Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B03641g6.16ON98898847510.0
NDAI0D008706.16ON106995620810.0
NCAS0H008806.16ON100493320190.0
Smik_5.266.16ON100265515190.0
YEL061C (CIN8)6.16ON100065514810.0
Skud_5.286.16ON99865514690.0
TDEL0G045306.16ON95858314340.0
Suva_5.66.16ON99961614360.0
ZYRO0C07898g6.16ON97459414111e-179
KAFR0L003706.16ON96362513551e-171
Kpol_1032.66.16ON100460613101e-164
SAKL0E01078g6.16ON94865313041e-163
Kpol_1045.736.16ON96286212671e-158
Kwal_56.224036.16ON94365712461e-155
KLLA0D01045g6.16ON96555512011e-148
Ecym_30206.16ON94459011941e-147
TPHA0M002406.16ON93958511901e-147
KLTH0C11330g6.16ON94165811861e-146
ACR010C6.16ON94558911751e-145
KNAG0M011306.16ON95062011701e-144
TBLA0A072306.16ON109763411621e-141
TPHA0J003006.16ON98292310041e-119
ACR228C7.387ON11292755922e-62
SAKL0F12298g7.387ON11122255913e-62
Ecym_46887.387ON11342825913e-62
TPHA0E008907.387ON12322145782e-60
Smik_2.537.387ON11132195762e-60
Suva_2.547.387ON11102195753e-60
YBL063W (KIP1)7.387ON11112255753e-60
Skud_2.417.387ON11102165745e-60
TDEL0C016007.387ON11052145682e-59
NDAI0E043007.387ON11862205665e-59
KAFR0L017107.387ON11512195649e-59
NCAS0E026407.387ON11022205593e-58
ZYRO0B03234g7.387ON11382405585e-58
TBLA0D006407.387ON11422774232e-41
KLTH0G03850g5.531ON4731753362e-32
SAKL0G05016g5.531ON5041773329e-32
Kwal_47.186085.531ON4791773221e-30
KLLA0B00759g5.531ON4562203167e-30
SAKL0G18920g2.633ON6491773155e-29
Ecym_34152.633ON6623053058e-28
ADR145C2.633ON6351382978e-27
Ecym_40665.531ON4781722812e-25
Smik_7.483.528ON8051802773e-24
Skud_7.533.528ON8051802774e-24
KLTH0G01606g3.528ON8191442755e-24
TDEL0D059603.528ON7331442746e-24
Kwal_47.190933.528ON8191792739e-24
ZYRO0E08668g3.528ON7781792721e-23
KAFR0F042103.528ON6721782711e-23
ZYRO0D12650g5.531ON4781732671e-23
TBLA0C039403.479ON7391822712e-23
NCAS0E005503.528ON7841452712e-23
Suva_7.443.528ON8051802712e-23
CAGL0D04994g3.479ON6921382702e-23
SAKL0F01760g3.528ON8091432693e-23
YGL216W (KIP3)3.528ON8051802693e-23
NDAI0I029603.528ON8681842693e-23
CAGL0I07029g3.528ON7051802684e-23
KNAG0B005203.528ON7231442684e-23
Kpol_1004.255.531ON5061922635e-23
AER441C3.528ON8181432667e-23
Ecym_12003.528ON8331432668e-23
TPHA0D034803.528ON8471792651e-22
TBLA0C053103.479ON6761782631e-22
Kpol_423.83.528ON8061462641e-22
KNAG0A078803.479ON7641372632e-22
TBLA0C049603.528ON8011862612e-22
Kpol_505.393.479ON6921392594e-22
TDEL0F036403.479ON7041392594e-22
KAFR0B065903.479ON7061402586e-22
KLLA0B10956g3.479ON6901372551e-21
NCAS0F034703.479ON6981392551e-21
KLLA0A01606g3.528ON7691452551e-21
SAKL0F03168g3.479ON7061352542e-21
TPHA0D032003.479ON7241402532e-21
NDAI0B057703.479ON7631442523e-21
Kpol_1050.1033.479ON6971342496e-21
Ecym_44073.479ON7111662488e-21
AGR253W3.479ON7091702488e-21
YPR141C (KAR3)3.479ON7291352489e-21
Suva_16.4693.479ON7311352471e-20
Skud_16.4353.479ON7291342461e-20
Smik_16.3883.479ON7291342461e-20
ZYRO0B04290g3.479ON7311432462e-20
KLTH0F14498g3.479ON7021732424e-20
KLLA0D05951g8.678ON6681392381e-19
Kpol_1013.78.678ON6201432334e-19
SAKL0H06490g8.678ON6571402319e-19
ZYRO0F07414g8.678ON6541782301e-18
KAFR0H024108.678ON6581572255e-18
NCAS0C013508.678ON6551822255e-18
TPHA0D012708.678ON6961532211e-17
NDAI0E02090singletonON6851612174e-17
Skud_16.1278.678ON7061652157e-17
TBLA0C018808.678ON4681382128e-17
CAGL0M02189g8.678ON6721572148e-17
Kwal_26.88068.678ON7151682131e-16
YPL155C (KIP2)8.678ON7062002131e-16
KLTH0D11286g8.678ON6781082122e-16
KNAG0J017208.678ON6251472112e-16
TPHA0D041903.479ON6721312112e-16
Kwal_55.21164singletonOFF5881752103e-16
Kwal_YGOB_55.211643.479ON6571752093e-16
TDEL0B072702.633ON6441792094e-16
ACR145W8.678ON6851702068e-16
Smik_6.3528.678ON7151722032e-15
TDEL0A062408.678ON6371091996e-15
Ecym_23958.678ON6871841961e-14
Suva_11.1452.633ON6571881835e-13
Skud_11.1482.633ON6561331835e-13
YKL079W (SMY1)2.633ON6561291835e-13
Suva_16.1558.678ON7041101801e-12
Kpol_1019.112.633ON6471501754e-12
Smik_11.1602.633ON6561471721e-11
TPHA0N016502.633ON6822121568e-10
KNAG0M025402.633ON5221081478e-09
TBLA0C008002.633ON6931901433e-08
NCAS0H031802.633ON6601051407e-08
ZYRO0E01078g2.633ON6681081343e-07
NDAI0C004802.633ON5981401343e-07
TBLA0A008202.633ON8031331202e-05
KNAG0H003602.633ON6811471183e-05
CAGL0L05104g2.633ON675671102e-04
KAFR0C040202.633ON6671731093e-04
NCAS0C052002.633ON57268940.019
Suva_13.4248.779ON46958850.19
TDEL0A054908.604ON781133810.57
SAKL0E02486g2.492ON72533810.65
SAKL0H13574g8.402ON668135790.97
Suva_8.434na 1ON525141781.3
NCAS0C028308.401ON87472762.7
Suva_13.2572.492ON73854753.1
YIL149C (MLP2)5.702ON1679140753.4
NCAS0A025504.268ON71277753.7
Kpol_1036.43.248ON22646716.4
Skud_8.785.267ON1927135736.8
YMR078C (CTF18)2.492ON74145718.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03641g
         (988 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...  1834   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   806   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   782   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   589   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   575   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   570   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   556   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   557   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   548   e-179
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   526   e-171
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   509   e-164
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   506   e-163
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   492   e-158
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   484   e-155
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   467   e-148
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   464   e-147
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   462   e-147
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   461   e-146
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   457   e-145
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   455   e-144
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   452   e-141
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   391   e-119
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   232   2e-62
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   232   3e-62
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   232   3e-62
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   227   2e-60
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   226   2e-60
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   226   3e-60
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   226   3e-60
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   225   5e-60
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   223   2e-59
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   222   5e-59
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   221   9e-59
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   219   3e-58
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   219   5e-58
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   167   2e-41
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   134   2e-32
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   132   9e-32
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   128   1e-30
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   126   7e-30
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   125   5e-29
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   122   8e-28
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   119   8e-27
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   112   2e-25
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   111   3e-24
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   111   4e-24
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   110   5e-24
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   110   6e-24
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   109   9e-24
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   109   1e-23
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   108   1e-23
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   107   1e-23
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   108   2e-23
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   108   2e-23
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   108   2e-23
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   108   2e-23
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   108   3e-23
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   108   3e-23
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   108   3e-23
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   107   4e-23
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   107   4e-23
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   105   5e-23
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   107   7e-23
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   107   8e-23
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   106   1e-22
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   105   1e-22
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   106   1e-22
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   105   2e-22
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   105   2e-22
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   104   4e-22
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   104   4e-22
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   103   6e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   102   1e-21
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   102   1e-21
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   102   1e-21
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   102   2e-21
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   102   2e-21
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   101   3e-21
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   100   6e-21
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   100   8e-21
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   100   8e-21
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   100   9e-21
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   100   1e-20
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...    99   1e-20
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...    99   1e-20
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...    99   2e-20
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...    98   4e-20
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...    96   1e-19
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....    94   4e-19
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...    94   9e-19
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...    93   1e-18
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...    91   5e-18
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...    91   5e-18
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...    90   1e-17
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    88   4e-17
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    87   7e-17
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    86   8e-17
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    87   8e-17
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...    87   1e-16
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    87   1e-16
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    86   2e-16
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    86   2e-16
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    86   2e-16
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    86   3e-16
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    85   3e-16
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    85   4e-16
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    84   8e-16
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    83   2e-15
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    81   6e-15
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    80   1e-14
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    75   5e-13
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    75   5e-13
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    75   5e-13
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    74   1e-12
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    72   4e-12
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    71   1e-11
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    65   8e-10
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    61   8e-09
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    60   3e-08
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     59   7e-08
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    56   3e-07
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    56   3e-07
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    51   2e-05
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    50   3e-05
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    47   2e-04
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    47   3e-04
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    41   0.019
Suva_13.424 Chr13 complement(729834..731243) [1410 bp, 469 aa] {...    37   0.19 
TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.6...    36   0.57 
SAKL0E02486g Chr5 complement(196218..198395) [2178 bp, 725 aa] {...    36   0.65 
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...    35   0.97 
Suva_8.434 Chr8 (783961..785538) [1578 bp, 525 aa] {ON} YOR377W ...    35   1.3  
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     34   2.7  
Suva_13.257 Chr13 complement(404214..406430) [2217 bp, 738 aa] {...    33   3.1  
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    33   3.4  
NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {O...    33   3.7  
Kpol_1036.4 s1036 (12112..12792) [681 bp, 226 aa] {ON} (12112..1...    32   6.4  
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    33   6.8  
YMR078C Chr13 complement(422503..424728) [2226 bp, 741 aa] {ON} ...    32   8.5  

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score = 1834 bits (4751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 907/988 (91%), Positives = 907/988 (91%)

Query: 1   MVVTTEAVTSRSERDAEPVQEPLVEKLATEELNILVAVRCRGRNEREIKAKSSVVVDVPD 60
           MVVTTEAVTSRSERDAEPVQEPLVEKLATEELNILVAVRCRGRNEREIKAKSSVVVDVPD
Sbjct: 1   MVVTTEAVTSRSERDAEPVQEPLVEKLATEELNILVAVRCRGRNEREIKAKSSVVVDVPD 60

Query: 61  NGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCT 120
           NGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCT
Sbjct: 61  NGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCT 120

Query: 121 ILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVEL 180
           ILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVEL
Sbjct: 121 ILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVEL 180

Query: 181 YNEELKDLLDSTNTATNSDNKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQM 240
           YNEELKDLLDSTNTATNSDNKKLRIFD                              AQM
Sbjct: 181 YNEELKDLLDSTNTATNSDNKKLRIFDSNVNGTSASGSSSRSSSRNNSPRSAPDNSRAQM 240

Query: 241 LRRKLGRHNTTGNSKISNNNHNKFSRFKQTSQESTRAHASXXXXXXXXXXXXXXXXXXXX 300
           LRRKLGRHNTTGNSKISNNNHNKFSRFKQTSQESTRAHAS                    
Sbjct: 241 LRRKLGRHNTTGNSKISNNNHNKFSRFKQTSQESTRAHASNNHQNVHIPNNNSNNTNQQQ 300

Query: 301 XXXDQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYK 360
              DQSASIYIQNLEEFHITSAME             VASTKMNDFSSRSHSIFTITLYK
Sbjct: 301 SPIDQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYK 360

Query: 361 EQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHI 420
           EQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHI
Sbjct: 361 EQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHI 420

Query: 421 PFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFI 480
           PFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFI
Sbjct: 421 PFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFI 480

Query: 481 MKDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESL 540
           MKDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESL
Sbjct: 481 MKDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESL 540

Query: 541 TAQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGAN 600
           TAQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGAN
Sbjct: 541 TAQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGAN 600

Query: 601 EEMKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMR 660
           EEMKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMR
Sbjct: 601 EEMKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMR 660

Query: 661 LXXXXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETL 720
           L               SKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETL
Sbjct: 661 LEKEVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETL 720

Query: 721 SDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQEN 780
           SDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQEN
Sbjct: 721 SDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQEN 780

Query: 781 KRHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRD 840
           KRHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRD
Sbjct: 781 KRHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRD 840

Query: 841 VVSSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTET 900
           VVSSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTET
Sbjct: 841 VVSSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTET 900

Query: 901 ATTSIGSVNKVEGNLKVIMDKVLNDPQLSRGKAEVPDEELHRLEKIPLGITNKENVVDLQ 960
           ATTSIGSVNKVEGNLKVIMDKVLNDPQLSRGKAEVPDEELHRLEKIPLGITNKENVVDLQ
Sbjct: 901 ATTSIGSVNKVEGNLKVIMDKVLNDPQLSRGKAEVPDEELHRLEKIPLGITNKENVVDLQ 960

Query: 961 HRYPALQEKRKPEDEVLLQAKLQRRNPD 988
           HRYPALQEKRKPEDEVLLQAKLQRRNPD
Sbjct: 961 HRYPALQEKRKPEDEVLLQAKLQRRNPD 988

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/956 (46%), Positives = 616/956 (64%), Gaps = 40/956 (4%)

Query: 13  ERDAEPVQEPLVEKLATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTT 72
           E+  +  ++P   +   EELNI VAVRCRGRNEREIK KSSV+V VPD   +NEVSINTT
Sbjct: 33  EQQKQSRRDPKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTT 92

Query: 73  DDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKT 132
           DDVGI A+MNSKTYTVDKVFGPSA+Q+L+++E+AEPLF DFIKGYNCT+LVYGMTSTGKT
Sbjct: 93  DDVGITAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKT 152

Query: 133 YTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLD-- 190
           YTMTGDEKL+NGEL ++AGIIPR+LF+LFDTLE N++DY+VKCSF+ELYNE+LKDLL+  
Sbjct: 153 YTMTGDEKLYNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDN 212

Query: 191 -STNTATNSDNKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA--------QML 241
            ++   + S+  KLRIFD                                         L
Sbjct: 213 NNSINNSKSNINKLRIFDSSTASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYL 272

Query: 242 RRKL--GRHNTTGNSKISNNNHNKFSR------FKQTSQESTRAHASXXXXXXXXXXXXX 293
           RRKL   R++   NS I  +N +   +      F   S+  T ++ +             
Sbjct: 273 RRKLKSSRYSNPENSNIFTSNASSSVKNMTKNSFLSNSKNQT-SNLNTNSNTRTNPPKLP 331

Query: 294 XXXXXXXXXXDQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSI 353
                     D +  IYIQNL+EFHI++A E             VASTKMNDFSSRSH+I
Sbjct: 332 TSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTI 391

Query: 354 FTITLYKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSL 413
           FTITLYKE  G LFR+SKMNLVDLAGSENI+RSGA+NQRAKE GSINQSLLTLGRVINSL
Sbjct: 392 FTITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSL 451

Query: 414 ADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
           AD++ HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNK
Sbjct: 452 ADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 511

Query: 474 PQLGAFIMKDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEES 533
           PQLG+ I KDIL+++IT+EL+++KSDLLSTKSKEG+YMS EHY+ L  +++ +KTE +ES
Sbjct: 512 PQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADES 571

Query: 534 KRAIESLTAQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLL 593
           KR IE L++QNA+L +++ +  + N   +  ++  +D++  LQ  ++ Q  KE  + S +
Sbjct: 572 KRIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSV 631

Query: 594 KDVQGANEEMKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTE 653
             +Q + +  KK I  +E +Q +++  I   + D++ ++R+ L+ H   ++      D +
Sbjct: 632 SKLQTSCDTFKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFD 691

Query: 654 ISGNLMRLXXXXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENH 713
           I  NL  +                K+Y + ++  LK+TP  F+ +   +++I+   + +H
Sbjct: 692 IGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHH 751

Query: 714 SKIAETLSDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMML 773
           + +A+ LSD+SEEYNNLKQYL  N F+NNHE+L++ H+ +T   L  ++  L   F  M+
Sbjct: 752 AAVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMM 811

Query: 774 DKHIQENKRHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGS 833
           +KH++ N+  ML +    TDEVIN E+++F  ++ KWE+S  LINQCDS+N+ F +    
Sbjct: 812 NKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQK---- 867

Query: 834 NLVEIRDVVSSSRDNIGATISSI-QSRTR------------NRQSIEEMIQGNDVIRQQI 880
              E+ D +S +R  I A+I+ +  + TR            N  + + +++ N +IR Q 
Sbjct: 868 ---EVTDGLSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQF 924

Query: 881 TRIKQKNKSLSLFKEHSTETATTSIGSVNKVEGNLKVIMDKVLNDPQLSRGKAEVP 936
             + +KN       E+S + A  S+ ++N +E ++K+ +         + G+  VP
Sbjct: 925 NELARKNSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVP 980

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/933 (46%), Positives = 600/933 (64%), Gaps = 56/933 (6%)

Query: 31  ELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDK 90
           ELNI VAVRCRGRNEREI +KS VVV VPD     E+SINTT + GI A+MNSKTYTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 91  VFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLH-NGE-LGD 148
           VFGP+A Q L+++E+AEPLF+DF+KGYNCT+LVYGMTSTGKTYTMTGDEKL+ NG  L D
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 149 AAGIIPRVLFELFDTLEANK--------DDYLVKCSFVELYNEELKDLL-----DSTNTA 195
           AAGIIPR+LF+LFDTL+ ++         D++VKCSFVELYNE+LKDLL     D     
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQQQQ 207

Query: 196 TNSDNKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQM------LRRKLGRHN 249
               ++KLRIFD                                       +R+K  R+N
Sbjct: 208 QQLGSRKLRIFDSTNNNNNNSNSNASSRASSRNNSPRTSSILPNANATNLAMRKKSIRYN 267

Query: 250 TTGNSKISNNNHNKFSRFKQTSQESTRAHASXXXXXXXXXXXXXXXXXXXXXXXDQSASI 309
              N+K  ++N+   +R     + S+ A                          + +  I
Sbjct: 268 YNSNNKAKSSNN---TRPNTNDEPSSIAGPD-----------------------ENTNGI 301

Query: 310 YIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGELFRV 369
           YIQNL+EFHIT+A E             VASTKMNDFSSRSH+IFTITLYKE    LFR+
Sbjct: 302 YIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRL 361

Query: 370 SKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTR 429
           SKMNLVDLAGSENI+RSGAMNQRAKE GSINQSLLTLGRVINSLADKS H+PFRESKLTR
Sbjct: 362 SKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTR 421

Query: 430 LLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSI 489
           LLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLG+ I+KDIL+++I
Sbjct: 422 LLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNI 481

Query: 490 TSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQ 549
           TSELAK+KSDL+STKSK+G+YMSHEHY++L  ++E  KTE++ESKR IE L++QN+ML +
Sbjct: 482 TSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLK 541

Query: 550 ERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHL 609
           ++ S  + N   +  + +LKD++  L   L+ Q  KET +   +  ++ + E++   +  
Sbjct: 542 DKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKN 601

Query: 610 FEFKQQELQQSISTFISDEISNIRDTLKKHIEYL-QNNGDLKDTEISGNLMRLXXXXXXX 668
           ++ KQ +L+  IS  +++ +  ++  L  H + + Q+ G+  D E+  NL  +       
Sbjct: 602 YQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQSEGNF-DVEM--NLKVIKDEITSM 658

Query: 669 XXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYN 728
                      Y E ++  L++TP   + +   +  +  +    +++I E LSD+SEEYN
Sbjct: 659 LEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYN 718

Query: 729 NLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENI 788
           NLKQYL N+FF+NNHE+LL+ H+  T   L ++SA+L   F +M+D H+ ENK+ M++N 
Sbjct: 719 NLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNF 778

Query: 789 LGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDN 848
              T++VI  E+++F  +R KWE+S  LIN+CDS+N+ FH  +   + +I+  ++SS  +
Sbjct: 779 RTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNLASSSSS 838

