLKFKRVKISPEVSVSDCKKEVLEISKSESD 278

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  211 bits (537), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 105/206 (50%), Positives = 142/206 (68%), Gaps = 1/206 (0%)

Query: 1   MELRRSTRLSAKHGNEVKDEGPIXXXXXXXXXXXVNTKEPVKKPNTKEEKVSSDEAILEV 60
           +ELR+S R+ A    +     P              + + VK     E+K   D  +LE+
Sbjct: 2   VELRKSARV-ANIKKQTTLTTPATSNKIVKKTSNAASHKKVKIVAETEDKPLVDAKVLEI 60

Query: 61  GDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHG 120
           GD+IPD+TL +Q+G+ VSL  +A  NK+++IF YP+ASTPGCTRQACGFRDN+ +LK+H 
Sbjct: 61  GDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDNYAELKKHA 120

Query: 121 LVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGKL 180
            V GLS DT A+Q KF+ K +LPY+LL DP REFIG+LGAKKT  SG IRS+++F +GKL
Sbjct: 121 AVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSYWIFFNGKL 180

Query: 181 KFKRLKISPEISVADGKKEVLELAKQ 206
           + K++K+SPE SVA+ K EVLEL K+
Sbjct: 181 RIKKIKVSPEASVAESKAEVLELVKE 206

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  209 bits (533), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 147/208 (70%), Gaps = 5/208 (2%)

Query: 2   ELRRSTRLSAK---HGNEVKDEGPIXXXXXXXXXXXVNTKEPVKKPNTKEEKVSSDEAIL 58
           E+RRS+R++ K   H  +VK E                      + + KE +    E I 
Sbjct: 3   EVRRSSRIANKKIIHQADVKAEHSSKVSKKAKTTVKKTLSVSKIETDLKETQKDDYEEI- 61

Query: 59  EVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKE 118
           +VGD+IPD+TL+NQ+G+++SL+ LA++NK+I IF+YP+ASTPGCTRQACGFRDNFDDLK+
Sbjct: 62  QVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDLKK 121

Query: 119 HGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADG 178
           + L+LGLS D+  AQ  FK K +LPYDLLCD  ++ I +LG KK P SG IRS+F+F DG
Sbjct: 122 YSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFVDG 180

Query: 179 KLKFKRLKISPEISVADGKKEVLELAKQ 206
           KLK KR+K+SPE+S+ + KKE+L+L K+
Sbjct: 181 KLKLKRVKVSPEVSITESKKEILDLVKE 208

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  207 bits (527), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 146/218 (66%), Gaps = 15/218 (6%)

Query: 2   ELRRSTRLSAKHGNEVKDEGPIXXXXXXXXXXXVNTKEPVKKPNT-------------KE 48
           ELRRSTRL+ +  NE K E                     KK N              K 
Sbjct: 4   ELRRSTRLATRKANE-KPEFEEIRFSQKKIKTSSGVSGVKKKSNNGGSVGVLKADSVLKS 62

Query: 49  EKVSSDEAILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACG 108
           EKV   +  LEVGD++P+I L+NQD K+V+LK +AK+NK+++IF YPKA+TPGCTRQACG
Sbjct: 63  EKVGGPKE-LEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQACG 121

Query: 109 FRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGS 168
           FRDN+++L++H ++ G+S D+  +Q  F+ K  LP+DLL DP RE IGMLGAKKT  +G 
Sbjct: 122 FRDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQAGV 181

Query: 169 IRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAKQ 206
           IRSH++F +GKLK+KR+K+SPE S+++G +EVL L K+
Sbjct: 182 IRSHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIKK 219

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  200 bits (509), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 91/147 (61%), Positives = 115/147 (78%)

Query: 58  LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLK 117
           L++GDDIPDI L +++G  VSLK + +ENK+++ F +PKA+TPGCTRQACGFRDN+ +LK
Sbjct: 83  LQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELK 142

Query: 118 EHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFAD 177
           EH  V G+S D   AQ KFK K +LPY LL D  R+FIG+LGAKKTP SG IRS+F+F D
Sbjct: 143 EHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVD 202

Query: 178 GKLKFKRLKISPEISVADGKKEVLELA 204
           GKLK KR+KISPE+SV + +KEV   A
Sbjct: 203 GKLKVKRVKISPELSVEEARKEVSAFA 229

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  199 bits (506), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 89/149 (59%), Positives = 117/149 (78%)

Query: 58  LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLK 117
           L+VGD +P+ITL+NQD  DV L  + K+NK++++F YPKASTPGCTRQACGFRDN+ +L+
Sbjct: 87  LQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQ 146

Query: 118 EHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFAD 177
           +H +V G+S D+  +Q  F++K  LP+DLL DP RE IG LGA+KT  +G IRSH+VF D
Sbjct: 147 KHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFVD 206

Query: 178 GKLKFKRLKISPEISVADGKKEVLELAKQ 206
           GKL  KR+KISPE+S+ADG  EVL  AK+
Sbjct: 207 GKLGSKRIKISPEMSIADGLSEVLLFAKK 235

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  191 bits (486), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 129/162 (79%), Gaps = 1/162 (0%)

Query: 44  PNTKEEKVSSDEAILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCT 103
           P TK+ K +  +  LE GD++PD+ L+NQ+G++VSLK++ ++NKV+++F YPKASTPGCT
Sbjct: 30  PETKKAKTNGSKGELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCT 89