Query: 849 IGATISSIQSRTRNRQS-----IEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903
           I   I+SI+S+   + S     ++  ++ + +  +    I +KN  L   ++++      
Sbjct: 839 IHNAIASIKSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQKNRKNAINYTDK 898

Query: 904 SIGSVNKVEGNLKVIMDKVLNDPQLSRGKAEVP 936
           S+ +++++   +K+ ++ +++D  ++ G    P
Sbjct: 899 SLLNIDELSETVKIALNNIVDDVAITDGDDNSP 931

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/655 (48%), Positives = 439/655 (67%), Gaps = 10/655 (1%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           DQS  IYIQNL+EFHIT+AME             VASTKMNDFSSRSH+IFTITLYK+  
Sbjct: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
            ELFR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFR
Sbjct: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLGAFIMKD
Sbjct: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV++IT ELAKIKSDLLSTKSKEG+YM+ +HYK+L+ D+E YK E++E KR IESLT++
Sbjct: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSK 552

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N++L +E+L  K+      + I SLK  +  L++ L +Q   E  I      +Q   E M
Sbjct: 553 NSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVM 612

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           +  +  ++ ++ +L +   T I+ EI N++ TL   +  LQ    L++T+I  NL  +  
Sbjct: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKN 672

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                           Y +CVK +L E+P+ F ++  ++D I    E  +  IAE LSD+
Sbjct: 673 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDI 732

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           SEE NNLKQY TN+FF+NNH+ELLSHHV +TY ++E+ + Q ++NF   L+ H++ENK+ 
Sbjct: 733 SEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKL 792

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843
           +++N+   T  VI+ E+ +F  +R KWE S  LIN+CDS+N+ F+ ++ + L +I+  V 
Sbjct: 793 IMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVD 852

Query: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903
           +S +++  +IS ++ +    ++   +++ N     Q  ++  K+  L    E S  +  +
Sbjct: 853 TSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIESSITSTNS 912

Query: 904 SIGSVNKVEGNLKVIMDKVLNDPQLSRGKA------EVPDEELHRLEKIPLGITN 952
            I +++ +   ++ IM+   N    ++ +       E+P+      +++PL I+N
Sbjct: 913 HITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLS----KRMPLRISN 963

 Score =  287 bits (734), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 6/184 (3%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           EELNI VAVRCRGRNEREI  KSSVVV+VPD   + E+SINTT D GI A+MN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           KVFGP ASQ L+++E+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL D+
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------KKL 203
           AGIIPRVL +LFDTLE  ++DY+VKCSF+ELYNEELKDLLD+ + +++++       KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 204 RIFD 207
           RIFD
Sbjct: 213 RIFD 216

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/655 (47%), Positives = 432/655 (65%), Gaps = 10/655 (1%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           DQ+  IYIQNL+EFHIT+AME             VASTKMNDFSSRSH+IFTITLYK+  
Sbjct: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
            ELFR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFR
Sbjct: 371 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 430

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLG+FIMKD
Sbjct: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKD 490

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV++IT ELAKIKSDLLSTKSKEG+YMS +HYK+L+ D+E YK E++E KR IESLT++
Sbjct: 491 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSK 550

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           NA+L +++L  K+        I SLK  +  L++ L +Q   E  I      +Q   E M
Sbjct: 551 NALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVM 610

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           +  +H ++ ++ +L Q     I+ EI  ++ TL   +  +Q    L++T I  NL  +  
Sbjct: 611 QMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKN 670

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                           Y +CVK +L E+P+ F  V  ++D I    ++ +  IAE LSD+
Sbjct: 671 EVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDI 730

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           SEE NN+KQYL N+FFKNNH+ELL+ HV +TY  +E+ + + ++NF  +L+ H+ ENK+ 
Sbjct: 731 SEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKL 790

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843
           +++N+   T  VI+ E+ +F  +R KWE S  LIN CDS+N+ F+ ++ + L +I+  V 
Sbjct: 791 IMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVD 850

Query: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903
           +S +++  +IS ++ +    ++   +++ N     Q  ++  K+  L    ++S  +  +
Sbjct: 851 TSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHS 910

Query: 904 SIGSVNKVEGNLKVIMDKVLN------DPQLSRGKAEVPDEELHRLEKIPLGITN 952
            I +V+ +   ++ IM    N      D  +     E+P+      +K+PL ++N
Sbjct: 911 HITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLS----KKMPLRLSN 961

 Score =  291 bits (745), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 158/187 (84%), Gaps = 6/187 (3%)

Query: 27  LATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTY 86
           +  EELNI VAVRCRGRNEREI  KSSVVV+VPD   + E+SINTT D GI A+MN+K Y
Sbjct: 30  VPNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRY 89

Query: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146
           TVDKVFGP ASQ L+++E+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL
Sbjct: 90  TVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 149

Query: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDS-TNTATNSD-----N 200
            DAAGIIPRVL +LFDTLE  ++DY+VKCSF+ELYNEELKDLLDS +N ++N+       
Sbjct: 150 SDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFM 209

Query: 201 KKLRIFD 207
           KKLRIFD
Sbjct: 210 KKLRIFD 216

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/655 (46%), Positives = 434/655 (66%), Gaps = 10/655 (1%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           DQS  IYIQNL+EFHIT+A+E             VASTKMNDFSSRSH+IFTITLYK+  
Sbjct: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
            ELFR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+L D+S HIPFR
Sbjct: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLGAF+MKD
Sbjct: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV++IT ELAKIKSDLLSTKSKEG+YMS +HYK+L+ D+E +K E++E KR IESL ++
Sbjct: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N++L +++L  ++      + + SLK  +  L++ L +Q   E  I      +Q   E M
Sbjct: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           +  +  ++ ++ +L +   T IS EI +++  L   ++ +Q     ++T+I  NL  +  
Sbjct: 609 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 668

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                           Y +CVK +L E+P+ F  +  ++D I    +  +  IAE LSD+
Sbjct: 669 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 728

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           SEE NNLKQYL N+FFKNNH+ELL+HH+ +TY  +E+ + Q ++NF M L+ H++ENK+ 
Sbjct: 729 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 788

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843
           +++N+   T  VI+ E+ +F  +RAKWE S  LIN+CDS+N+ F+  + + L +I+  V 
Sbjct: 789 IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD 848

Query: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903
           +S +++  +IS ++ +    ++   +++ N     Q  ++  K+  L    E S  +  +
Sbjct: 849 TSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIESSITSTHS 908

Query: 904 SIGSVNKVEGNLKVIM------DKVLNDPQLSRGKAEVPDEELHRLEKIPLGITN 952
            I +V+ +   ++ IM      +    D  +     E+P+      +++PL I+N
Sbjct: 909 HITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLS----KRLPLRISN 959

 Score =  288 bits (736), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 136/187 (72%), Positives = 156/187 (83%), Gaps = 6/187 (3%)

Query: 27  LATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTY 86
           +  EELNI VAVRCRGRNEREI  KSSVVV+VPD   + EVSINTT D GI A+MN+K Y
Sbjct: 32  VPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRY 91

Query: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146
           TVDKVFGP ASQ L++EE+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL
Sbjct: 92  TVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 151

Query: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------ 200
            DAAGIIPRVL +LFDTLE  + DY+VKCSF+ELYNEELKDLLD+ +  ++++       
Sbjct: 152 NDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFM 211

Query: 201 KKLRIFD 207
           KKLRIFD
Sbjct: 212 KKLRIFD 218

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/583 (49%), Positives = 399/583 (68%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           DQ+A IYIQNL++FHIT+A E             VA+TKMNDFSSRSH+IFTITLYKE N
Sbjct: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           GE+FRVSKMNLVDLAGSENISRSGA +QRAKEAGSINQSLLTLGRVINSL DKS H+PFR
Sbjct: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YA+KAKNIKNKPQLG+ IMKD
Sbjct: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV++IT ELAKIK+DLLSTKSKEG+YMS ++YK+L  D+E YKTE++E KRAIE+LT+Q
Sbjct: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N +L +++ +  + N   +  + +++D +  L S  ++Q  +E N+ +    ++     M
Sbjct: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           +  I   E ++++++  +    ++E + ++ T+  +I  ++   D ++  + GN+  +  
Sbjct: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRG 603

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                           Y +CV+ +L ETP  F+  + ++  + KL    H  + E LSDV
Sbjct: 604 EISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDV 663

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           SEE+NNL+QYL ++FFKNNHEE+L  H+  TY  ++ ++  L Q F  M+D H+++NK  
Sbjct: 664 SEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDL 723

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843
           MLE++   T +VI  E+Q+F  Q+ KWE S   IN+CDS+N +F   + S L+ I+  + 
Sbjct: 724 MLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLG 783

Query: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQK 886
           SS++ I  TI+ ++ +    +S   M+  + V  +Q + I  K
Sbjct: 784 SSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNK 826

 Score =  280 bits (717), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 139/179 (77%), Positives = 160/179 (89%), Gaps = 4/179 (2%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           EELNI VAVRCRGRNEREIKAKSSVVV VPD   +NEVSINTT DVGI A++NSKTYTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           +VFGPSA+Q LV+++IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL++GEL ++
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL-DSTNTATNSDNKKLRIFD 207
           AGIIPR+LF+LF+TLE  K+DY+VKCSFVELYNEELKDLL DS   A+   ++KLRIFD
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIAS---SRKLRIFD 188

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/616 (49%), Positives = 423/616 (68%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           DQS  IYIQNL+EFHIT+AME             VASTKMNDFSSRSH+IFTITLYK+  
Sbjct: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
            ELFR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFR
Sbjct: 370 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLGAFIMKD
Sbjct: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV++IT ELAKIKSDLLSTKSKEG+YMS +HYK+L+ D+E YK E++E KR IESL+++
Sbjct: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSK 549

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N++L +++L  KD      + + SLK  +  L++ L +Q   E  I      +Q   E M
Sbjct: 550 NSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 609

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           +  +  ++ ++ +L +   T IS EI +++ TL   +  ++ N   ++T I  NL  +  
Sbjct: 610 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 669

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                           Y +CVK +L E+P+ F  +  ++D I    +  ++ IAE LSD+
Sbjct: 670 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 729

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           SEE NNLKQYL N+FFKNNH+ELL+HH+ +TY  +E+ +++ ++NF   L+ H++ENK+ 
Sbjct: 730 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 789

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843
           +++N+   T  VIN E+ +F  +R KWE S  LIN+CDS+N+ F+  + + L +I++ V 
Sbjct: 790 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 849

Query: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903
           +S +++  +IS ++ +    ++   +++ N     Q  ++  K+  L    E+S  +  +
Sbjct: 850 TSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHS 909

Query: 904 SIGSVNKVEGNLKVIM 919
            I +++ +   ++ IM
Sbjct: 910 HITNIDDIYDTIENIM 925

 Score =  287 bits (734), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 157/187 (83%), Gaps = 6/187 (3%)

Query: 27  LATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTY 86
           +  EELNI VAVRCRGRNEREI  KSSVVV+VPD   + EVSINTT D GI A+MN+K Y
Sbjct: 30  VPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRY 89

Query: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146
           TVDKVFGP ASQ L+++E+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL
Sbjct: 90  TVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 149

Query: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------ 200
            DAAGIIPRVL +LFDTLE  ++DY+VKCSF+ELYNEELKDLLD+ +  ++++       
Sbjct: 150 SDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFM 209

Query: 201 KKLRIFD 207
           KKLRIFD
Sbjct: 210 KKLRIFD 216

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  548 bits (1411), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 283/594 (47%), Positives = 400/594 (67%), Gaps = 7/594 (1%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D  + +YIQNL++FHITSA +             VA+TKMNDFSSRSH+IFTITLY+E  
Sbjct: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           GE+F+VSKMNLVDLAGSENISRSGA +QRAKEAGSINQSLLTLGRVINSLADKS H+PFR
Sbjct: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKD
Sbjct: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV++IT+ELAK+KSDLLSTK +EGVYMS ++YK++  D+E YKTE++ESKR IE L++Q
Sbjct: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N++L +++ +  + N   +  + ++KD +  L   L+ Q  KE  +  +  +++      
Sbjct: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKD-------TEISG 656
           +  I  +  +++++ + +   +  E    R  L  +IE ++ N    D         I  
Sbjct: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631

Query: 657 NLMRLXXXXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKI 716
           NL  L                K Y + ++ +L+E P +F+++S ++D +       H ++
Sbjct: 632 NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691

Query: 717 AETLSDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKH 776
            E LSD+SE YNNLKQY  ++FFKNNHEE+L+ H+  TY QL+ ++  L+Q F  M+D H
Sbjct: 692 TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751

Query: 777 IQENKRHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLV 836
           +++NK  M++++   T E I+ E+Q+F  QR KWE+S  LIN CDS+++ F+  + S L 
Sbjct: 752 LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811

Query: 837 EIRDVVSSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSL 890
           +I+    SS D I  ++S ++   +  +    ++ GN+V+++QI  I  K+ SL
Sbjct: 812 DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSL 865

 Score =  278 bits (710), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 158/178 (88%), Gaps = 2/178 (1%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           EELNI VAVR RGRNEREI+AKSSVVV VPD   ++EV+INTTDDVGI A+MNSKTY VD
Sbjct: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           KVFGPSA+Q+L+++EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKL+N EL D+
Sbjct: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           AGIIPR+LF+LF+TL+   +DY+VKCSFVELYNEELKDLLD  ++  NS  +KLRI+D
Sbjct: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLD--DSVENSSMRKLRIYD 188

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  526 bits (1355), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 281/625 (44%), Positives = 410/625 (65%), Gaps = 6/625 (0%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           DQ+A IYIQNL+EFHIT+A E             VASTKMNDFSSRSH+IFTITL+KE  
Sbjct: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           GE+FR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVINSLADK+ H+PFR
Sbjct: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+T EETCSTLEYASKAKNIKNKPQLG+FIMKD
Sbjct: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           IL+++IT+EL KIKSDLLSTKSK+G+YM  +HYK+L  D++ YKTE++E KR IESLT+Q
Sbjct: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           NA+L +++ ++ ++N   +  I ++ +++  L + ++ Q + E  +   ++     N ++
Sbjct: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
            K I   + ++  +     T +   +S +   L   IE  ++ G  ++  +  NL  +  
Sbjct: 585 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKS 644

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                         K Y EC+   L +TP LF+ ++  + N+  L    +S+IAE LSD+
Sbjct: 645 EMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDL 704

Query: 724 SEEYNNLKQYLTNNFF---KNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQEN 780
           SEEYNN KQ++T+ F+   K +  ELL+ ++ NT   +E +S  +M     +L++H++ N
Sbjct: 705 SEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRAN 764

Query: 781 KRHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRD 840
           K  ++ ++  VT E+++NEL     + +KWE+S+ LIN+ D++N+ F+  + S++  + D
Sbjct: 765 KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTD 824

Query: 841 VVSSSRDNIGATISSIQSRTRNR---QSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHS 897
            +  + D+I   I  I    +      S   MI  N++I+     I++KN  L  F +  
Sbjct: 825 KIKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEG 884

Query: 898 TETATTSIGSVNKVEGNLKVIMDKV 922
                 S+  +N+++ +++ ++  +
Sbjct: 885 YLVTNESMKKLNELDTSIRTVLKDI 909

 Score =  286 bits (731), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 153/178 (85%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           EELNI VAVRCRGRN+REI AKSSVVV VPD   + EV+INT++D+G  A+MNSKTYTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           KVFGPSA+Q L+++EIAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+N EL D+
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           AGIIPR+LF+LF+TLE   +D++VKCSFVELYNEELKDLL       N + KKLRIFD
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 192

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  509 bits (1310), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 267/606 (44%), Positives = 410/606 (67%), Gaps = 3/606 (0%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D+   IYIQNL+EFHITSA E             VASTKMNDFSSRSH+IFTI LYKE +
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           G++FR+SKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADK+ HIPFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG+ I KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV++I SELAK+K+DLLSTKS++GVYMS  HYK+L  D+E YKTE++E KR I+ LT Q
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N +L +++ +  + +   K  + S+KD++  L  S+++Q  KE  +  L+  ++  + EM
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           + TI     ++Q  Q  +    ++E+  ++  L +++E +     + +T++  N+ ++  
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                        +  Y +C++ ++KE+P L  S++  +  + K+++  + +++ ++S++
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           + E+N+LKQYL  +FFK++HEE+L+ H++ TY  +   S  +++     L+ +++E++  
Sbjct: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843
           +++++   T +++ +E+++F  ++ KWE S  +IN+CDS+N+ +   + + L  ++  V+
Sbjct: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837

Query: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903
           S+ D +   +S ++  T N     ++ + +  I QQ T + +KN  L   + H  E+ T 
Sbjct: 838 STSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKL---ESHLNESITM 894

Query: 904 SIGSVN 909
           +  S+N
Sbjct: 895 NESSIN 900

 Score =  294 bits (752), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 137/178 (76%), Positives = 160/178 (89%), Gaps = 1/178 (0%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           +ELNI+VAVRCRGRNEREIKAKSSVVV VPD   ++E++INTT+DVGIA +MNSKTYTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           KVFGPSA+Q+L++EE+AEPLF DFI+GYNCT+LVYGMTSTGKTYTMTGDE+L+NGEL D+
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           AGIIPRVLF+LFD +E   DDY++KCSF+ELYNEELKDLLD    A NS  KKLRIFD
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQ-AINSTAKKLRIFD 187

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  506 bits (1304), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/653 (43%), Positives = 409/653 (62%), Gaps = 13/653 (1%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           +QS++IYIQNL+EFHIT+A +             VASTKMNDFSSRSH+IFTI LYK  N
Sbjct: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           GE+FRVSKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADK+ HIPFR
Sbjct: 316 GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 375

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG  +MKD
Sbjct: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD 435

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV++IT ELAKIKSD LSTKSK+G+YM+ +HYK+L  D+E YKTE++E KR IE + +Q
Sbjct: 436 ILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQ 495

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N +L +++ +  + +   +  I  L D +  L   + +Q   E ++   +  ++ A   +
Sbjct: 496 NVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTV 555

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           + ++   E  Q + +  +   + D +++ + ++ + +  ++ +   +   I GN+  +  
Sbjct: 556 QNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQE 615

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                              CV+ +L+  P+ FES+   L +IS + +   +++ + L D+
Sbjct: 616 ELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDI 675

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           SEEYNN ++YL  + FKNNHEE LS HV  TY  L++++ +L   F  M+D H++ENK  
Sbjct: 676 SEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSL 735

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843
           M++++   +DEV+  E+++F   + KWE S   IN+CDS+N++F   +   L  +   + 
Sbjct: 736 MIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNIE 795

Query: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903
            S +    T   ++   +    I E+++ N  +   I  +K+K+     F     E  ++
Sbjct: 796 GSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHT----FLRDQVERTSS 851

Query: 904 SIGSVN-KVEG---NLKVIMDKVLNDPQLSRGKAEVPDEELHRLEKI---PLG 949
            I + N K EG    ++ I+DK L  P    G  E+ +  L +L K    P+G
Sbjct: 852 YIEAANEKFEGIDQFIRQIIDKKL--PTHLVGNGELVNVMLEQLGKTHLKPIG 902

 Score =  292 bits (748), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 156/178 (87%), Gaps = 2/178 (1%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           +ELNI V+VRCRGRNEREIKAKSSVVV VPD   +NEVSINTTD++GI A+MNSKTYTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           KVFGPSA Q L++++IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+L++GEL DA
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           AGIIPR+LF+LFDTLE   +DYLVKCSF+ELYNEELKDLL+    +     KKLRIFD
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQES--GVIKKLRIFD 190

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  492 bits (1267), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 299/862 (34%), Positives = 483/862 (56%), Gaps = 43/862 (4%)

Query: 31  ELNILVAVRCRGR--NEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTV 88
           E NI V  R +G+  NE+    +  ++++ P  G+   +     DD   A K   + + +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEP--GL---IKFKGKDD---AVK---REFGM 60

Query: 89  DKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEK--LHNGEL 146
           D +F     Q+ +Y +  +P+FQDFI GYNC+ LVYG T +GKTYT++G+E   LH+   
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL-DSTNTATNSDNKKLRI 205
             + G+IPRVL ELFD L  N  D++VKCS+VE+YNEELKDLL D  N+  ++  KKLRI
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180

Query: 206 FDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQMLRRKLGRHNTTGNSKISNNNHNKFS 265
            D                              A ++R+K+GR + T    +   N    S
Sbjct: 181 VDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTA-IIRKKMGRQSLTA---LKQANTLSIS 236

Query: 266 RFKQTSQESTRAHASXXXXXXXXXXXXXXXXXXXXXXXDQSASIYIQNLEEFHITSAMEX 325
           R    ++ S + H                         +++ + YIQNLEEFHIT+A E 
Sbjct: 237 RSNSFNEYSPQRHIQ-----------------------EKTGAPYIQNLEEFHITNAKEG 273

Query: 326 XXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSENISR 385
                       +AS+K   +SSR+ +IFTI LYKE+ GE+FRVSK N VDLAG+E+  +
Sbjct: 274 IQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHK 333

Query: 386 SGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIA 445
               NQR K+   INQ +  L +++NSL +K   IPF++SKLT L++D+L GN+K+  I 
Sbjct: 334 IEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFIL 393

Query: 446 TISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLLSTKS 505
           T+   K + +E   TLE+ +K +++K  P LG  I K+ L++SI++ELAK+KSDLLSTKS
Sbjct: 394 TLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKS 453

Query: 506 KEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKANI 565
           KEGVYMSHEHY  L  D++ +K E+ + K+ I+ L  Q+  L++++ + ++ N   +  +
Sbjct: 454 KEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKL 513

Query: 566 ASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFI 625
            S++D+V  + +++++Q  +E ++ +    ++     M  TI  +  ++  +Q  + T  
Sbjct: 514 QSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLF 573

Query: 626 SDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXXXXXXXXXXXXXXXSKSYGECVK 685
           ++E+S ++  L K++   + N  + + EI  NL +                   + +C+K
Sbjct: 574 NEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHEEIKQILQISENEIDSLFLDCIK 633

Query: 686 MMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNNHEE 745
            M +E+P+LF S    +  +     EN++ +AE LSDVSEE+NNLKQY+   FFKNNHEE
Sbjct: 634 KMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEE 693

Query: 746 LLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGE 805
           LL  +V  TY Q++++S   +  F  +L+ +++ NK  +L+NI   T EVI NE+  F  
Sbjct: 694 LLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIP 753

Query: 806 QRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQSRTRNRQS 865
           Q+ KWEKS  LI +    ++ F       + +++D +  + +++  T+S ++S+    Q 
Sbjct: 754 QKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQK 813

Query: 866 IEEMIQGNDVIRQQITRIKQKN 887
              +I+ N+V+ ++   I +KN
Sbjct: 814 AANIIENNEVVTEEFISIMKKN 835

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  484 bits (1246), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 284/657 (43%), Positives = 404/657 (61%), Gaps = 14/657 (2%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           + S++I+IQNL+EFHI  A E             VASTKMND SSRSH+IFTI LYK+ N
Sbjct: 233 EPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCN 292

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           GE FRVSKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADKS HIPFR
Sbjct: 293 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFR 352

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD
Sbjct: 353 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKD 412

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           +L++S+T+EL KIKSDLLSTKSK+G+YMS E+YK+L  ++E YKTE+EE KRA+E ++AQ
Sbjct: 413 VLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQ 472

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N++L +E+    + N   K  +  L +N+  L   +  Q   E  + ++++++  A   M
Sbjct: 473 NSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTM 532

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           ++++ ++E + Q     +   + D I + + +L   IE L+ N D    ++  N+  +  
Sbjct: 533 QQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVDAVTT 592

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                         + +   +K +  +TP  F+ +  ++++I+ +     S +   LS +
Sbjct: 593 ELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSI 652

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           SEEYNNLK YL  +FFKNN +E L  HV  TY QL+ ++  +      ML++ +  NK  
Sbjct: 653 SEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEF 712

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843
           M++++     EV+  E+ +    +  WE S   IN+CD +N+ F   +G  + EI   + 
Sbjct: 713 MMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTID 772

Query: 844 SSRDNIGATISSIQSR-TRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETAT 902
             +     T    +S  TR R +   + Q N +I Q +  IK+K+   +L K    ++A 
Sbjct: 773 QGQKTSQVTTEDAKSELTRVRAAFSSL-QNNGIILQNVDSIKKKH---NLLKSQVQDSAN 828

Query: 903 TSIGSVNKVEGNLKVIMDKVLNDPQLSRGKAEVPDEELHRLEKI------PLGITNK 953
               +  K  G +   +  +LN   + + ++E P + L  LE++      PLG + K
Sbjct: 829 YMQAATQKF-GEIDNSIQDLLNAQTIPQPQSENPIDGL--LEQLNDKSLKPLGPSGK 882

 Score =  292 bits (748), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 154/178 (86%), Gaps = 2/178 (1%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           EELNI VAVRCRGRNE+E+KA+SSVVV VPD   TNEVSINTT D GI A++NSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           KVFGPSA Q L+++ IAEPLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDE+L++GEL + 
Sbjct: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           AGIIPRVLF+LFD L A  DDY++KCSF+ELYNEELKDLLD   T  +S  KKLRIFD
Sbjct: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDE--TPDSSMPKKLRIFD 180

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  467 bits (1201), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 268/555 (48%), Positives = 356/555 (64%), Gaps = 62/555 (11%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           +QS++IYIQ+L+EFHIT A E             VASTKMND SSRSH+IFT+TLYK  N
Sbjct: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           GE FRVSK+NLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADK+ HIPFR
Sbjct: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MKD
Sbjct: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV++I+ ELAK+KSD LSTKSKEG+YMSH HY ++  DIE YKTE++ES+R IE L++Q
Sbjct: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503

Query: 544 NAMLQQ---------------------------ERLSLKDDNACYKAN-IASLKDNVVTL 575
           N +L +                           E++ LK  N     N I  LKD V  +
Sbjct: 504 NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563

Query: 576 QSSLKEQITKETNIRSLLKDVQGAN-EEMKKTIH--LFEFKQQELQQSISTFISDEISNI 632
           Q +LK     E  ++S ++ +   N  E ++ I   L   KQQ L+QS +  I D+I+N+
Sbjct: 564 QGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFT--IDDDINNV 621

Query: 633 RDTLKKHIEYLQNNGDLKDTEISGNLMRLXXXXXXXXXXXXXXXSKSYGECVKMMLKETP 692
           +D+L+  +E ++ +  +    +  NL                          + ++ + P
Sbjct: 622 KDSLETLLETVKKDAII----MCENL-------------------------AQKVVGDQP 652

Query: 693 RLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQ 752
           + F S+   L+++    +E+  ++ E LS ++ E NNLK YL  +FF+NNH+E+L+ H  
Sbjct: 653 KFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHAD 712

Query: 753 NTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQRAKWEK 812
            TY QL  +S  LM   T ++  H+++N+  +++ +   T EVI  E+  F   R  WE+
Sbjct: 713 KTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQ 772

Query: 813 SSALINQCDSVNHSF 827
           S   IN CDS+++ F
Sbjct: 773 SFNHINVCDSLSNKF 787

 Score =  295 bits (756), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 133/178 (74%), Positives = 157/178 (88%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           +ELNI VAVRCRGRNE+EIKAKSSVVV+ PD    NEVSINT+ D+GI A+MNSKTYTVD
Sbjct: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           KVFGPSA Q LV++EIA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL++GEL +A
Sbjct: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           AGIIPRVLF+LFDTLE  + DY+VKCSF+ELYNEELKDLLD    +  ++++KLRI+D
Sbjct: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  464 bits (1194), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/590 (43%), Positives = 376/590 (63%), Gaps = 6/590 (1%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           +QS++IYIQNL+EFHIT+A E             VASTKMNDFSSRSH+IFTI LYK   
Sbjct: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           GELFR+SKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADKS HIPFR
Sbjct: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+F+MKD
Sbjct: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           ILV+SI+SEL+K+KSD LSTK+KEG+YMSHEHY+++  D+E Y+TE++ESKR +ES ++Q
Sbjct: 422 ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N++L +++ + +  N      I  L++ +  L   ++ Q   E ++ S +  ++ A   M
Sbjct: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           K ++  +E  +  LQ  I   +   I++ R+++ +H+E ++     K+  I+ N+  +  
Sbjct: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                        S      VK++  +    ++     L ++    +     +   L+++
Sbjct: 602 IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEM 661

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           +EE NN+K+YL  +F KNN++E+L   ++  Y + +  S  L+ +   M++ H++E++  
Sbjct: 662 TEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNL 721

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQ---ALGSNLVEIRD 840
           ML ++     E+I+ EL+MF   + +W  S   IN+CD+ +  F      L +NL E+ D
Sbjct: 722 MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELAD 781

Query: 841 VVSSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSL 890
               + D++      +Q    N + I       + I +Q+  I  K+K L
Sbjct: 782 NSVVAADDVA---KQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKML 828

 Score =  298 bits (764), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 138/178 (77%), Positives = 156/178 (87%), Gaps = 4/178 (2%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           EELNI VAVRCRGRNEREIKAKS+VVV VPD   +NEVSINTT D+GIA KMNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           +VFGPSA QKL+++ IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL++GEL D+
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           AGIIPRVLF LFDTLEA + D+LVKCS++ELYNEELKDLLD T   +    K+LRIFD
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS----KRLRIFD 192

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  462 bits (1190), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 252/585 (43%), Positives = 376/585 (64%)

Query: 306 SASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGE 365
           +ASIYIQNLEEFHI +A E             VASTKMND SSRSH+IFTI LYKE  GE
Sbjct: 235 NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE 294

Query: 366 LFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRES 425
           +F++SKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINS+ADK+ HIPFRES
Sbjct: 295 IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRES 354

Query: 426 KLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDIL 485
           KLTRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ IMKD+ 
Sbjct: 355 KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVR 414

Query: 486 VRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNA 545
           ++ + +ELAKIK DL STK K+GVYM+  HYKDL  D+E YKTE++E  R ++SL  QNA
Sbjct: 415 LKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNA 474

Query: 546 MLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKK 605
           +L +++ +  + N   + N+  + + +  +Q++L+ Q  KE  +   L   +  + +MK 
Sbjct: 475 LLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKT 534

Query: 606 TIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXXXX 665
            I  +  K++ +Q ++ +  +DE+  +++ L +++  +     +  T +  N+  +    
Sbjct: 535 VIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDV 594

Query: 666 XXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSE 725
                       K + E  + ++KETP + E  S  +    +L E   + + E L  + +
Sbjct: 595 ISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQ 654

Query: 726 EYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHML 785
           +Y+ L +Y +N+FFK+NH  +++ HV  T A +E++ + + + F   ++   ++N++ +L
Sbjct: 655 QYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLIL 714

Query: 786 ENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSS 845
           EN+  V+ ++I NE+  F E +++W+ S   IN CD +N+S+H  + + L  ++  + SS
Sbjct: 715 ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSS 774

Query: 846 RDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSL 890
            + I   ++ I+S   +  S  +++  +  I     +I  K   L
Sbjct: 775 DEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKL 819

 Score =  288 bits (736), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 131/182 (71%), Positives = 161/182 (88%), Gaps = 7/182 (3%)

Query: 29  TEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDV--GIAAKMNSKTY 86
           T+E+NI+VAVRCRGRN+REIK+KSSV+V VPD   +NE+SINT+DD+  G+ A++NSKTY
Sbjct: 12  TDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTY 71

Query: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146
           TVDKVFGPSA+Q+L++EEIAEPLF DF++GYNCT+LVYGMTSTGKTYTMTGDEKL+ G+L
Sbjct: 72  TVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDL 131

Query: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL-DSTNTATNSDNKKLRI 205
            D+AGIIPRVLF+LF+T+E   D+Y++KCSF+ELYNEELKDLL DS NT      KKLRI
Sbjct: 132 SDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKL----KKLRI 187

Query: 206 FD 207
           FD
Sbjct: 188 FD 189

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  461 bits (1186), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 278/658 (42%), Positives = 402/658 (61%), Gaps = 23/658 (3%)

Query: 307 ASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGEL 366
           ++I+IQNL+EFHI  A E             VASTKMND SSRSH+IFTI LY++ NGE 
Sbjct: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294

Query: 367 FRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESK 426
           FRVSKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESK
Sbjct: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354

Query: 427 LTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV 486
           LTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+LV
Sbjct: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414

Query: 487 RSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAM 546
           +++T+EL KI+SDLL+TKSK+G+YMS E+YK+L  ++E YKTE++E KRAIE L+ QN +
Sbjct: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474

Query: 547 LQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKT 606
           L +E+    + N   +  I  L +N+  L   +  Q   E  + ++++++  A   M+ +
Sbjct: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534

Query: 607 IHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDT-EISGNLMRLXXXX 665
           + ++E +    Q  +   + + I + + +L   IE L+  G  +D  ++  N+  L    
Sbjct: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLK--GTEEDGFDVDANIDTL---T 589

Query: 666 XXXXXXXXXXXSKSYGECVKMMLK---ETPRLFESVSGRLDNISKLAEENHSKIAETLSD 722
                      + +   C K M K   +TP   + +  ++++I+ +     S +   LS 
Sbjct: 590 KELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSS 649

Query: 723 VSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKR 782
           +SEEYN+LK YL  +FFKNN ++ L  HV  TY QL+ ++  +      M+++ ++ NK 
Sbjct: 650 ISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKE 709

Query: 783 HMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVV 842
            M++++     EV+  E+ +    +  WE S   IN+CD +N  F + +GS    +RDV 
Sbjct: 710 IMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGS---VVRDVF 766

Query: 843 SSSRDNIGATISSIQSRTRNR---QSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHST- 898
               + +  + S++     +    Q     ++ +DVI   I  IK+K+  L L  + S  
Sbjct: 767 EKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSAS 826

Query: 899 --ETATTSIGSV-NKVEGNLKVIMDKVLNDPQLSRGKAEVPDEELHRLEKIPLGITNK 953
             E AT   G + + ++G   ++  + ++ P  S  + E   E+L+     PLG + K
Sbjct: 827 YMEAATQKFGEIDDSIQG---LLNSQAVSQPH-SENRIEGLLEQLNGKPLKPLGPSGK 880

 Score =  292 bits (748), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 135/178 (75%), Positives = 156/178 (87%), Gaps = 2/178 (1%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           EELNI VAVRCRGRNE+E+KAKSSVVV VPD   TNEVSINTT D GI A++NSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           +VFGPSA Q L+++ IAEPLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDE+L++GEL + 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           AGIIPRVLF+LFD L+A+ DDY++KCSF+ELYNEELKDLLD   T  +S  +KLRIFD
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDE--TPDSSMPRKLRIFD 180

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  457 bits (1175), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/589 (43%), Positives = 382/589 (64%), Gaps = 10/589 (1%)

Query: 307 ASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGEL 366
           + IY+QN++EFHI +A E             VASTKMNDFSSRSH+IFTI LYK  +GEL
Sbjct: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGEL 305

Query: 367 FRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESK 426
           FRVSKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADKS HIPFRESK
Sbjct: 306 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESK 365

Query: 427 LTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV 486
           LTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGA +MKDILV
Sbjct: 366 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILV 425

Query: 487 RSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAM 546
           ++I+SELAKIKSD LSTKSK+G+YMSHEHY+++  D+E  +TE++ESKR IESLT+QN +
Sbjct: 426 KNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNL 485

Query: 547 LQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKT 606
           L +++ + ++      + I  L+  +  L   ++ Q   ET + + +  ++ A   M+ +
Sbjct: 486 LLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGS 545

Query: 607 IHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXXXXX 666
           +  +E  +  LQ  I   +   I++ R+++ +H+E ++ +   K+  I  N+  +     
Sbjct: 546 LKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFD 605

Query: 667 XXXXXXXXXXSKSYGECVKMMLKETPRLF-----ESVSGRLDNISKLAEENHSKIAETLS 721
                     S      VK ++KETP ++     E+VS     +S  +    + +   L+
Sbjct: 606 DTLKSVEANGSDMCDTLVK-LIKETPSMYLKEFNETVSSLKSELSSYS----NALTNKLT 660

Query: 722 DVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENK 781
           ++SEE N+L++YL  + FKN+ +E+L   +++ Y +++ +S QL+     M+  H++E++
Sbjct: 661 EISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESR 720

Query: 782 RHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDV 841
             M+ ++    +E+I+NE  +F   R +W  S   INQCD+ + +F     S L +++++
Sbjct: 721 TLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKEL 780

Query: 842 VSSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSL 890
             +S  +    ++  + RT +     + +  +  +++Q+  I  K++ L
Sbjct: 781 SDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRML 829

 Score =  300 bits (769), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 160/180 (88%), Gaps = 4/180 (2%)

Query: 28  ATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYT 87
           A EELNI VAVRCRGRNEREIKAKSSVVV VPD   +NEVSINTTD+VGIAAKMNS+TYT
Sbjct: 17  AQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYT 76

Query: 88  VDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELG 147
           VDKVFGPSA Q L+++EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKL++G+L 
Sbjct: 77  VDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLS 136

Query: 148 DAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           D+AGIIPR++F+LFD LEA   D+LVKCS++ELYNEELKDLLD ++ ++    K+LRIFD
Sbjct: 137 DSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----KRLRIFD 192

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  455 bits (1170), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/620 (40%), Positives = 397/620 (64%), Gaps = 17/620 (2%)

Query: 309 IYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGELFR 368
           IYIQNL++FHI++A E             VA+TK+ND SSRSH+IFTITLYK+   +L+R
Sbjct: 270 IYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKFKDDLYR 329

Query: 369 VSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLT 428
           +SK+NLVDLAGSEN++++GA+N RAKE+GSINQSLLTLGRVINSLADKS HIPFRESKLT
Sbjct: 330 LSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKLT 389

Query: 429 RLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRS 488
           RLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLG+FI+KDIL++ 
Sbjct: 390 RLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLKD 449

Query: 489 ITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQ 548
           ++ EL K+++DL  TKSKEG+Y+S ++YK++  D++ +KTEL E KR  +SL  +N +L 
Sbjct: 450 VSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLG 509

Query: 549 QERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIH 608
           +E+ S  +     K+ + +L+  + ++ + L +  T+ T +   + D+     E+K  I 
Sbjct: 510 KEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIE 569

Query: 609 LFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQ--NNGDLK-----DTEISGNLMRL 661
           +++ K +  +      + DE++ +   +    + L+  N+G+ +     D+ I G +M L
Sbjct: 570 VYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIHTHIDS-IRGEVMNL 628

Query: 662 XXXXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLS 721
                             Y  C+  +LKETP++F+ +S  + +I  + EE+++++A   S
Sbjct: 629 LETTKENAETL-------YKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFS 681

Query: 722 DVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENK 781
           D+SEE+N  KQYL   FF+NNH E++  H     + +++ S  L+Q+    +  ++  N 
Sbjct: 682 DLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNA 741

Query: 782 RHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDV 841
           + +  +I  V  +VIN E+ +F  +++KWE+S  LINQ DS+++ F   +  ++ +I  V
Sbjct: 742 QMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASV 801

Query: 842 VSSSRDNIGATISSIQSR-TRNRQSIEEMIQGNDVIRQQITRIKQK-NKSLSLFKEHSTE 899
           + +S +++  +IS+I+     N  + +E I  N+++      I++K N  L L     T 
Sbjct: 802 IRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLVTGDLTV 861

Query: 900 TATTSIGSVNKVEGNLKVIM 919
           TA  S+  +  ++ +++ ++
Sbjct: 862 TAQESMDGIQNLDRSIRTLI 881

 Score =  223 bits (568), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 146/192 (76%), Gaps = 17/192 (8%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           +++NI VAVRCRGRN+REI+AKS +VV VPD   T EVSINT+   GI A++ +KTYTVD
Sbjct: 23  DDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYTVD 82

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLH-NGELGD 148
           KV+GP +SQKLV+E+ AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD ++   G++  
Sbjct: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142

Query: 149 AAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL-----DSTNTATNSD---- 199
            AGI PR+L +LF+ L+   DDY+VKCSFVELYNE+L+DLL     D +N   NS     
Sbjct: 143 QAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199

Query: 200 ----NKKLRIFD 207
               +KKLRIFD
Sbjct: 200 SLNASKKLRIFD 211

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  452 bits (1162), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 258/634 (40%), Positives = 386/634 (60%), Gaps = 24/634 (3%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D +  IYIQNL+EF+I +A +             VASTKMND SSRSH+IFTITLYKE N
Sbjct: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           G L+RVSKMNLVDLAGSENI++SGA +QRAKEAGSINQSLLTLGRVINSLADKS HIPFR
Sbjct: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG+FIMKD
Sbjct: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
           +L+++IT+EL KIKSDL+ST+ K+GVYMS +HYK+L+ D+E YKTE++ESKRA E L +Q
Sbjct: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568

Query: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603
           N  L +++ +  + N   +  I    + +  L   L E   +E  +  L++ ++     M
Sbjct: 569 NGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSM 628