Query: 104 RQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKT 163
           +QACGFRDN+++LK++  V GLS DTP AQ KFKEK SLP+DLL DP R+ IG LGA K+
Sbjct: 90  KQACGFRDNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKS 149

Query: 164 PASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAK 205
           P SG+ RS++VF  GKL+ KR+ +SPE SV++ KKE +E A+
Sbjct: 150 P-SGTKRSYWVFVQGKLRTKRISVSPEASVSEAKKEAIEAAQ 190

>Ecym_2055 Chr2 complement(89845..90408) [564 bp, 187 aa] {ON}
           similar to Ashbya gossypii ADL154C
          Length = 187

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 9/107 (8%)

Query: 56  AILEVGDDIPDI---TLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTR-QACGFRD 111
           A+ ++GD IP       ++  G DV +       K II+ + P A +P C+     GF +
Sbjct: 27  ALFKIGDTIPTGLKGIYESSPGNDVDIGKEVTNGKFIIVGV-PAAFSPACSSAHVPGFIN 85

Query: 112 NFDDLKEHGL--VLGLSHDTPAAQLKFKEKYSLPYDL--LCDPTREF 154
             DD K  G+  VL    + P     +  + + P DL  L D   EF
Sbjct: 86  LLDDFKAKGISQVLITCVNDPFVTKAWASQLNCPPDLRILADTQGEF 132

>Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON}
           (127836..128366) [531 nt, 177 aa]
          Length = 176

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 51/125 (40%), Gaps = 13/125 (10%)

Query: 71  NQDG----KDVSLKALAKENKVIIIFLYPKASTPGCT-RQACGFRDNFDD-LKEHGLVLG 124
           NQD       +      KENK I+I   P A +P C+     G+ +  D+ LK+   ++ 
Sbjct: 29  NQDACKMPVTIDWTQFVKENKTIVITGAPAAFSPTCSISHIPGYLEKKDELLKKADQIIV 88

Query: 125 LSHDTPAAQLKFKEKYSLP----YDLLCDPTREFIGMLGAKKTPASG---SIRSHFVFAD 177
           L+ D P AQ  +  +  +          D    FI  LG +    +G   S R   V  D
Sbjct: 89  LTVDNPFAQQAWARQLGVTDTTKLKFASDAGAHFIKSLGLELDVGNGVFWSGRWALVVKD 148

Query: 178 GKLKF 182
           G + +
Sbjct: 149 GIVTY 153

>SAKL0C06094g Chr3 (570643..571512) [870 bp, 289 aa] {ON} similar to
           uniprot|P47008 Saccharomyces cerevisiae YJL145W SFH5
           putative phosphatidylinositol transfer protein
          Length = 289

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 13/65 (20%)

Query: 100 PGCTRQACGFRDNFDDLKEHGLVLGLSHDTPAAQ---LKFKEKYSLPYDL----LCDPT- 151
           PG  +  C     +D+L  H ++ G  +D P AQ    KF + YS  Y+     LCD   
Sbjct: 20  PGLVKDRC---QGYDELYGHQIIPGEYYDEPVAQALVYKFCKAYSFQYEEAVANLCDTLN 76

Query: 152 --REF 154
             REF
Sbjct: 77  WRREF 81

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score = 30.4 bits (67), Expect = 3.4,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 42/100 (42%), Gaps = 11/100 (11%)

Query: 67  ITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHGLVLGLS 126
           +TL  QDG+    +A  ++  VI  F    A+T G T Q  G R   D  +         
Sbjct: 637 LTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARAR------- 689

Query: 127 HDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPAS 166
               AA   + ++  L YD     TRE++    A+  PAS
Sbjct: 690 ----AALQHWVQEGVLYYDGNAYKTREYLDDQPAENLPAS 725

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON}
           
          Length = 1107

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 164 PASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEV 200
           P  G+I++ F   DG L FKR   SPE S  +  KEV
Sbjct: 154 PELGTIKAPFAAFDGNLPFKRGPSSPENSSKNDCKEV 190

>Smik_6.303 Chr6 complement(475316..476500) [1185 bp, 394 aa] {ON}
           YGR185C (REAL)
          Length = 394

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 19/96 (19%)

Query: 115 DLKEHGLVLGLSH-DTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHF 173
           +++E+GL+  + +   P  +LKF   +   ++   D   +F G +  K            
Sbjct: 259 NVEENGLLSFVQYVIAPIQELKFGANH---FEFFIDRPEKFGGPMTYKS----------- 304

Query: 174 VFADGKLKFKRLKISP---EISVADGKKEVLELAKQ 206
            F D KL FK  K+SP   +I VAD   E+LE  +Q
Sbjct: 305 -FEDMKLAFKEEKLSPPDLKIGVADAINELLEPIRQ 339

>TPHA0E01050 Chr5 complement(215811..217592) [1782 bp, 593 aa] {ON}
           Anc_7.368 YER087W
          Length = 593

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 68  TLQNQDGKDVSLK-ALAKENKVIIIFLYPKA 97
           T  N+  KDVS+K +L+K+N  +I F YPK+
Sbjct: 262 TNDNKAVKDVSVKYSLSKDNSTLIAFYYPKS 292

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,963,939
Number of extensions: 935180
Number of successful extensions: 1766
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1760
Number of HSP's successfully gapped: 30
Length of query: 209
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 104
Effective length of database: 41,441,469
Effective search space: 4309912776
Effective search space used: 4309912776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)