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKD------------ 651
           + TI  +  +  E+++S    + +E   +++ L + +  +  NG++ D            
Sbjct: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNI--NGNIIDNLKSSIISNNSS 686

Query: 652 ------TEISGNLMRLXXXXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNI 705
                 +    N+  +                  Y  C++ +L + P +       +++I
Sbjct: 687 IEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSI 746

Query: 706 SKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQL 765
                +  +KI E LSD+SEEYNN K+YL N+F +NN+E +L +H+++  +Q+E  S  L
Sbjct: 747 DFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNL 806

Query: 766 MQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNH 825
           + N    +++    N +   E +  + ++++  E +     + KW KS  +IN  D +N+
Sbjct: 807 LLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINN 866

Query: 826 SFHQALGSNLVEIRDVVSSSRDNIGATISSIQ-SRTRNRQSIEEMIQGNDVIRQQITRIK 884
           +FH  + + +++I +++  S ++I  +I+ I+ +  R  +++ E++  N      I  +K
Sbjct: 867 TFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNINELK 926

Query: 885 QKNKSLSLFKEHSTETATTSIGSVNKVEGNLKVI 918
            KN     ++E       +S  S+N ++   +VI
Sbjct: 927 IKNMD---YQEKLKCIGKSSENSINYLDSTKQVI 957

 Score =  296 bits (757), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 138/178 (77%), Positives = 159/178 (89%), Gaps = 3/178 (1%)

Query: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           EELNI VAVRCRGRNERE++AKSSVVV VPD   +NEVSINT+D+VGIAA MNSKTYTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149
           KVFGPSASQ L+++EIAEPLF+DFIKGYNCTILVYGMTSTGKTYTMTGDEKL++GEL D+
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207
           AGIIPRVLF+LF++ E   DDY++KCSFVELYNE+LKDLLD    + ++  KKLRIFD
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDD---SVDNTYKKLRIFD 183

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  391 bits (1004), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 288/923 (31%), Positives = 477/923 (51%), Gaps = 80/923 (8%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDN--GVTNEVSINTTDDVGIAAKMNSKTYTVDK 90
           NI VAVRCR   + E  + S  ++ + DN  G +NEV I   +  G       K YT+D 
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEV-IVLDESTG-----RKKIYTLDA 62

Query: 91  VFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD-EKLHNGELGDA 149
           V+G    QK +++E   P ++ F  GYN +I+ YG   +GK YT+ G+  +L N    ++
Sbjct: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAES 122

Query: 150 A--GIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTA---------TNS 198
              G++PRVL  LF  LE+N +D+++KCSFVE+YN+EL+DLL  T            T S
Sbjct: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGS 182

Query: 199 DNKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQMLRRKLGRHNTTGNSKISN 258
             KKLRI D                              A M+R+++G+ +   N+ ISN
Sbjct: 183 TGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTA-MMRKRMGKRSLPPNNSISN 241

Query: 259 N--NHNKFSRFKQTSQESTRAHASXXXXXXXXXXXXXXXXXXXXXXXDQSASIYIQNLEE 316
           N  N+N+ S  +  S       +S                       ++  SIYIQNL+E
Sbjct: 242 NTANNNRLSLSRTNSFSDYSLQSSH----------------------ERLNSIYIQNLQE 279

Query: 317 FHITSAMEXXXXXXXXXXXXXVAST----KMNDFSSRSHSIFTITLYKEQN-GELFRVSK 371
             IT   E             +AST      N+FS RSHSIF ITLYKE+   E+FR+SK
Sbjct: 280 ITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSK 339

Query: 372 MNLVDLAGSE----NISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKL 427
           ++ V+ AGSE    N S++GA N           +L +  ++IN + + S +  F +SKL
Sbjct: 340 LSFVNFAGSEYGDNNTSKNGAFNS----------NLQSFNKMINGMVNNSTYASFLDSKL 389

Query: 428 TRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVR 487
           T+LLQ++  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ I K+ L++
Sbjct: 390 TQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIK 449

Query: 488 SITSELAKIKSDLLSTKSKE-GVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAM 546
            +++EL K KSDLLS KS + G+YM  +HY +L   +E YK +++ SK +I  LT +   
Sbjct: 450 ILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNE 509

Query: 547 LQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKET---NIRSLLKDVQGANEEM 603
           ++ E+ + ++ N   +  + +L++ +  L  +L++Q  +E+   NI+  L  + G    M
Sbjct: 510 IRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILG---NM 566

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLXX 663
           +K++  +  K+  LQ  +      E+  ++++L+ +   ++N     +  ++ N+  +  
Sbjct: 567 QKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKA 626

Query: 664 XXXXXXXXXXXXXSKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723
                         +        +L  +P+ FE +   L N+ +  E NH+K +E LSD+
Sbjct: 627 EILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDI 686

Query: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783
           SEE+NNL  Y+ +NF K++HEEL+  ++  TY +++  S +  +NF  +LD ++++N + 
Sbjct: 687 SEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKS 746

Query: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843
           + ++I  +T E++ NEL  F  ++ KWE +S  I   ++ N S  +    N   +  ++S
Sbjct: 747 LSKSITSLTSEIVENELTQFNPEKKKWELASNEI--IENFNESITKNKNKNSEILAKLLS 804

Query: 844 SSRDNIGATISSIQSRTRNRQSIE---EMIQGNDVIRQQITRIKQKNKSLSLFKEHSTET 900
            S       I+++ S  +N + +E   E+   ND+I+ +   I  KNK L   K+  T+ 
Sbjct: 805 ESTSTSELFINNMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKL---KDLITDN 861

Query: 901 ATTSIGSVNKVEGNLKVIMDKVL 923
             +S  S++  + NLK  M  V 
Sbjct: 862 FNSSENSIDSFD-NLKEAMQNVF 883

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  232 bits (592), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 129/275 (46%), Positives = 182/275 (66%), Gaps = 20/275 (7%)

Query: 308 SIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTIT-----LYKEQ 362
           SI+++ +EE +I SA E             VA+TK ND SSRSH+IFTIT     ++   
Sbjct: 250 SIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTKIHPIS 309

Query: 363 NGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPF 422
             +  +V K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D S+HIP+
Sbjct: 310 GEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPY 369

Query: 423 RESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMK 482
           RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN PQ+   + K
Sbjct: 370 RESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVNQLMAK 429

Query: 483 DILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTE---LEESKRAIES 539
           +  +     E+ +++ +L ++ SKEG+Y++ E +       E Y++    +EE +  I++
Sbjct: 430 ESCIIEYIQEIERLRKELRASHSKEGIYITQEKF-------ETYESNSILVEEQQAKIDN 482

Query: 540 LTAQ-----NAMLQQERLSLKDDNACYKANIASLK 569
           L  Q        L+Q +L  + D    + ++A+ K
Sbjct: 483 LQEQLRRLKEKFLEQTKLIKEKDGQIKELDVANRK 517

 Score =  147 bits (370), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 105/168 (62%), Gaps = 17/168 (10%)

Query: 31  ELNILVAVRCRGRNEREIKAKSSVVVD-VPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89
           E NI V VRCR RNEREI+ KSSVV+  + +NG   EV I T    G     ++KTYT D
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNG--REV-ILTNPGTG-----SNKTYTFD 103

Query: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE---- 145
           +VFG  + Q+ ++ ++A     + I+GYNCT+  YG T TGKTYTM+GD  +        
Sbjct: 104 RVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDP 163

Query: 146 ----LGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL 189
               L + AGIIPRVL ELF  L    +DY VK SF+ELYNE+L+DLL
Sbjct: 164 NFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLL 211

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  232 bits (591), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 162/225 (72%), Gaps = 7/225 (3%)

Query: 306 SASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITL----YKE 361
           S SI ++ +EE +I SA E             VASTK ND SSRSH++FTIT        
Sbjct: 249 SHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDP 308

Query: 362 QNGELF-RVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHI 420
            +GE + +  K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D S+HI
Sbjct: 309 LSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 368

Query: 421 PFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFI 480
           P+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   +
Sbjct: 369 PYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSM 428

Query: 481 MKDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIEC 525
            KD  +     E+ +++ +L +T++K+G+Y++ E Y DL Y+  C
Sbjct: 429 TKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY-DL-YESNC 471

 Score =  149 bits (377), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 81/185 (43%), Positives = 111/185 (60%), Gaps = 10/185 (5%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V VRCR RN+REI  KSSVV+        + +  N +     +     KTYT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKL-----HNGE-- 145
           G  + Q++V+  +A+    + ++GYNCT+  YG T TGKTYTM+GD  +     HN +  
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 146 ---LGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKK 202
              L + AGIIPRVL +LF  L+    DY VK SF+ELYNE LKDLL  +N   +++ + 
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDDNNAES 233

Query: 203 LRIFD 207
           +RIFD
Sbjct: 234 IRIFD 238

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  232 bits (591), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/282 (45%), Positives = 183/282 (64%), Gaps = 17/282 (6%)

Query: 308 SIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTIT-----LYKEQ 362
           SI ++ +EE +I SA E             VA+T+ ND SSRSH+IFTIT     ++   
Sbjct: 254 SIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTKIHPIS 313

Query: 363 NGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPF 422
             +  ++ K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D S+HIP+
Sbjct: 314 GEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPY 373

Query: 423 RESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMK 482
           RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA++AK+IKN PQ+   + K
Sbjct: 374 RESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQINQLMAK 433

Query: 483 DILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTA 542
           +  +     E+ K++ +L +  +KEG+Y++ E Y+   Y+  C   E +++K  I++L  
Sbjct: 434 ESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYET--YESNCILVEEQQAK--IDNLQE 489

Query: 543 QNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQIT 584
           Q    +++ L         +  +   KD  V +  S+ E+IT
Sbjct: 490 QIKRFKEKYLE--------QTKLVKEKDTQVKMIKSINERIT 523

 Score =  145 bits (366), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/165 (47%), Positives = 100/165 (60%), Gaps = 15/165 (9%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V VRCR RN REIK KSSVVV     G      I +    G     N+KTYT D+VF
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTL--GSQGREIILSNQSTG-----NNKTYTFDQVF 108

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA--- 149
           G  + Q+ +++++A     + ++GYNCT+  YG T TGKTYTM+GD  +    L D    
Sbjct: 109 GVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYV 168

Query: 150 -----AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL 189
                AGIIPRVL ELF  L+   +DY VK SF+ELYNE+L+DLL
Sbjct: 169 LLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLL 213

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  227 bits (578), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 156/214 (72%), Gaps = 5/214 (2%)

Query: 307 ASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTI----TLYKEQ 362
           +SI ++ +EE +I SA E             VASTK+ND SSRSH+IFTI    T     
Sbjct: 338 SSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPV 397

Query: 363 NGELF-RVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIP 421
            G+ F +  K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D+S HIP
Sbjct: 398 TGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHHIP 457

Query: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIM 481
           +RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   + 
Sbjct: 458 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQSLS 517

Query: 482 KDILVRSITSELAKIKSDLLSTKSKEGVYMSHEH 515
           KD  +    +E+ +++++L   ++KEG+Y++ + 
Sbjct: 518 KDTFIHEYINEIDRLRNELKLARTKEGIYITQDQ 551

 Score =  122 bits (306), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 87/237 (36%), Positives = 115/237 (48%), Gaps = 64/237 (27%)

Query: 29  TEELNILVAVRCRGRNEREIKAKSSVVVDV-----------PD----------NGVTNEV 67
           T++ NI V VRCR R +REI  KSSVV+             P+          NG T   
Sbjct: 47  TKDDNIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTK 106

Query: 68  SINTTDDVGIAAKMNS------KTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTI 121
           +    ++    A  NS      +TYT DKVFG  + Q+ ++E +A+    + ++GYNCT+
Sbjct: 107 NNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTV 166

Query: 122 LVYGMTSTGKTYTMTGD-EKLHNGE------LGDAAGIIPRVLFELFDTLEAN------- 167
             YG T TGKTYTM+GD   L N +      LG+ AGIIPRVL  LF  L  N       
Sbjct: 167 FAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTK 226

Query: 168 ----------------------KDDYLVKCSFVELYNEELKDLLDSTNT-ATNSDNK 201
                                   +Y VK SF+ELYNE+L DLL +  T A NS++K
Sbjct: 227 VNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNSNDK 283

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  226 bits (576), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 157/219 (71%), Gaps = 8/219 (3%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLY---- 359
           + ++SI ++ ++E  I SA E             VA+TK ND SSRSH++FTIT      
Sbjct: 236 NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQ 295

Query: 360 ----KEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLAD 415
                 QN    ++ K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 296 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 416 KSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQ 475
            S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQ 415

Query: 476 LGAFIMKDILVRSITSELAKIKSDLLSTKSKEGVYMSHE 514
           +   + KD  ++    E+ K+K+DL ++++K+G++++ +
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

 Score =  132 bits (332), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 109/193 (56%), Gaps = 19/193 (9%)

Query: 28  ATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYT 87
            T + NI V VRCR RN+REI  KSSVV+          +  N +     ++K   KTY 
Sbjct: 47  TTSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQ 103

Query: 88  VDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD--------- 138
            D+VFG  + Q+ V+   A+   ++ + GYNCTI  YG T TGKTYTM+GD         
Sbjct: 104 FDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQS 163

Query: 139 -EKLHNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNT--- 194
            +KL    LG+ AGIIPRVL +LF  L     +Y VK SF+ELYNE LKDLL  ++    
Sbjct: 164 TDKL---LLGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDP 220

Query: 195 ATNSDNKKLRIFD 207
             N   +++RIFD
Sbjct: 221 VVNDTKRQIRIFD 233

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  226 bits (575), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/219 (52%), Positives = 159/219 (72%), Gaps = 8/219 (3%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITL----- 358
           + ++SI ++ ++E  I SA E             VA+TK ND SSRSH++FTIT      
Sbjct: 236 NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQ 295

Query: 359 -YKE--QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLAD 415
             KE  QN    ++ K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 296 DSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 416 KSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQ 475
            S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQ 415

Query: 476 LGAFIMKDILVRSITSELAKIKSDLLSTKSKEGVYMSHE 514
           +   + KD  ++    E+ K+++DL ++++K+G++++ +
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  152 bits (385), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 114/201 (56%), Gaps = 14/201 (6%)

Query: 18  PVQEPLVEKL-ATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVG 76
           PV  P+     AT E NI V VRCR RN REI  KSSVV+          +  N +    
Sbjct: 36  PVPPPICNNSNATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQSY 95

Query: 77  IAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMT 136
            ++K   KTY  D+VFG  + Q++V+   A+   ++ + GYNCTI  YG T TGKTYTM+
Sbjct: 96  SSSK---KTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMS 152

Query: 137 GD-------EKLHNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL 189
           GD       +   N  LG+ AGIIPRVL +LF  L +   +Y VK SF+ELYNE LKDLL
Sbjct: 153 GDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLL 212

Query: 190 ---DSTNTATNSDNKKLRIFD 207
              +  +   N   K++RIFD
Sbjct: 213 SDNEDDDPTANDSKKQIRIFD 233

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  226 bits (575), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 116/225 (51%), Positives = 160/225 (71%), Gaps = 9/225 (4%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLY---- 359
           + ++SI ++ ++E  I SA E             VA+TK ND SSRSH++FTIT      
Sbjct: 236 NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQ 295

Query: 360 ----KEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLAD 415
                 QN    ++ K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 296 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 416 KSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQ 475
            S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQ 415

Query: 476 LGAFIMKDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLH 520
           +   + KD  ++    E+ K+++DL ++++K+G++++ +   DL+
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQL-DLY 459

 Score =  140 bits (352), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 111/190 (58%), Gaps = 13/190 (6%)

Query: 28  ATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYT 87
           AT + NI V VRCR RN+REI+ KSSVV+          +  N +     ++K   KTY 
Sbjct: 47  ATSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQ 103

Query: 88  VDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD-------EK 140
            D+VFG  + Q+ V+   A+   ++ + GYNCTI  YG T TGKTYTM+GD       + 
Sbjct: 104 FDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQS 163

Query: 141 LHNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNT---ATN 197
             N  LG+ AGIIPRVL +LF  L +   +Y VK SF+ELYNE LKDLL  +     A N
Sbjct: 164 TDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVN 223

Query: 198 SDNKKLRIFD 207
              +++RIFD
Sbjct: 224 DPKRQIRIFD 233

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  225 bits (574), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 155/216 (71%), Gaps = 8/216 (3%)

Query: 307 ASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLY------- 359
           +SI ++ ++E  I SA E             VA+TK ND SSRSH++FTIT         
Sbjct: 238 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 297

Query: 360 -KEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSE 418
              QN    ++ K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D S 
Sbjct: 298 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 357

Query: 419 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGA 478
           HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN PQ+  
Sbjct: 358 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 417

Query: 479 FIMKDILVRSITSELAKIKSDLLSTKSKEGVYMSHE 514
            + KD  ++    E+ K+++DL ++++K+G++++ +
Sbjct: 418 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 453

 Score =  153 bits (387), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 115/200 (57%), Gaps = 13/200 (6%)

Query: 18  PVQEPLVEKLATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGI 77
           PV  P+    AT + NI V VRCR RN+REI  KSSVV+          +  N +     
Sbjct: 36  PVTPPIYNSAATSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYS 95

Query: 78  AAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTG 137
           ++K   KTY  D+VFG  + Q+ V+   A+   ++ + GYNCTI  YG T TGKTYTM+G
Sbjct: 96  SSK---KTYQFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSG 152

Query: 138 D-------EKLHNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL- 189
           D       +   N  LG+ AGIIPRVL +LF  L +   +Y VK +F+ELYNE LKDLL 
Sbjct: 153 DINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLS 212

Query: 190 --DSTNTATNSDNKKLRIFD 207
             +  + A N   +++RIFD
Sbjct: 213 DNEDDDPAVNDSKRQIRIFD 232

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  223 bits (568), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 156/214 (72%), Gaps = 5/214 (2%)

Query: 309 IYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQ-----N 363
           I ++ +EEF+I SA E             VA+TK ND SSRSH++FTIT    +     N
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
            +  ++ K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D S+HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
           ESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYK 517
             +     E+ +++ +L +++ KEG+Y++ + ++
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

 Score =  144 bits (363), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 114/184 (61%), Gaps = 19/184 (10%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSK-TYTVDKV 91
           N+ V VRCR RNE+EI+ KSSVV+         EV ++     G  +  +SK TYT D+V
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTL-GAKGREVILSN----GAGSLSHSKRTYTFDQV 95

Query: 92  FGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE------ 145
           FG  + Q+ V++E+A+    + ++GYNCT+  YG T TGKTYTM+GD  +  G+      
Sbjct: 96  FGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISIL-GDLDSQDK 154

Query: 146 --LGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKL 203
             LG+ +GIIPRVL +LF  L    ++Y VK SF+ELYNE+LKDLL      +  + + +
Sbjct: 155 ILLGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLL----AESEQEEENI 210

Query: 204 RIFD 207
           RIFD
Sbjct: 211 RIFD 214

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  222 bits (566), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 118/220 (53%), Positives = 158/220 (71%), Gaps = 6/220 (2%)

Query: 306 SASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTI----TLYKE 361
           S+SI ++ +EE +I SA E             VASTK ND SSRSH++FTI    T    
Sbjct: 286 SSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDP 345

Query: 362 QNGELF-RVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHI 420
            +GE + +  K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D S+HI
Sbjct: 346 ISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 405

Query: 421 PFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFI 480
           P+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AK+IKN PQ+   +
Sbjct: 406 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSM 465

Query: 481 MKDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLH 520
            KD  +    SE+ +++ +L +++ K+G+ ++ +   DL+
Sbjct: 466 SKDTCINEYVSEIERLRLELKTSRQKDGICITQDQL-DLY 504

 Score =  142 bits (357), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 106/182 (58%), Gaps = 16/182 (8%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V VRCR R+EREIK KSSVV+          +  N +  +    K    +Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPKK----SYSFDRVF 163

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD-EKLHNGE------ 145
           G  + Q+ V+ + A+    + + GYNCT+  YG T TGKTYTM+GD   L N E      
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 146 LGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRI 205
           LG+ AGIIPRVL  LF  L A ++DY VK SF+ELYNE LKDL         S+ + +RI
Sbjct: 224 LGEHAGIIPRVLVNLFKML-ALENDYSVKISFLELYNERLKDLF----AQNESEEETIRI 278

Query: 206 FD 207
           FD
Sbjct: 279 FD 280

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  221 bits (564), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 120/219 (54%), Positives = 161/219 (73%), Gaps = 6/219 (2%)

Query: 307 ASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQ---- 362
           +SI ++ +EE +I SA E             VASTK ND SSRSH+IFTIT    +    
Sbjct: 252 SSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKIDPV 311

Query: 363 NGELF-RVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIP 421
           +GE + ++ K+NLVDLAGSENISRSGA N RA+EAG IN+SLLTLGRVIN+L D S+HIP
Sbjct: 312 SGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQHIP 371

Query: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIM 481
           +RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   + 
Sbjct: 372 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQSMS 431

Query: 482 KDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLH 520
           KD+ +     E+ +++ +L +++ K+GVY++ E + DL+
Sbjct: 432 KDVCINEYVQEIERLRQELKASRQKDGVYITQEQF-DLY 469

 Score =  142 bits (359), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 103/182 (56%), Gaps = 15/182 (8%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V VRCR RN+REI+ KSSVV+         EV ++    V    K   KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTM-GAQGKEVVLSDPSSVLSHTK---KTYIFDQVF 114

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD-------EKLHNGE 145
           G  + Q++V+   A+    + ++GYNCTI  YG T TGKTYTM+GD       E      
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 146 LGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRI 205
           LG+ AGIIPRVL  LF  L     +Y VK SF+ELYNE LKDLL  +     S    +RI
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETEES----IRI 230

Query: 206 FD 207
           FD
Sbjct: 231 FD 232

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  219 bits (559), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 159/220 (72%), Gaps = 6/220 (2%)

Query: 306 SASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITL----YKE 361
           S+SI ++ +EE +I SA +             VA+TK ND SSRSH++FTIT        
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 362 QNGELF-RVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHI 420
            +GE + +  K+NLVDLAGSENI+RSGA N+RA+EAG IN+SLLTLGRVIN+L D ++HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 421 PFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFI 480
           P+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   +
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 481 MKDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLH 520
            KD  +     E+ +++ +L +++ K+G+ ++ + + DL+
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQF-DLY 457

 Score =  150 bits (379), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 111/182 (60%), Gaps = 16/182 (8%)

Query: 34  ILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFG 93
           I V VRCR RNEREI+ KSSVV+       + ++ ++        AK   +TYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK---RTYTFDRVFG 117

Query: 94  PSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE-------- 145
             + Q+ V+ + A+    + ++GYNCT+  YG T TGKTYTM+GD  +  G+        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 146 LGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRI 205
           LG+ AGIIPRVL ELF  L+ N + Y VK SF+ELYNE LKDLL S      S+ + +RI
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGN-EGYSVKVSFLELYNERLKDLLAS----EQSEEENIRI 232

Query: 206 FD 207
           FD
Sbjct: 233 FD 234

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  219 bits (558), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 119/240 (49%), Positives = 166/240 (69%), Gaps = 9/240 (3%)

Query: 309 IYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQ----NG 364
           I ++ +EE +I SA E             VA+TK ND SSRSH+IFTI  +  +    +G
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 365 ELF-RVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423
           E + ++ K+NLVDLAGSENI+RSGA N RA+EAG IN+SLLTLGRVIN+L + S HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483
            SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA++AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543
             +     E+ +++ +L +++ +EG+Y++ E Y DL+   E     +EE K  I+++  Q
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY-DLY---ESNSLLVEEQKVVIQNMGEQ 503

 Score =  145 bits (366), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 106/183 (57%), Gaps = 17/183 (9%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V VRCR RN+REI  KSSVVV        + +  N +  +    K    TY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLSHPKK----TYMFDEVF 99

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE------- 145
           G  + Q+ ++ E+A+   Q+ ++GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIW-GDLDSQDKI 158

Query: 146 -LGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLR 204
            LG+ AGIIPRVL  LF  L     ++ VK SF+ELYNE LKDLL       +SD   +R
Sbjct: 159 LLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLL----ADNDSDEDNIR 214

Query: 205 IFD 207
           IFD
Sbjct: 215 IFD 217

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  167 bits (423), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 115/277 (41%), Positives = 163/277 (58%), Gaps = 42/277 (15%)

Query: 307 ASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTIT-----LYKE 361
           +SI ++ ++E  I +AME             V STK+ND SSRSH+IFTIT     L  +
Sbjct: 206 SSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQ 265

Query: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEH-- 419
            N E  ++ K+NLVDLAGSENI++SG   +R++E G IN+SLLTLGRVIN+L+DK+ +  
Sbjct: 266 TNKEYIKIGKLNLVDLAGSENITKSGL--KRSQETGLINKSLLTLGRVINALSDKTNNTH 323

Query: 420 ----------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEET 457
                                 IP+RESKLTRLLQDSLGG TKT +IATISPAK   +ET
Sbjct: 324 GSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDET 383

Query: 458 CSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDL-LSTKSKEGVYMSHEHY 516
            STLEYA++A +IKN P++         +    +++ ++K +L  ST    G+++  E  
Sbjct: 384 ISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIGGIFIPLEK- 442

Query: 517 KDLHYDIECYKTE---LEESKRAIESLTAQNAMLQQE 550
             L+Y    YK+    +EE    I ++T Q A  +++
Sbjct: 443 --LNY----YKSNEILIEEQNAKINNMTNQIAKFKKK 473

 Score =  137 bits (346), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 114/208 (54%), Gaps = 36/208 (17%)

Query: 26  KLATEELNILVAVRCRGRNEREIKAKSSVVVD-VPDNGVTNEVSINTTDDVGIAAKMNSK 84
           K  T   NI V VRCR RN++EI  KSSVVV  +  NG          + + I+   N  
Sbjct: 2   KTITHNSNIKVYVRCRSRNQKEIDEKSSVVVSTLGQNG----------NQIIISNSTNKN 51

Query: 85  TYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKL--- 141
            Y  D VFG  + Q+ ++  +A    Q+ I GYNCT+  YG T TGKTYTM+GD  +   
Sbjct: 52  KYIFDNVFGVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGD 111

Query: 142 ----HNGELGDAAGIIPRVLFELFDTLE---ANKDD-----YLVKCSFVELYNEELKDLL 189
                N  LG+ AGIIPRVL +LF +LE   +N+ +     Y VK SF+ELYNE LKDLL
Sbjct: 112 LNSTKNILLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL 171

Query: 190 DS-----TNTATNSDN-----KKLRIFD 207
            +      N+ ++S N       ++IFD
Sbjct: 172 SADADLPPNSGSSSANDPSVSSNIKIFD 199

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  134 bits (336), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 110/175 (62%), Gaps = 8/175 (4%)

Query: 308 SIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGELF 367
           + +++ L+EF + S  E             V +T +N+ SSRSH+IFTI + +++N  L 
Sbjct: 167 TTFVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLG 226

Query: 368 RV----SKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEH--IP 421
            V    S + L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K +   IP
Sbjct: 227 HVLERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIP 286

Query: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQL 476
           +R++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL
Sbjct: 287 YRDAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 84/170 (49%), Gaps = 29/170 (17%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V+VR R   ERE  A+  +   V +N +  E           A +  ++ +  D   
Sbjct: 4   NIKVSVRLRKPLERE-SAERVIAQVVSENLIKVEQR---------AKREETRNFEFDLCC 53

Query: 93  GPSAS----QKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGD 148
             S S    Q  +YE++A       + GYN  I  YG T +GK++TMTG  +L       
Sbjct: 54  TYSESLEEDQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL------- 106

Query: 149 AAGIIPRVLFELFDTLEA--NKDD-----YLVKCSFVELYNEELKDLLDS 191
             GI+PR+  ELF+  E   + DD     + ++CS++E+YNE ++DLL +
Sbjct: 107 -PGIVPRMCQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLLGA 155

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  132 bits (332), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 76/177 (42%), Positives = 110/177 (62%), Gaps = 8/177 (4%)

Query: 308 SIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN---G 364
           + +++ L EF +    E             V  T MN+ SSRSH+IFTI++ + +    G
Sbjct: 196 TTFVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAG 255

Query: 365 ELF-RVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEH--IP 421
           +L  R S + LVDLAGSE +S +GA   R KE  +IN+SL TLGRV++ LA K+    IP
Sbjct: 256 DLTERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIP 315

Query: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGA 478
           +R+S LT +L+++LGGN+KT +IA +SP     EET STL YA+ AK +KN  ++ +
Sbjct: 316 YRDSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKNTARVNS 370

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 88/194 (45%), Gaps = 29/194 (14%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI VAVR R    RE        V  P + V  +  I+T+  +        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 93  ----GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDE---KLHNGE 145
                 S  Q+++Y+ I        + GYN  IL YG T +GK++TM G E     HN +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 146 LG-------DAAGIIPRVLFELFDTL-------EANKDDYLVKCSFVELYNEELKDLLDS 191
                     A GIIPRV  +LFD         +  K  + + CS++E+YNE+++DLL  
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL-- 180

Query: 192 TNTATNSDNKKLRI 205
                + D  K R+
Sbjct: 181 -----SEDGSKCRV 189

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  128 bits (322), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 109/177 (61%), Gaps = 8/177 (4%)

Query: 308 SIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGELF 367
           + +++ L EF ++S  +             + ST +N++SSRSH+IFTI++ +++   L 
Sbjct: 167 TTFVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALG 226

Query: 368 RV----SKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEH--IP 421
            V    S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA + +   IP
Sbjct: 227 HVIERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIP 286

Query: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGA 478
           +R++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL A
Sbjct: 287 YRDAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQLNA 341

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 85/170 (50%), Gaps = 29/170 (17%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI VAVR R   ERE+    S++  V D  V      N         K  ++++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVEDGNVIQVKDRNQ--------KNETRSFHFDQCF 53

Query: 93  GPS----ASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGD 148
             S    A Q  +YE+++       + GY+  +  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGSP--------E 105

Query: 149 AAGIIPRVLFELFDTLEA--NKDD-----YLVKCSFVELYNEELKDLLDS 191
           + GI+ R+  ELF+  E   + DD     + ++CS++E+YNE ++DLL +
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGT 155

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  126 bits (316), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 131/220 (59%), Gaps = 17/220 (7%)

Query: 310 YIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGELFRV 369
           ++Q++  F +    E             VAST+MN  SSRSH+IFT+++ +++     R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 370 SKMNLVDLAGSENISRSGAMN--QRAKEAGSINQSLLTLGRVINSLADKSEH-IPFRESK 426
           S + LVDLAGSE  + +  ++  +R KE  +IN+SL TLGR I+ LA  S+H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 427 LTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFI------ 480
           LT +L+++LGGN+KT +IA ISP  +  EE+ STL YA+ AK IK +  +   +      
Sbjct: 269 LTWVLKENLGGNSKTCMIACISPIDL--EESLSTLRYATTAKEIKLRATMNEIVPNINED 326

Query: 481 MKDILVRSITS--ELAKIKSDLLSTKSKEGV----YMSHE 514
           MK  +  + +S  EL  +KS++ S +S+  +    + +HE
Sbjct: 327 MKAAVEAAASSRKELEMLKSEMSSLQSEYNIKSEQWKTHE 366

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 9/120 (7%)

Query: 84  KTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHN 143
           +++  D +F  S+SQ  +  E+        ++GYN  I  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 144 GELGDAAGIIPRVLFELFDTLEANKDDY-LVKCSFVELYNEELKDLLDSTNTATNSDNKK 202
                  GIIP +  +LFD LE +K     V  ++ E+YNE+L DLL  T+      N K
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGDTSPRVRETNDK 146

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  125 bits (315), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 102/177 (57%), Gaps = 14/177 (7%)

Query: 307 ASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYK----EQ 362
           + IY++ L   ++TS  E             V+ST MN  SSRSHSI  I L K    E+
Sbjct: 195 SGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEE 254

Query: 363 NGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLAD------- 415
           N    + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L         
Sbjct: 255 N---IQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKR 311

Query: 416 KSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKN 472
            S HIP+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL + S+AK IKN
Sbjct: 312 TSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 68/111 (61%), Gaps = 11/111 (9%)

Query: 82  NSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 141
           N + +T D+VF   ++Q+ VYE +A  + + F +GYN TIL YG T +GK++TM G +  
Sbjct: 71  NDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFGPK-- 128

Query: 142 HNGELGDAAGIIPRVLFELFDTLE-ANKDD--YLVKCSFVELYNEELKDLL 189
                 +  G+IPR+  ++F  +E  + +D  + V  SF+E+Y E++ DLL
Sbjct: 129 ------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLL 173

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  122 bits (305), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 159/305 (52%), Gaps = 24/305 (7%)

Query: 309 IYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGE-LF 367
           +Y+Q+     ++   E              +ST MN  SSRSH+I  I L K  N E   
Sbjct: 216 VYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGSI 275

Query: 368 RVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSE---HIPFRE 424
           + S + LVDLAGSE +S++ A+    +EA  IN SL +LG VIN+L  K +   HIP+R+
Sbjct: 276 QKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPYRD 335

Query: 425 SKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQL--GAFIMK 482
           S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I+NK  +      +K
Sbjct: 336 SQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENKAIVNRSDLFLK 395

Query: 483 DILVRSIT----------SELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEE 532
             L R I           + +  ++ ++L+ ++      S +       DIE   T+L+ 
Sbjct: 396 KKLERQIALLEKREQEYQNRITLLEHEVLALRANNIRAPSPD-----TEDIETENTKLKA 450

Query: 533 SKRAIESLTAQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSL 592
              +++S+ +    L+ E+    DD     + +    + VV LQ+ L +Q+ KET ++ +
Sbjct: 451 QMDSLKSILSSGGSLEGEQHISTDD---LLSKLMEKCELVVDLQARLDDQLDKETALKRM 507

Query: 593 LKDVQ 597
           + D++
Sbjct: 508 MDDLR 512

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 94/167 (56%), Gaps = 24/167 (14%)

Query: 33  NILVAVRCRGRNEREIKAKSSVV------VDVPDNGVTNEVSINTTDDVGIAAKMNSKTY 86
           N+ V VR +  +  E +   +VV      V+ P+N    + S  +T+  G+  +  S+++
Sbjct: 34  NVKVMVRLKPIDAPEKQYNVAVVALDESTVEFPNN----DTSPGSTN--GVQGESPSRSF 87

Query: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146
             D VFG +++Q  VY+ +AE +   F  GYN TIL YG T +GK+YTM G         
Sbjct: 88  HFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPI------- 140

Query: 147 GDAAGIIPRVLFELFD---TLEANKD-DYLVKCSFVELYNEELKDLL 189
            D  G+IPR+  E+F+    L+++ D +Y+V  SF+E+Y E++ DLL
Sbjct: 141 -DNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLL 186

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  119 bits (297), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/138 (50%), Positives = 92/138 (66%), Gaps = 3/138 (2%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKEQNGEL-FRVSKMNLVDLAGSENISRSGAMNQRAKEAG 397
            ST MN  SSRSH+I  I L K  N E   + S + LVDLAGSE ++++ A+    +EA 
Sbjct: 219 GSTDMNLESSRSHAIVKINLLKRDNLEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAK 278

Query: 398 SINQSLLTLGRVINSLADKSE--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSE 455
            IN SL +LG VIN+L  K +  HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    
Sbjct: 279 KINLSLSSLGNVINALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNES 338

Query: 456 ETCSTLEYASKAKNIKNK 473
           ET +TL + S+AK+IKNK
Sbjct: 339 ETLTTLRFGSRAKHIKNK 356

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 86/163 (52%), Gaps = 20/163 (12%)

Query: 51  KSSVVV---DVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAE 107
           K  VVV    +P+ G    V+ +        A   ++ +  D VFG  A Q+ V++ +AE
Sbjct: 22  KMKVVVRLRPLPEGGSAAVVAADEGTVEFAGAADEARAFRFDYVFGTDARQEEVFDYVAE 81

Query: 108 PLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEAN 167
            +   F  GYN TIL YG T +GK+YTM G    H        G+IPR+  ++F+ +   
Sbjct: 82  EMLDQFFTGYNSTILAYGQTGSGKSYTMFGPPG-HR-------GLIPRICQQIFERIGLL 133

Query: 168 KD----DYLVKCSFVELYNEELKDLL-DSTNTAT----NSDNK 201
           K+    +Y+V  SF+E+Y E++ DLL +S N A+    NSD +
Sbjct: 134 KNCADIEYVVSVSFLEIYLEKVYDLLGESINKASSPKKNSDKR 176

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  112 bits (281), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 102/172 (59%), Gaps = 7/172 (4%)

Query: 310 YIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQ----NGE 365
           YI+ L +  + S  E             VA T +N+ SSRSH+I TI + + +       
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 366 LFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLA-DKSEHIPFRE 424
           + RVS + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L+ +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 425 SKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQL 476
           S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHL 342

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 83/166 (50%), Gaps = 23/166 (13%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI VA+R R +  RE    S     V     +NE+++   +   +   +   T+  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPS-----VIKRKTSNEITLQKDNTANVITTVE-HTFYFDQVF 57

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGI 152
             S++QK +Y E+A       ++GY+  ++ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 153 IPRVLFELFDTLEANKDD---------YLVKCSFVELYNEELKDLL 189
           IP V  ELF  ++  +D+         + V  S+ ++YNE++ D+L
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML 155

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 101/180 (56%), Gaps = 12/180 (6%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D  + I + NL   H T+  +              + T+ N+ SSRSH++  I +   Q 
Sbjct: 264 DTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM--QT 321

Query: 364 GELFRVSK------MNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLA--- 414
            +L  ++       ++++DLAGSE  + +     R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 415 -DKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
             +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382 GSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 59/106 (55%), Gaps = 10/106 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F  ++SQ  VY+E   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTP------ 206

Query: 146 LGDAAGIIPRVLFELFDTLEANKDD--YLVKCSFVELYNEELKDLL 189
                GII   + ELF+ +   +D+  + +  S++E+YNE ++DLL
Sbjct: 207 --SQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  111 bits (277), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 100/180 (55%), Gaps = 12/180 (6%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D    I + NL   H T+  +              + T+ N+ SSRSHS+  I +   Q 
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIM--QT 321

Query: 364 GELFRVSK------MNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLA--- 414
            +L  ++       ++++DLAGSE  S +     R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 415 -DKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
             ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382 GSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F  ++SQ  VY+E   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTP------ 206

Query: 146 LGDAAGIIPRVLFELFDTLEANKDD--YLVKCSFVELYNEELKDLL 189
                GII   + ELF+ +   KD+  + +  S++E+YNE + DLL
Sbjct: 207 --SQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 91/144 (63%), Gaps = 9/144 (6%)

Query: 339 ASTKMNDFSSRSHSIFTITLY-KEQNGEL---FRVSKMNLVDLAGSENISRSGAMNQRAK 394
           ++T  N+ SSRSH++  + +  K +  EL    + + ++L+DLAGSE  S +    +R  
Sbjct: 271 SATDANETSSRSHAVLQVHITQKNRTAELTEDHKFATLSLIDLAGSERASATKNRGERLH 330

Query: 395 EAGSINQSLLTLGRVINSLADKSE-----HIPFRESKLTRLLQDSLGGNTKTALIATISP 449
           E  +IN+SLL LG  IN+L    +     H+P+R+SKLTRLL+ SLGGN KT +I  ISP
Sbjct: 331 EGANINRSLLALGNCINALCAGGKRGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISP 390

Query: 450 AKMTSEETCSTLEYASKAKNIKNK 473
                +ET +TL+YA++AK IK K
Sbjct: 391 TSNHYDETLNTLKYATRAKEIKTK 414

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 66/130 (50%), Gaps = 15/130 (11%)

Query: 68  SINTTDDVGIAAKMNSK-----TYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTIL 122
           SI T         MNS+      +  D+VF   ASQ+ VYE    PL    + G+N T+ 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 123 VYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVEL 180
            YG T  GKTYT++G          +  GII   + ELF  +E  KD   + +  S++E+
Sbjct: 162 AYGATGCGKTYTVSGT--------AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEI 213

Query: 181 YNEELKDLLD 190
           YNE ++DLL+
Sbjct: 214 YNESIRDLLE 223

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 94/144 (65%), Gaps = 9/144 (6%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKE-QNGEL---FRVSKMNLVDLAGSENISRSGAMNQRAK 394
           ++T  N+ SSRSH++  I + +  +  E+      +K++++DLAGSE  + +    +R +
Sbjct: 275 SATDANETSSRSHAVLQINIVQSSRTAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQ 334

Query: 395 EAGSINQSLLTLGRVINSLA-----DKSEHIPFRESKLTRLLQDSLGGNTKTALIATISP 449
           E  +IN+SLL LG  IN+L       ++ H+P+R+SKLTRLL+ SLGGN KT +I  +SP
Sbjct: 335 EGANINRSLLALGNCINALCISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSP 394

Query: 450 AKMTSEETCSTLEYASKAKNIKNK 473
           +    +ET +TL+YA++AK IK K
Sbjct: 395 SSTHYDETLNTLKYANRAKEIKTK 418

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F  +A+Q+ VY      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGTP------ 182

Query: 146 LGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVELYNEELKDLL 189
             +  G+I   + ELF  +E  +D   + +  S++E+YNE ++DLL
Sbjct: 183 --ERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  109 bits (273), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 100/179 (55%), Gaps = 9/179 (5%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLY-KEQ 362
           D    I + NL    +++  +              ++T  N+ SSRSH++  + +  + +
Sbjct: 236 DSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNR 295

Query: 363 NGEL---FRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSE- 418
             EL    + + ++L+DLAGSE  S +    +R  E  +IN+SLL LG  IN+L      
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRK 355

Query: 419 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
               H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 356 RGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D+VF   +SQ  VYE    PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGTP------ 178

Query: 146 LGDAAGIIPRVLFELFDTLEANKDD--YLVKCSFVELYNEELKDLLD 190
             +  GII   + ELF  +E  +D   + +  S++E+YNE ++DLL+
Sbjct: 179 --ENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 99/179 (55%), Gaps = 9/179 (5%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D + SI + NL  ++     +              ++T  N+ SSRSH++  I + +   
Sbjct: 239 DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 364 GELFR----VSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLA----- 414
               +     + ++++DLAGSE  + +     R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGT 358

Query: 415 DKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
            +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 359 RRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 67/124 (54%), Gaps = 15/124 (12%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D++F   ++QK VYE    PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGSP------ 181

Query: 146 LGDAAGIIPRVLFELFDTLEANKDD--YLVKCSFVELYNEELKDLLDSTNTATNSDNKKL 203
             +  GII + + ELF+ +E  KD   + +  SF+E+YNE ++DLL        + +KKL
Sbjct: 182 --ENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL-----CPETSSKKL 234

Query: 204 RIFD 207
            I +
Sbjct: 235 VILE 238

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 102/178 (57%), Gaps = 8/178 (4%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYK--- 360
           DQ++ I + NL      +  +              + T+ N+ SSRSHS+  I + +   
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 361 --EQNGELFRV-SKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLA--D 415
             +  G   ++ S ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 416 KSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
           KS HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK IK K
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F   ++Q+ ++E+   PL    + G+N T+  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 146 LGDAAGIIPRVLFELFDTLE-----ANKDDYLVKCSFVELYNEELKDLL 189
             +  GII R + ELF  +E     +N+    +  S++E+YNE ++DLL
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/173 (39%), Positives = 100/173 (57%), Gaps = 11/173 (6%)

Query: 308 SIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN---- 363
           S +++ LEE  + +  E             V ST MN  SSRSH+IF I++ +++     
Sbjct: 177 STFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKT 236

Query: 364 GELFRV-SKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLAD----KSE 418
           G +    S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    +S+
Sbjct: 237 GTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQ 296

Query: 419 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIK 471
            IP+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS  K +K
Sbjct: 297 MIPYRESALTWILKENLGGNSNTCLVACVSPENYY--ESLSTLRYASLTKKVK 347

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 65/122 (53%), Gaps = 21/122 (17%)

Query: 83  SKTYTVDKVFGPSAS----QKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD 138
           +K +  D  FG + S    Q ++YE +        ++GYN  IL YG T +GKT+TM   
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMM-- 106

Query: 139 EKLHNGELGDAAGIIPRVLFELFDTLE-ANKD--------DYLVKCSFVELYNEELKDLL 189
                GE G+  GI+PR   ELF+     ++D        D+ VKCSF E+YNE++ DLL
Sbjct: 107 -----GEKGN-EGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

Query: 190 DS 191
            S
Sbjct: 161 SS 162

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 97/182 (53%), Gaps = 15/182 (8%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITL--YKE 361
           DQS   Y+ N++ F I +  +              +ST +N  SSRSH IF I L  Y  
Sbjct: 557 DQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNH 616

Query: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSL-------- 413
           +  E   +SK+NLVDLAGSE I+ S     R KE  SIN+SL  LG VI++L        
Sbjct: 617 KTNEKC-ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 414 ----ADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKN 469
                 K+ HIPFR SKLT LL+ SL G++KT +   +S  +    ET ++L +A+K  N
Sbjct: 676 NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 470 IK 471
            K
Sbjct: 736 TK 737

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 57/113 (50%), Gaps = 16/113 (14%)

Query: 82  NSKTYTV--DKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDE 139
           N+ TY+   D VF        V+ EI E L Q  + GYN  I  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 140 KLHNGELGDAAGIIP---RVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL 189
                 L    G+IP   + +F   D+L+ N  +Y V C F+ELYNE + DL 
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLF 539

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 93/145 (64%), Gaps = 10/145 (6%)

Query: 339 ASTKMNDFSSRSHSIFTITLYK-EQNGEL---FRVSKMNLVDLAGSENISRSGAMNQRAK 394
           + T+ N+ SSRSH++  I + +  +  +L      + ++++DLAGSE  + +    +R  
Sbjct: 297 SPTEANEVSSRSHAVLQIHIMQTNRTADLTSEHTFATLSIIDLAGSERAAATKNRGERLY 356

Query: 395 EAGSINQSLLTLGRVINSLA------DKSEHIPFRESKLTRLLQDSLGGNTKTALIATIS 448
           E  +IN+SLL LG  IN+L       ++S HIP+R+SKLTRLL+ SLGGN KT +I  IS
Sbjct: 357 EGANINRSLLALGNCINALCLTDGGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCIS 416

Query: 449 PAKMTSEETCSTLEYASKAKNIKNK 473
           P+    +ET +TL+YA++AK IK K
Sbjct: 417 PSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F   ASQ+ VY+     L    + G+N T+  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGTP------ 204

Query: 146 LGDAAGIIPRVLFELFDTLEANKDD--YLVKCSFVELYNEELKDLL 189
             +  GII RV+ ELF+ +E  KD   + +  S++E+YNE ++DLL
Sbjct: 205 --EQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 100/180 (55%), Gaps = 12/180 (6%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D    I + NL   H T+  +              + T+ N+ SSRSH++  I +   Q 
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM--QT 321

Query: 364 GELFRVSK------MNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLA--- 414
            +L  ++       ++++DLAGSE  + +     R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLND 381

Query: 415 -DKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
             ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382 GSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F  ++SQ  VY+E   PL    + GYN T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGTP------ 206

Query: 146 LGDAAGIIPRVLFELFDTLEANKDD--YLVKCSFVELYNEELKDLL 189
                G+I   + ELF+ ++  KD+  + +  S++E+YNE ++DLL
Sbjct: 207 --SQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 85/138 (61%), Gaps = 4/138 (2%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKEQNGELFRVSK-MNLVDLAGSENISRSGAMNQRAKEA 396
            AST  N+ SSRSHSIF I L  +  G   +    +NLVDLAGSE ++ S  + +R +E 
Sbjct: 550 TASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRET 609

Query: 397 GSINQSLLTLGRVI---NSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMT 453
            SIN+SL  LG VI   NS   +  HIPFR SKLT LLQ SL G++KT +   ISPA + 
Sbjct: 610 QSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALH 669

Query: 454 SEETCSTLEYASKAKNIK 471
             ET ++L +ASK  N K
Sbjct: 670 LNETINSLRFASKVNNTK 687

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 60/124 (48%), Gaps = 19/124 (15%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F    +   +++E+ + L Q  + GYN  I  YG T +GKTYTM          
Sbjct: 397 FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 445

Query: 146 LGDAAGIIPRV---LFELFDTLEANKDDYLVKCSFVELYNEELKDLLDST-----NTATN 197
           L    GI+P     +F   D L A    Y V C F+E+YNE + DLL S      N   N
Sbjct: 446 LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLLRSGAPSQENNDRN 505

Query: 198 SDNK 201
           +D+K
Sbjct: 506 ADSK 509

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 89/143 (62%), Gaps = 8/143 (5%)

Query: 339 ASTKMNDFSSRSHSIFTITLY-KEQNGEL---FRVSKMNLVDLAGSENISRSGAMNQRAK 394
           + T  N+ SSRSH++  I +  K +  EL      + ++++DLAGSE  S +    +R  
Sbjct: 282 SPTDANETSSRSHAVLQINVVQKNRTAELSEAHTFATLSIIDLAGSERASATKNRGERLH 341

Query: 395 EAGSINQSLLTLGRVINSLADKSE----HIPFRESKLTRLLQDSLGGNTKTALIATISPA 450
           E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGGN KT +I  I+P+
Sbjct: 342 EGANINRSLLALGNCINALCVSGRRSTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPS 401

Query: 451 KMTSEETCSTLEYASKAKNIKNK 473
               +ET +TL+YA++AK IK K
Sbjct: 402 SAHYDETLNTLKYANRAKEIKTK 424

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F   A+Q  VYE    PL    + G+N T+  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGTP------ 189

Query: 146 LGDAAGIIPRVLFELFDTLEANKDD--YLVKCSFVELYNEELKDLL 189
             +  G+I   + ELF  +E  KD   + +  S++E+YNE ++DLL
Sbjct: 190 --EQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 99/180 (55%), Gaps = 12/180 (6%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D    I + NL   H  +  +              + T+ N+ SSRSH++  I +   Q 
Sbjct: 264 DTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM--QT 321

Query: 364 GELFRVSK------MNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLA--- 414
            +L  ++       ++++DLAGSE  + +     R  E  +IN+SLL LG  IN+L    
Sbjct: 322 NKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 415 -DKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
             +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382 GSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 59/106 (55%), Gaps = 10/106 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F  ++SQ  VY+E   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPS----- 207

Query: 146 LGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVELYNEELKDLL 189
                GII   + ELF+ +   KD  D+ +  S++E+YNE ++DLL
Sbjct: 208 ---QPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 103/184 (55%), Gaps = 15/184 (8%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D+ + I + NL   +  S  +              +ST+ N+ SSRSH++  I +  + N
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIM-QTN 360

Query: 364 GELFRVSK-----MNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSE 418
            ++   S+     ++++DLAGSE  + +    +R  E  +IN+SLL LG  IN+L   + 
Sbjct: 361 TKIDLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTN 420

Query: 419 ---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKN 469
                    HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK 
Sbjct: 421 NTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKE 480

Query: 470 IKNK 473
           IK K
Sbjct: 481 IKTK 484

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (55%), Gaps = 10/113 (8%)

Query: 79  AKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD 138
           AK N   +  DK+F  ++SQ  VY      L    + G+N T+  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 139 EKLHNGELGDAAGIIPRVLFELFDTLEANKDD--YLVKCSFVELYNEELKDLL 189
           +        +  GII RV+ ELF+ +E  KD+  + +  S++E+YNE + DLL
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 96/180 (53%), Gaps = 10/180 (5%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D    I + NL +   T+  E              + T+ N+ SSRSH++  I + ++  
Sbjct: 267 DTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNR 326

Query: 364 G----ELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSE- 418
                E      ++++DLAGSE  + +     R  E  +IN+SLL LG  IN+L      
Sbjct: 327 TPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGND 386

Query: 419 -----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
                H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 387 ERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F   A+Q+ VY+     L    + G+N T+  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGTP------ 209

Query: 146 LGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVELYNEELKDLL 189
             +  GI+ + + ELF  +E  KD   + +  SF+E+YNE ++DLL
Sbjct: 210 --ENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 89/144 (61%), Gaps = 9/144 (6%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKEQN----GELFRVSKMNLVDLAGSENISRSGAMNQRAK 394
           + T+ N  SSRSH++  I + +        E      ++++DLAGSE  + +    +R  
Sbjct: 289 SPTEANSVSSRSHAVLQIHIMQRNKLVDLKEHQTFGTLSIIDLAGSERAAATKNRGRRLH 348

Query: 395 EAGSINQSLLTLGRVINSLAD-----KSEHIPFRESKLTRLLQDSLGGNTKTALIATISP 449
           E  +IN+SLL LG  IN+L       +++H+P+R+SKLTRLL+ SLGGN KT +I  ISP
Sbjct: 349 EGANINRSLLALGNCINALCSNDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISP 408

Query: 450 AKMTSEETCSTLEYASKAKNIKNK 473
           +    +ET +TL+YA++AK IK K
Sbjct: 409 SSAHYDETLNTLKYANRAKEIKTK 432

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 12/107 (11%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F    SQ+ VY      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 143 FVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSGTR------ 196

Query: 146 LGDAAGIIPRVLFELF---DTLEANKDDYLVKCSFVELYNEELKDLL 189
             +  GII R + ELF   D L   K D+ +  SF+E+YNE + DLL
Sbjct: 197 --ENPGIIFRTMEELFVKMDALAGTK-DFELTVSFLEIYNETIHDLL 240

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  105 bits (263), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 100/192 (52%), Gaps = 22/192 (11%)

Query: 308 SIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQ----- 362
           S+YI+N+ E  +++  +               ST MN  SSRSH+I +IT+ +       
Sbjct: 188 SMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNT 247

Query: 363 NGELFRVSKMNLVDLAGSE-NISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSE--- 418
           N  +   S    VDLAGSE + +     N R KE  SIN+SL TL RV+ SL  + E   
Sbjct: 248 NSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELKY 307

Query: 419 --------H---IPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKA 467
                   H   +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ STL YA  A
Sbjct: 308 NSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESASTLRYADIA 365

Query: 468 KNIKNKPQLGAF 479
           + IK    +  +
Sbjct: 366 QTIKTNSIINTY 377

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (52%), Gaps = 16/112 (14%)

Query: 89  DKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGD 148
           D+ FG   SQ   Y+       +D + GYNC IL YG T +GKTYTM G+ K       D
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 149 AAGIIPRVLFELFDTLE----------ANKDDYLVKCSFVELYNEELKDLLD 190
             G+IPR   +LF  +E          + + +Y V CS  E+YNE++ DLL+
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLE 169

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  107 bits (266), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (61%), Gaps = 8/143 (5%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKM----NLVDLAGSENISRSGAMNQRAK 394
           + T  N+ SSRSH++  + + +       +  KM    +++DLAGSE  S +    +R  
Sbjct: 274 SPTDANETSSRSHAVLQVHVVQSSRTVDLKEDKMYATLSIIDLAGSERASATKNRGERLH 333

Query: 395 EAGSINQSLLTLGRVINSLADKSE----HIPFRESKLTRLLQDSLGGNTKTALIATISPA 450
           E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGGN KT +I  +SP+
Sbjct: 334 EGSNINKSLLALGNCINALCMTGRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPS 393

Query: 451 KMTSEETCSTLEYASKAKNIKNK 473
               +ET +TL+YA++AK+IK K
Sbjct: 394 SAHYDETLNTLKYANRAKDIKTK 416

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F   ASQ+ V++    PL    + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISGTP------ 181

Query: 146 LGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVELYNEELKDLLD 190
             D+ GII   + ELF  +   KD   + +  S++E+YNE ++DLL+
Sbjct: 182 --DSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLE 226

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  107 bits (266), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (61%), Gaps = 8/143 (5%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKEQNGELFRVSK----MNLVDLAGSENISRSGAMNQRAK 394
           + T  N+ SSRSH++  I + +       +  K    ++++DLAGSE  S +    +R  
Sbjct: 276 SPTDANETSSRSHAVLQIHVVQSSRSVDLKEDKTYATLSIIDLAGSERASATKNRGERLH 335

Query: 395 EAGSINQSLLTLGRVINSLADKSE----HIPFRESKLTRLLQDSLGGNTKTALIATISPA 450
           E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGGN KT +I  +SP+
Sbjct: 336 EGSNINKSLLALGNCINALCMTGRRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPS 395

Query: 451 KMTSEETCSTLEYASKAKNIKNK 473
               +ET +TL+YA++AK+IK K
Sbjct: 396 SAHYDETLNTLKYANRAKDIKTK 418

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F   A+Q+ V+     PL    I G+N T+  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISGTP------ 183

Query: 146 LGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVELYNEELKDLLD 190
             +  GII   + ELF  +E  KD   + +  S++E+YNE ++DLL+
Sbjct: 184 --ENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLE 228

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 99/179 (55%), Gaps = 9/179 (5%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYK-EQ 362
           D    I + NL      +  E              + T  N+ SSRSH++  I + + ++
Sbjct: 239 DSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDR 298

Query: 363 NGELFR---VSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLA----- 414
             +L      + ++++DLAGSE  + +    +R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGT 358

Query: 415 DKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNK 473
            ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++AK+IK K
Sbjct: 359 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 64/122 (52%), Gaps = 15/122 (12%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F  +A+Q  VY      L    + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 146 LGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVELYNEELKDLLDSTNTATNSDNKKL 203
             +  GII   + ELF  +E+ KD  +  +  S++E+YNE ++DLL+      N  +KKL
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLNP-----NVSSKKL 234

Query: 204 RI 205
            I
Sbjct: 235 VI 236

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 96/178 (53%), Gaps = 16/178 (8%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLY---- 359
           D S +  ++NLE   +TS                 AST  N+ SSRSHSIF I ++    
Sbjct: 499 DASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINE 558

Query: 360 ---KEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADK 416
              +E+NG L      NL+DLAGSE +S S   ++R KE   IN+SL  LG V+NSL   
Sbjct: 559 GLGEERNGLL------NLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSP 612

Query: 417 ---SEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIK 471
              + HI FR+SKLT LLQ SL GN+KT ++  IS +     ET  +L +A K  + K
Sbjct: 613 DATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 65/118 (55%), Gaps = 14/118 (11%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           Y+ DKVF  + + + +++E++E L Q  + G+N  I  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 146 LGDAAGIIP---RVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN 200
           L    GIIP   + +F+  D    N   Y V C F+E+YN+E+ DLL S +  +NS N
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSNSSN 489

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 92/146 (63%), Gaps = 13/146 (8%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKEQ------NGELFRVSKMNLVDLAGSENISRSGAMNQR 392
           ++T  N+ SSRSH++  I + +        +  +F  + ++++DLAGSE  + +    +R
Sbjct: 292 SATDANETSSRSHAVLQIHISQTNRTVDLTSSHVF--ATLSIIDLAGSERAASTKNRGER 349

Query: 393 AKEAGSINQSLLTLGRVINSLA-----DKSEHIPFRESKLTRLLQDSLGGNTKTALIATI 447
             E  +IN+SLL LG  IN+L       +S H+P+R+SKLTRLL+ SLGGN KT +I  +
Sbjct: 350 LYEGANINKSLLALGNCINALCLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCV 409

Query: 448 SPAKMTSEETCSTLEYASKAKNIKNK 473
           SP+    +ET +TL+YA++AK IK K
Sbjct: 410 SPSSTHYDETLNTLKYANRAKEIKTK 435

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F   +SQ  VY      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGTP------ 199

Query: 146 LGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVELYNEELKDLLD 190
             +  GII   + ELF  +E  KD  ++ +  S++E+YNE ++DLL+
Sbjct: 200 --EQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN 244

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 85/137 (62%), Gaps = 13/137 (9%)

Query: 339 ASTKMNDFSSRSHSIFTITLY------KEQNGELFRVSKMNLVDLAGSENISRSGAMNQR 392
           AST  N+ SSRSHSIF I L+      KE++  +     +NLVDLAGSE +  S    +R
Sbjct: 623 ASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGV-----LNLVDLAGSERVHSSQVTGER 677

Query: 393 AKEAGSINQSLLTLGRVINSLADKS--EHIPFRESKLTRLLQDSLGGNTKTALIATISPA 450
            +E  +IN+SL  LG VI +L DK+   HIPFR SKLT LLQ SL GN+KT +   ISP+
Sbjct: 678 LRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMFVNISPS 737

Query: 451 KMTSEETCSTLEYASKA 467
                ET ++L +ASK 
Sbjct: 738 SSHINETINSLRFASKV 754

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (53%), Gaps = 14/115 (12%)

Query: 85  TYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNG 144
           ++  DK+F    S   V++E+ + L Q  + GYN  I  YG T +GKTYTM     LH  
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-----LHPN 524

Query: 145 ELGDAAGIIPRVLFELFDTLEANKD---DYLVKCSFVELYNEELKDLLDSTNTAT 196
           +     G+IP  +  +FD +E  K+   +Y + C FVE+YNE + DLL S    T
Sbjct: 525 D-----GVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLLRSNENGT 574

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 101/186 (54%), Gaps = 19/186 (10%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D +  I + NL  +   +  E              +ST  N+ SSRSH++  I L  +QN
Sbjct: 221 DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHL-TQQN 279

Query: 364 G---------ELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLA 414
                     +LF  S ++++DLAGSE  + +    +   E  +IN+SLL LG  IN+L 
Sbjct: 280 KLNNDINSTEQLF--STLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALC 337

Query: 415 DKSE-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKA 467
             +        HIP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++A
Sbjct: 338 INTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRA 397

Query: 468 KNIKNK 473
           K IK K
Sbjct: 398 KEIKTK 403

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 61/109 (55%), Gaps = 10/109 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+   +++Q+ V++   EPL    + GYN T+  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGTP------ 163

Query: 146 LGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVELYNEELKDLLDST 192
             +  GII   L  LF+ +E  KD  +  +  S++E+YNE +KDLLD T
Sbjct: 164 --ENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLDPT 210

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 86/139 (61%), Gaps = 6/139 (4%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKEQN--GELFRVSKMNLVDLAGSENISRSGAMNQRAKE 395
            A+T  N+ SSRSHSIF I L    N  GE      +NLVDLAGSE ++ S     R +E
Sbjct: 549 TATTAANERSSRSHSIFIIHLRGSNNITGE-SSYGILNLVDLAGSERLNSSQVEGARLRE 607

Query: 396 AGSINQSLLTLGRVINSL--ADKSE-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKM 452
             +IN+SL  LG VI++L  +D S+ HIPFR SKLT LLQ SL GN+KT +   ISP + 
Sbjct: 608 TQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPTQQ 667

Query: 453 TSEETCSTLEYASKAKNIK 471
             +ET ++L +ASK    K
Sbjct: 668 QIQETLNSLRFASKVNTTK 686

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 14/113 (12%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D++F      K V++EI + L Q  + GYN  I  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 146 LGDAAGIIPRVLFELFDTLEANKD---DYLVKCSFVELYNEELKDLLDSTNTA 195
           L    G+IP  +  +FD  ++ K+   +Y V C FVE+YNE + DLL    +A
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLREETSA 498

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/139 (49%), Positives = 87/139 (62%), Gaps = 6/139 (4%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKEQ--NGELFRVSKMNLVDLAGSENISRSGAMNQRAKE 395
            AST  N+ SSRSHSIF + L  E    GE      +NLVDLAGSE I+ S  + +R +E
Sbjct: 559 TASTACNERSSRSHSIFIVHLSGENVLTGERSH-GILNLVDLAGSERINTSQVIGERLRE 617

Query: 396 AGSINQSLLTLGRVINSL--ADKSE-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKM 452
             SIN+SL  LG VI++L  AD S+ HIPFR SKLT LLQ SL GN+KT +   IS    
Sbjct: 618 TQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPN 677

Query: 453 TSEETCSTLEYASKAKNIK 471
            + ET ++L +ASK  + K
Sbjct: 678 HTNETLNSLRFASKVNSTK 696

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 73/160 (45%), Gaps = 18/160 (11%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V  R R    RE    + + V   ++   N+V     +  G   ++    +  D++F
Sbjct: 354 NIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNGYGSGPQI----FKFDRIF 409

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGI 152
               +   V++EI + L Q  + GYN  I  YG T +GKTYTM          L    GI
Sbjct: 410 NEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPTDGI 458

Query: 153 IPRVLFELFD---TLEANKDDYLVKCSFVELYNEELKDLL 189
           IP  +  +F+    L+     Y V C FVE+YNE + DLL
Sbjct: 459 IPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  103 bits (258), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 85/140 (60%), Gaps = 8/140 (5%)

Query: 338 VASTKMNDFSSRSHSIFTITLY---KEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAK 394
            ASTK N+ SSRSHSIF I L+    + N + + +  +NLVDLAGSE I+ S    +R +
Sbjct: 565 TASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGI--LNLVDLAGSERINSSQVSGERLR 622

Query: 395 EAGSINQSLLTLGRVI---NSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 451
           E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+ SL GN+KT +   IS + 
Sbjct: 623 ETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTLMFVNISASL 682

Query: 452 MTSEETCSTLEYASKAKNIK 471
               ET ++L +ASK  + K
Sbjct: 683 NHVNETINSLRFASKVNSTK 702

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 64/131 (48%), Gaps = 14/131 (10%)

Query: 72  TDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGK 131
           T  + I    N+  Y  DK+F    S   +++E+ + L Q  + GYN  I  YG T +GK
Sbjct: 407 TQTMEITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGK 465

Query: 132 TYTMTGDEKLHNGELGDAAGIIP---RVLFELFDTLEANKDDYLVKCSFVELYNEELKDL 188
           T+TM          L  + GIIP   R +F   D L+    +Y + C FVE+YNE + DL
Sbjct: 466 TFTM----------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDL 515

Query: 189 LDSTNTATNSD 199
           L    T+   D
Sbjct: 516 LREKQTSQKHD 526

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/137 (45%), Positives = 86/137 (62%), Gaps = 4/137 (2%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKEQN--GELFRVSKMNLVDLAGSENISRSGAMNQRAKE 395
           +A+T  N+ SSRSHS+FTI ++   +  GE      +NLVDLAGSE I  S     R +E
Sbjct: 551 IAATNSNERSSRSHSVFTIRIHGTNSITGEA-SDGVLNLVDLAGSERIDTSNVTGDRLRE 609

Query: 396 AGSINQSLLTLGRVINSLADKS-EHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTS 454
             +IN+SL  LG VI +L  K  +HIPFR SKLT LLQ SL G++KT +   +SP+    
Sbjct: 610 TQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMFVNVSPSSNHV 669

Query: 455 EETCSTLEYASKAKNIK 471
           +ET ++L +ASK  + K
Sbjct: 670 KETLNSLRFASKVNSTK 686

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 82/164 (50%), Gaps = 21/164 (12%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V  R R   E E++  S + V   DN        N +  + I+ +  +  +  DKVF
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNR-------NGSQAIEISNEDRNSRFLFDKVF 410

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGI 152
             +AS + V+EE+ + L Q  + GYN  I  YG T +GKTYTM          + D  G+
Sbjct: 411 SSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDGV 459

Query: 153 IPRVLFELFDT---LEANKDDYLVKCSFVELYNEELKDLLDSTN 193
           IP  L  +FD    L+    DY  +  F+E+YNE++ DLL S N
Sbjct: 460 IPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLLRSLN 503

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 83/139 (59%), Gaps = 6/139 (4%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKEQN--GELFRVSKMNLVDLAGSENISRSGAMNQRAKE 395
            AST  N+ SSRSHSIF I L    +  GE      +NLVDLAGSE I+ S     R +E
Sbjct: 558 TASTGSNEHSSRSHSIFIIHLRGSNSLTGE-ESYGILNLVDLAGSERINSSQVTGDRLRE 616

Query: 396 AGSINQSLLTLGRVINSLADKSE---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKM 452
             +IN+SL  LG VI++L    +   HIPFR SKLT LLQ SL GN+KT +   ISP+  
Sbjct: 617 TQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSAN 676

Query: 453 TSEETCSTLEYASKAKNIK 471
              ET ++L +ASK  + K
Sbjct: 677 HINETINSLRFASKVNSTK 695

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 82/176 (46%), Gaps = 29/176 (16%)

Query: 30  EELNILVAVRCRGRNE-REIKAKSSVVVDVPD----NG-----VTNEVSINTTDDVGIAA 79
           +EL   + V CR R     I++K +  + V D    NG     V   + +N  +   I  
Sbjct: 343 QELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSMEVMKGIEVNNNNATQIPQ 402

Query: 80  KMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDE 139
           +     +  DK+F  + +   V++E+ + L Q  + GYN  I  YG T +GKTYTM    
Sbjct: 403 R-----FKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---- 452

Query: 140 KLHNGELGDAAGIIPRVLFELFD---TLEANKDDYLVKCSFVELYNEELKDLLDST 192
                 L    GIIP  +  +F+    L+     Y + C FVE+YNE + DLL S+
Sbjct: 453 ------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLLRSS 502

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 88/145 (60%), Gaps = 10/145 (6%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKEQNGELFR----VSKMNLVDLAGSENISRSGAMNQRAK 394
           + T  N+ SSRSH++  I + +       +     + ++++DLAGSE  + +    +R  
Sbjct: 270 SPTDANETSSRSHAVLQIHVAQMNRTADIKQDQTFATLSIIDLAGSERAAVTKNRGERLL 329

Query: 395 EAGSINQSLLTLGRVINSLADKSE------HIPFRESKLTRLLQDSLGGNTKTALIATIS 448
           E  +IN+SLL LG  IN+L   S       H+P+R+SKLTRLL+ SLGGN KT +I  +S
Sbjct: 330 EGANINRSLLALGNCINALCVSSTRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVS 389

Query: 449 PAKMTSEETCSTLEYASKAKNIKNK 473
           P+    +ET +TL+YA++AK IK K
Sbjct: 390 PSSGHYDETLNTLKYANRAKEIKTK 414

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 67/128 (52%), Gaps = 15/128 (11%)

Query: 80  KMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDE 139
           +   + +  D++F    +Q+ VYE    PL    + G+N T+  YG T  GKT+T++G  
Sbjct: 118 RFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT- 176

Query: 140 KLHNGELGDAAGIIPRVLFELFDTLEANKD--DYLVKCSFVELYNEELKDLLDSTNTATN 197
                   +  GII   + ELF  +E  KD   + ++ SF+E+YNE++ DLLD      N
Sbjct: 177 -------SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLDP-----N 224

Query: 198 SDNKKLRI 205
             +KKL I
Sbjct: 225 ISSKKLVI 232

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/135 (48%), Positives = 84/135 (62%), Gaps = 6/135 (4%)

Query: 338 VASTKMNDFSSRSHSIFTITL--YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKE 395
            A+T  N+ SSRSHS+F I L  Y    GE  +   +NLVDLAGSE I+ S     R +E
Sbjct: 564 TAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINASQVTGDRLRE 622

Query: 396 AGSINQSLLTLGRVINSLA--DKSE-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKM 452
             +IN+SL  LG VI++LA  D S+ HIPFR SKLT LLQ SL G++KT +   ISP   
Sbjct: 623 TQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLD 682

Query: 453 TSEETCSTLEYASKA 467
              ET ++L +ASK 
Sbjct: 683 HFNETLNSLRFASKV 697

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F P  S   ++EEI + L Q  + GYN  I  YG T +GKTYTM          
Sbjct: 413 FKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 461

Query: 146 LGDAAGIIPRVLFELFDTLEANKD---DYLVKCSFVELYNEELKDLLDSTNTAT 196
           L    G+IP  L  +F  +   K+   +Y +   F+E+YNE + DLL   N  T
Sbjct: 462 LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLLRGLNNDT 515

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 86/140 (61%), Gaps = 8/140 (5%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKEQNGELFRVSK---MNLVDLAGSENISRSGAMNQRAK 394
            A+T  N+ SSRSHS+F I  Y +   E+   S    +NLVDLAGSE ++ S A+  R +
Sbjct: 581 TAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERLNSSQAVGARLR 638

Query: 395 EAGSINQSLLTLGRVINSLA---DKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 451
           E  +IN+SL  LG VI++L    +   HIPFR SKLT LLQ SL G++KT +   ISP K
Sbjct: 639 ETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKTLMFVNISPTK 698

Query: 452 MTSEETCSTLEYASKAKNIK 471
               ET ++L +ASK  + K
Sbjct: 699 SHLNETINSLRFASKVNSTK 718

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 14/118 (11%)

Query: 83  SKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLH 142
           S+ Y  D++F  + S   V++EI + L Q  + G+N  I  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 143 NGELGDAAGIIPRVLFELFDTLEANKDD---YLVKCSFVELYNEELKDLLDSTNTATN 197
              L D  G+IP  +  +FD  E+ K+    Y + C F+E+YNE + DLL   +T  N
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTDGN 533

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 84/144 (58%), Gaps = 11/144 (7%)

Query: 338 VASTKMNDFSSRSHSIFTITL--YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKE 395
            AST  N+ SSRSHSIF I L    E  GE      +NLVDLAGSE I+ S    +R +E
Sbjct: 613 TASTLSNEHSSRSHSIFIIHLKGTNEITGEK-SYGILNLVDLAGSERINSSQVTGERLRE 671

Query: 396 AGSINQSLLTLGRVINSLAD--------KSEHIPFRESKLTRLLQDSLGGNTKTALIATI 447
             +IN+SL  LG VI++L          K  HIPFR SKLT LLQ SL GN+KT +   I
Sbjct: 672 TQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIGNSKTLMFVNI 731

Query: 448 SPAKMTSEETCSTLEYASKAKNIK 471
           SP+     ET ++L +ASK  + K
Sbjct: 732 SPSINYVNETLNSLRFASKVNSAK 755

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 56/107 (52%), Gaps = 14/107 (13%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F  + +   V++E+ + L Q  + GYN  I  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 146 LGDAAGIIPRVLFELF---DTLEANKDDYLVKCSFVELYNEELKDLL 189
           L    GIIP  +  +F   + L+     Y ++C FVE+YNE + DLL
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLL 548

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 91/134 (67%), Gaps = 6/134 (4%)

Query: 339 ASTKMNDFSSRSHSIFTITL--YKEQNGELFRVSKMNLVDLAGSENISRSGAMN-QRAKE 395
           A T MN+ SSRSHS+F + +  + + + E  +   +NLVDLAGSE ++RSG ++ +R +E
Sbjct: 562 AKTAMNNRSSRSHSVFIVEVEGFNKDSEERCK-GVLNLVDLAGSERMNRSGLVDKERIEE 620

Query: 396 AGSINQSLLTLGRVINSL--ADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMT 453
              IN+SL ++G VI++L     S HIPFR +KLT LL+ SL G++KT ++ T+SP+  +
Sbjct: 621 TKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSLQGSSKTLMLVTVSPSNSS 680

Query: 454 SEETCSTLEYASKA 467
             ET ++L +A+K 
Sbjct: 681 RNETMNSLRFATKV 694

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 14/122 (11%)

Query: 72  TDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGK 131
           T D+       S  +  DK+F    S + V+ E+ E L Q  + G+N  I  YG T +GK
Sbjct: 394 TLDIKRPMTNGSVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGK 452

Query: 132 TYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEANKD---DYLVKCSFVELYNEELKDL 188
           TYTM          L +  GIIP  L  + D   + K     Y +K  FVE+YN+ + DL
Sbjct: 453 TYTM----------LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDL 502

Query: 189 LD 190
           L+
Sbjct: 503 LN 504

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 92/166 (55%), Gaps = 6/166 (3%)

Query: 311 IQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITL--YKEQNGELFR 368
           I N+ +  +TS  +              A T+ N+ SSRSHS+F + +  + +Q GE+  
Sbjct: 543 ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGHNDQTGEVSH 602

Query: 369 VSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVI---NSLADKSEHIPFRES 425
             K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI   NS      HIPFR S
Sbjct: 603 -GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNS 661

Query: 426 KLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIK 471
           KLT LLQ SL G++KT +   I   +  + ET ++L +ASK  + K
Sbjct: 662 KLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 61/121 (50%), Gaps = 14/121 (11%)

Query: 83  SKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLH 142
           S  +  DK+F P  +   V++EI + L Q  + GYN  I  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 143 NGELGDAAGIIPRVL---FELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSD 199
              L    G+IP  L   F+  + L  +   Y + C ++E+YNE + DLL   N+  N D
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLLREFNSNDNID 522

Query: 200 N 200
           +
Sbjct: 523 D 523

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 310 YIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQNGELFRV 369
           YI N+    +TS  +              A+T+ N+ SSRSHS+F + +    NG     
Sbjct: 540 YITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHI----NGRNLHT 595

Query: 370 S-----KMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKS---EHIP 421
                 K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L        +IP
Sbjct: 596 GETSQGKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIP 655

Query: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIK 471
           FR SKLT LLQ SL G++KT +   I P      ET ++L +ASK  + K
Sbjct: 656 FRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 63/124 (50%), Gaps = 14/124 (11%)

Query: 79  AKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD 138
            ++ S  +  D +F PS + K ++EEI + L Q  + GYN  I  YG T +GKTYTM   
Sbjct: 408 GRILSYNFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--- 463

Query: 139 EKLHNGELGDAAGIIPRVLFELFD---TLEANKDDYLVKCSFVELYNEELKDLLDSTNTA 195
                  L    G+IP  L  +F     L+    +Y ++C ++E+YNE + DLL    + 
Sbjct: 464 -------LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRDFKSH 516

Query: 196 TNSD 199
            N D
Sbjct: 517 DNID 520

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 80/135 (59%), Gaps = 6/135 (4%)

Query: 338 VASTKMNDFSSRSHSIFTITLY--KEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKE 395
            AST  N+ SSRSHSIF I L     + G       +NLVDLAGSE I+ S  +  R +E
Sbjct: 587 TASTASNEHSSRSHSIFIIHLSGSNAKTGA-HSYGTLNLVDLAGSERINVSQVVGDRLRE 645

Query: 396 AGSINQSLLTLGRVINSLADK---SEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKM 452
             +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT +   ISP+  
Sbjct: 646 TQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSS 705

Query: 453 TSEETCSTLEYASKA 467
              ET ++L +ASK 
Sbjct: 706 HINETLNSLRFASKV 720

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 56/111 (50%), Gaps = 14/111 (12%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F    +   V++E+ + L Q  + GYN  I  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 146 LGDAAGIIPRVL---FELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTN 193
           L    GIIP  +   F   + L+    DY V C F+E+YNE + DLL S N
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDN 535

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 80/135 (59%), Gaps = 6/135 (4%)

Query: 338 VASTKMNDFSSRSHSIFTITL--YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKE 395
            AST  N+ SSRSHSIF I L     + G       +NLVDLAGSE I+ S  +  R +E
Sbjct: 586 TASTASNEHSSRSHSIFIIHLSGLNAKTGAQ-SYGTLNLVDLAGSERINISQVVGDRLRE 644

Query: 396 AGSINQSLLTLGRVINSLADKS---EHIPFRESKLTRLLQDSLGGNTKTALIATISPAKM 452
             +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT +   ISP+  
Sbjct: 645 TQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSS 704

Query: 453 TSEETCSTLEYASKA 467
              ET ++L +ASK 
Sbjct: 705 HINETLNSLRFASKV 719

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 59/118 (50%), Gaps = 20/118 (16%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DK+F    + + V++E+ + L Q  + GYN  I  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 146 LGDAAGIIPRVL---FELFDTLEANKDDYLVKCSFVELYNEELKDLL------DSTNT 194
           L    GIIP  +   F   + L+    DY V C F+E+YNE + DLL      D TNT
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRNENNKDDTNT 542

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/134 (47%), Positives = 81/134 (60%), Gaps = 6/134 (4%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKEQNGELFRVS--KMNLVDLAGSENISRSGAMNQRAKEA 396
           AST  N+ SSRSHSIF I L    N +    S   +NLVDLAGSE I+ S  +  R +E 
Sbjct: 588 ASTASNEHSSRSHSIFMIHL-SGSNAKTGAQSYGTLNLVDLAGSERINISQVVGDRLRET 646

Query: 397 GSINQSLLTLGRVINSLADK---SEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMT 453
            +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT +   ISP+   
Sbjct: 647 QNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSH 706

Query: 454 SEETCSTLEYASKA 467
             ET ++L +ASK 
Sbjct: 707 INETLNSLRFASKV 720

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 61/121 (50%), Gaps = 25/121 (20%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTM--TGDEKLHN 143
           +  DK+F    + + V++E+ + L Q  + GYN  I  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 144 GELGDAAGIIPRVL---FELFDTLEANKDDYLVKCSFVELYNEELKDLL-------DSTN 193
                  GIIP  +   F   + L+    DY V C F+E+YNE + DLL       D TN
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRNDSIGKDDTN 542

Query: 194 T 194
           T
Sbjct: 543 T 543

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 79/134 (58%), Gaps = 4/134 (2%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKEQNGELFR-VSKMNLVDLAGSENISRSGAMNQRAKEA 396
            AST  N+ SSRSHSIF I L         +    +NLVDLAGSE I+ S  +  R +E 
Sbjct: 587 TASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINISQVVGDRLRET 646

Query: 397 GSINQSLLTLGRVINSLADKS---EHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMT 453
            +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT +   ISP+   
Sbjct: 647 QNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSH 706

Query: 454 SEETCSTLEYASKA 467
             ET ++L +ASK 
Sbjct: 707 INETLNSLRFASKV 720

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 78/168 (46%), Gaps = 17/168 (10%)

Query: 30  EELNILVAVRCRGRNERE-IKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTV 88
           +EL   + V CR R   E ++   + +++V  N   +   I + +   I        +  
Sbjct: 381 QELRGNIRVYCRIRPALETLEDSDTSLINV--NEFDDNCGIQSMEVTKIHNTAQVHEFKF 438

Query: 89  DKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGD 148
           DK+F    +   V++E+ + L Q  + GYN  I  YG T +GKT+TM          L  
Sbjct: 439 DKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 149 AAGIIPRVL---FELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTN 193
             GIIP  +   F   + L+    DY V C F+E+YNE + DLL S N
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRSDN 535

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 84/143 (58%), Gaps = 14/143 (9%)

Query: 338 VASTKMNDFSSRSHSIFTITL------YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQ 391
            AST  N+ SSRSHS+F I L        EQ+  +     +NLVDLAGSE I+ S  + +
Sbjct: 576 TASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGI-----LNLVDLAGSERINSSQVLGE 630

Query: 392 RAKEAGSINQSLLTLGRVINSLADKS---EHIPFRESKLTRLLQDSLGGNTKTALIATIS 448
           R +E  +IN+SL  LG V+++L        HIPFR SKLT LLQ SL GN+KT +   IS
Sbjct: 631 RLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNIS 690

Query: 449 PAKMTSEETCSTLEYASKAKNIK 471
             +    ET ++L +ASK  + K
Sbjct: 691 ACESHLNETLNSLRFASKVNSTK 713

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 14/111 (12%)

Query: 84  KTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHN 143
           + +  D++F  + + + V+EEI + L Q  + GYN  I  YG T +GKTYTM        
Sbjct: 426 QNFKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-------- 476

Query: 144 GELGDAAGIIPRVLFELFDTLEANKD---DYLVKCSFVELYNEELKDLLDS 191
             L    GIIP  +  +F  +E  K+   +Y + C F+E+YNE + DLL S
Sbjct: 477 --LNPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRS 525

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 69/173 (39%), Positives = 96/173 (55%), Gaps = 6/173 (3%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITL--YKE 361
           ++S + +I N+    +TS                 A+T  N  SSRSHS+F I L  Y  
Sbjct: 526 NESRTTHITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNT 585

Query: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSL--ADKSE- 418
            +GE      +NLVDLAGSE I       +R +E  +IN+SL  LG VI++L  AD S+ 
Sbjct: 586 ISGEK-STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKR 644

Query: 419 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIK 471
           HIPFR SKLT LLQ SL G++KT +   +SP   +  ET ++L +A+K  + K
Sbjct: 645 HIPFRNSKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 75/165 (45%), Gaps = 31/165 (18%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVG---IAAKMNSK--TYT 87
           NI V  R R   E E  + SS+ ++              +D+ G   I  K +SK   +T
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEIE------------KFSDETGMQSITIKRDSKQHKFT 410

Query: 88  VDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELG 147
            D+ F    +   V+ EI + L Q  + GYN  I  YG T +GKT+TM          L 
Sbjct: 411 FDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM----------LN 459

Query: 148 DAAGIIPRVLFELFDTLEANKD---DYLVKCSFVELYNEELKDLL 189
              GIIP  L  +F  +E  K+    Y +   FVE+YNE +KDL 
Sbjct: 460 PNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLF 504

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 85/139 (61%), Gaps = 13/139 (9%)

Query: 341 TKMNDFSSRSHSIFTITLY--KEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGS 398
           T  N  SSRSH++  I ++   E  GE   +S ++L DLAGSE   R+    +R KE   
Sbjct: 268 TDFNTRSSRSHAVVLIRVFCTDEITGEQV-MSTLSLCDLAGSE---RATGQQERRKEGAY 323

Query: 399 INQSLLTLGRVINSLADKSE-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAK 451
           IN+SLL LG VI+ L+ +S        HIP+R+SKLTR+LQ +L G++  A I T+    
Sbjct: 324 INKSLLALGTVISKLSMESSGLSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRP 383

Query: 452 MTSEETCSTLEYASKAKNI 470
            TS E+ +T+ +AS+AKNI
Sbjct: 384 ETSTESINTIRFASRAKNI 402

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D VF P  +   VYE +A P+     +G+NCTI  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 146 LGDAAGIIPRVLFELFDTLEAN--KDDYLVKCSFVELYNEELKDLLD 190
                GIIP  +  +FD +     +  + V+ S++E+YNE + DLL+
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLN 204

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 87/143 (60%), Gaps = 15/143 (10%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKEQ--NGELFRVSKMNLVDLAGSENISRSGAMNQRAKEA 396
           +ST  N  SSRSH+I  I L      +GE+   S ++L DLAGSE ++   A ++R +E 
Sbjct: 261 SSTDFNTRSSRSHAIILIRLISSDLSSGEVV-TSTLSLCDLAGSERVT---AQHERRQEG 316

Query: 397 GSINQSLLTLGRVINSLADK---------SEHIPFRESKLTRLLQDSLGGNTKTALIATI 447
             IN+SLL LG VI+ L+ +         + HIP+R+SKLTR+LQ +L GN+    I TI
Sbjct: 317 SFINKSLLALGTVISKLSAEVNNSTESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTI 376

Query: 448 SPAKMTSEETCSTLEYASKAKNI 470
             +   + E+ +TL +AS+AKN+
Sbjct: 377 DTSVDATNESVNTLRFASRAKNV 399

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 67/124 (54%), Gaps = 19/124 (15%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           YT D VF P AS   VY    +PL      G+N T+  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 146 LGDAAGIIP----RVLFELFD-TLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN 200
           +   AG+IP     +  ++FD T+  NK  Y    S++E+YNE++ DLL+     T+ D 
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENK-KYDTLVSYLEIYNEKIYDLLE-----TDFDP 209

Query: 201 KKLR 204
           K LR
Sbjct: 210 KPLR 213

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 81/140 (57%), Gaps = 13/140 (9%)

Query: 341 TKMNDFSSRSHSIFTITL-YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSI 399
           T  N  SSRSH+I  I L   +    L   S ++L DLAGSE   R+ A  +R KE   I
Sbjct: 305 TDFNSRSSRSHAIVLIRLTCTDLKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFI 361

Query: 400 NQSLLTLGRVINSLADKS---------EHIPFRESKLTRLLQDSLGGNTKTALIATISPA 450
           N+SLL LG VI+ L+ +S          HIP+R+SKLTR+LQ +L G+     I T+   
Sbjct: 362 NKSLLALGTVISKLSAESTQNMGVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAH 421

Query: 451 KMTSEETCSTLEYASKAKNI 470
             +S ET +T+ +AS+AKNI
Sbjct: 422 AESSAETINTIRFASRAKNI 441

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 63/108 (58%), Gaps = 11/108 (10%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           ++ D VF P+     VYEE A P+ +   +G+N TI  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 146 LGDAAGIIPRVLFELFDTLEA---NKDDYLVKCSFVELYNEELKDLLD 190
             +  G+IP  + ++F  + +   N   + VK S++E+YNE++ DLL+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 93/178 (52%), Gaps = 28/178 (15%)

Query: 341 TKMNDFSSRSHSIFTITLYKEQNGELFRVSK-MNLVDLAGSENISRSGAMNQRAKEAGSI 399
           T  N  SSRSH+I  I L K    E   VS  ++L DLAGSE   ++   N+R KE   I
Sbjct: 294 TTYNTRSSRSHAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFI 350

Query: 400 NQSLLTLGRVINSLADKSE-------------HIPFRESKLTRLLQDSLGGNTKTALIAT 446
           N+SLL LG VI+ L+ +S              HIP+R+SKLTR+LQ +L GN     I T
Sbjct: 351 NKSLLALGTVISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICT 410

Query: 447 ISPAKMTSEETCSTLEYASKAKNIK----NKPQL-------GAFIMKDILVRSITSEL 493
           I      S ET +TL +AS+AKN+      KP L       G    KD  + S+T +L
Sbjct: 411 IDTRPDASSETLNTLRFASRAKNVSLHIFRKPLLPSMSGSNGIVEEKDKTIMSLTRQL 468

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 12/125 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D VF  + +   VY + ++P+     +G N T+  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 146 LGDAAGIIPRVLFELFDTL--EANKDD--YLVKCSFVELYNEELKDLLDSTNTATNSDNK 201
             +  G+IP  +  L+  +  E+ + D  + +  S++E+YNE++ DLLD  N    +   
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLDCENELKPTAAT 233

Query: 202 KLRIF 206
             R+F
Sbjct: 234 SSRMF 238

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 82/157 (52%), Gaps = 28/157 (17%)

Query: 339 ASTKMNDFSSRSHSIFTITLYKEQNGELFRVSK-MNLVDLAGSENISRSGAMNQRAKEAG 397
           + T+ N  SSRSH++  + L      +  + S  + L DLAGSE   R+    +R KE  
Sbjct: 297 SETEYNLRSSRSHAVILVRLVTHNVIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGA 353

Query: 398 SINQSLLTLGRVINSLADKS------------------------EHIPFRESKLTRLLQD 433
            IN+SLL LG VI+ L+ +S                         HIP+R+SKLTRLLQ 
Sbjct: 354 FINKSLLALGTVISKLSAESLSNSKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQP 413

Query: 434 SLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNI 470
           +L GN+    I TI P   T  ET +TL +AS+AKN+
Sbjct: 414 ALSGNSAVTTICTIDPRMETYAETINTLRFASRAKNV 450

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 63/115 (54%), Gaps = 9/115 (7%)

Query: 82  NSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 141
           N+  Y  D VF P      +Y+  A PL      G+N T+  YGMT +GKTYTM GD + 
Sbjct: 129 NNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMGDNE- 187

Query: 142 HNGELGDAAGIIPRVLFELFDTLEANKDD--YLVKCSFVELYNEELKDLLDSTNT 194
                 +  GI+P  +  LF+ +  +++D  Y V  S++E+YNE++ DLLD   T
Sbjct: 188 ------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRT 236

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 91/182 (50%), Gaps = 18/182 (9%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN 363
           D    + +  L E    S+ E              A T  N  SSRSH+I  I L     
Sbjct: 274 DSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNV 333

Query: 364 GELFRVSK-MNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSL--------- 413
            +   +S  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L         
Sbjct: 334 IDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASH 390

Query: 414 -----ADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAK 468
                A+ + HIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +AS+AK
Sbjct: 391 GNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAK 450

Query: 469 NI 470
           N+
Sbjct: 451 NV 452

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (51%), Gaps = 8/110 (7%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D V+ P  S   +YE I +P+     +G+N T+  YGMT +GKTYTM G        
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGG-- 192

Query: 146 LGDAAGIIPRVLFELFDTL----EANKDDYLVKCSFVELYNEELKDLLDS 191
             D  G+IP  +  LF  +       +  + V  S++E+YNE + DLLDS
Sbjct: 193 --DDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLDS 240

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 83/153 (54%), Gaps = 23/153 (15%)

Query: 338 VASTKMNDFSSRSHSIFTITLYK-EQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEA 396
           ++ T+ N  SSRSHSI  + L   +    +   S ++L DLAGSE   ++ +  +R KE 
Sbjct: 278 ISETEYNSRSSRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERRKEG 334

Query: 397 GSINQSLLTLGRVINSLADKS-------------------EHIPFRESKLTRLLQDSLGG 437
             IN+SLL LG VI  L+ +S                    HIP+R+SKLTR+LQ +L G
Sbjct: 335 AFINKSLLALGTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSG 394

Query: 438 NTKTALIATISPAKMTSEETCSTLEYASKAKNI 470
           N+    I T+      S ET +TL +AS+AKN+
Sbjct: 395 NSIITTICTVDIRSDASSETLNTLRFASRAKNV 427

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 84/168 (50%), Gaps = 31/168 (18%)

Query: 34  ILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFG 93
           I+VA+R +  +  E K     V ++ DN           DDVG         + +D++F 
Sbjct: 76  IIVAIRPKPISNNEKK-----VWNIVDNKRI------AHDDVG--------EFRLDRIFD 116

Query: 94  PSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGII 153
              S   +Y E+ +PL      GYN T+  YGMT +GKT+TM+G +        +  G+I
Sbjct: 117 CDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLI 168

Query: 154 PRVLFELFDTL-EAN---KDDYLVKCSFVELYNEELKDLLDSTNTATN 197
           P  +  LF+T+ E N   K  Y +  S++E+YNE+L DLLD+     N
Sbjct: 169 PLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLLDTNVEGVN 216

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 82/161 (50%), Gaps = 31/161 (19%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKEQNGELFRVSK-MNLVDLAGSENISRSGAMNQRAKEA 396
            A T  N  SSRSH+I  I L      +   +S  ++L DLAGSE   R+    +R KE 
Sbjct: 310 TAETDFNARSSRSHAIVLIRLTTSDMKDGTSISSTLSLCDLAGSE---RATGQQERRKEG 366

Query: 397 GSINQSLLTLGRVINSLADKSE---------------------------HIPFRESKLTR 429
             IN+SLL LG VI+ L+ +S                            HIP+R+SKLTR
Sbjct: 367 AFINKSLLALGTVISKLSTESNKNRSPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTR 426

Query: 430 LLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNI 470
           LLQ +L G++    I TI     +S ET +TL +AS+AKNI
Sbjct: 427 LLQPALSGDSIVTTICTIDTKNESSAETLNTLRFASRAKNI 467

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 68/132 (51%), Gaps = 20/132 (15%)

Query: 63  VTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTIL 122
           VT+E +I   DDVG         +  D VF    S   +Y+ I  P+     +G+N TI 
Sbjct: 123 VTDEKTI-AHDDVG--------EFKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIF 173

Query: 123 VYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELF-----DTLEANKDDYLVKCSF 177
            YGMT +GKTYTM G       E     G+IP  +  LF     +TL+ +K  + +  S+
Sbjct: 174 AYGMTGSGKTYTMMGCP-----EREQKDGLIPLSVSYLFTKIMEETLDGDK-KFEIVLSY 227

Query: 178 VELYNEELKDLL 189
           +E+YNE++ DLL
Sbjct: 228 LEIYNEKIYDLL 239

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 83/165 (50%), Gaps = 35/165 (21%)

Query: 338 VASTKMNDFSSRSHSIFTITLYK-EQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEA 396
           +  T  N  SSRSH+I  I L   + N    R S ++L DLAGSE   R+    +R KE 
Sbjct: 332 IGETDYNTRSSRSHAIVLIRLTSTDVNNGTSRSSTLSLCDLAGSE---RATGQQERRKEG 388

Query: 397 GSINQSLLTLGRVINSL-ADK------------------------------SEHIPFRES 425
             IN+SLL LG VI+ L ADK                              S HIP+R+S
Sbjct: 389 SFINKSLLALGTVISKLSADKTTSVDSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDS 448

Query: 426 KLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNI 470
           KLTRLLQ +L G++    I T+      + ET +TL +AS+AKN+
Sbjct: 449 KLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 493

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 12/110 (10%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D VF    +   VYE   +P+    + G+N TI  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 146 LGDAAGIIPRVLFELF-DTLEANKDD---YLVKCSFVELYNEELKDLLDS 191
           L    G+IP  +  LF + +E + D    + V  S++E+YNE + DLL+S
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLES 264

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 80/138 (57%), Gaps = 12/138 (8%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRA--KE 395
           V ST+ N  SSRSH++  + +  +  G   RV  + L DLAGSE  S    ++ R    E
Sbjct: 253 VRSTQHNTGSSRSHAVLRLRI-TDSMGSKARV--LTLCDLAGSERAS----VHDRGLRAE 305

Query: 396 AGSINQSLLTLG---RVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKM 452
            G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN    ++ T+S +  
Sbjct: 306 GGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLVTMVCTVSLSGT 365

Query: 453 TSEETCSTLEYASKAKNI 470
             E++  TL +A +A  +
Sbjct: 366 DYEQSLGTLRFARRASGV 383

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 52/112 (46%), Gaps = 27/112 (24%)

Query: 101 VYEEIAEPLFQ----DFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRV 156
           ++    +PL      D I G   TI+ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQLS 170

Query: 157 LFELFDTLEANKDDYLVKCSFVELYNEELKDLL-DSTNTATNSDNKKLRIFD 207
           + +L   L  N     +  S++E+YNE L DLL D T        K+LRI D
Sbjct: 171 IRDLLTQLSKNCQ---ITISYLEIYNERLHDLLCDGT--------KELRILD 211

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 83/157 (52%), Gaps = 31/157 (19%)

Query: 341 TKMNDFSSRSHSIFTITLYKE--QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGS 398
           T+ N  SSRSH+I  I L  +  + GE   +  ++L DLAGSE   R    N+R KE   
Sbjct: 301 TEFNTRSSRSHAIVMIRLISKDIRTGEQ-NIRTLSLCDLAGSE---RGVGQNERRKEGAF 356

Query: 399 INQSLLTLGRVINSLA-------------------------DKSEHIPFRESKLTRLLQD 433
           IN+SLL LG VI+ L+                             HIP+R+SKLTRLLQ 
Sbjct: 357 INRSLLALGTVISRLSAENNGSHHTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQP 416

Query: 434 SLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNI 470
           +L G++    + TI  A  +S ET +TL +AS++KN+
Sbjct: 417 ALSGDSVVVALCTIDLAHESSSETLNTLRFASRSKNV 453

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 68/127 (53%), Gaps = 17/127 (13%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +T D VF    S   +Y +  +PL    I+GYN TI  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 146 LGDAAGIIPRVLFELFDTL------EANKDDYLVKCSFVELYNEELKDLLDSTNTATNSD 199
             +  G+IP  +  LF +L      E  K +  V  S++E+YNE++ DLLD   + +N  
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWV--SYLEIYNEKINDLLD-VASGSNVQ 241

Query: 200 NKKLRIF 206
           N   R+F
Sbjct: 242 NTPSRLF 248

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 91/168 (54%), Gaps = 20/168 (11%)

Query: 341 TKMNDFSSRSHSIFTITL-YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSI 399
           T  N  SSRSH+I T+ L   +        S ++L DLAGSE   R+   ++R KE   I
Sbjct: 310 TDYNTRSSRSHAIVTLNLACTDLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFI 366

Query: 400 NQSLLTLGRVINSLADKS---------EHIPFRESKLTRLLQDSLGGNTKTALIATISPA 450
           N+SLL LG VI+ L+  S          HIP+R+SKLTR+LQ +L G +    I TI   
Sbjct: 367 NKSLLALGTVISKLSASSMHTTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTR 426

Query: 451 KMTSEETCSTLEYASKAKNI-----KNKPQLGAFIMKDILVRSITSEL 493
                ET +T+ +AS+AKN+     +N+ +L     KD L+ ++  +L
Sbjct: 427 LDAMSETVNTIRFASRAKNVSMTVKRNEAELAH--EKDALIHNLRRQL 472

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 76/149 (51%), Gaps = 6/149 (4%)

Query: 42  GRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLV 101
           G N ++ +   SV + +       +     +D+  IA   +   +  D VF P ++   V
Sbjct: 96  GENSQQYRGAISVSIRLKPTDANAKNPWFVSDEQTIAHN-DVGEFKFDNVFRPQSNNYEV 154

Query: 102 YEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELF 161
           Y++I +P+     +GYN  I  YGMT +GKT+TM+G  +    E G  +  +  +  ++ 
Sbjct: 155 YQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGTPE----EAGLISLSVEHIFAQIM 210

Query: 162 DTLEANKDDYLVKCSFVELYNEELKDLLD 190
               ANK  + V  S++E+YNE++ DLL+
Sbjct: 211 SESLANK-SFQVTVSYLEIYNEKIYDLLN 238

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 92/200 (46%), Gaps = 37/200 (18%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKE-- 361
           D    + +  L E    S+ E             +  T  N  SSRSH+I  I L     
Sbjct: 298 DSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNV 357

Query: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSL-ADK---- 416
           +NG   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 358 KNGT-SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSV 413

Query: 417 --------------------------SEHIPFRESKLTRLLQDSLGGNTKTALIATISPA 450
                                     S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 GSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 451 KMTSEETCSTLEYASKAKNI 470
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETMNTLRFASRAKNV 493

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 12/110 (10%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D VF    +   VYE  ++P+    + G+N TI  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 146 LGDAAGIIPRVLFELFDTL---EANKD-DYLVKCSFVELYNEELKDLLDS 191
           L    G+IP  +  LF  +     N D  + V  S++E+YNE + DLL+S
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLES 264

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 62/108 (57%), Gaps = 11/108 (10%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  DKVF P  +   VYEEI +P+     +GYN TI  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 146 LGDAAGIIPRVLFELFDTL---EANKDDYLVKCSFVELYNEELKDLLD 190
             D AG+I   + ++F  +     N   Y V+ S++E+YNE++ DLL+
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN 239

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 80/150 (53%), Gaps = 26/150 (17%)

Query: 341 TKMNDFSSRSHSIFTITLYKEQNGELFR----VSKMNLVDLAGSENISRSGAMNQRAKEA 396
           T  N  SSRSH+I TI   K    EL       S ++L DLAGSE   R+   ++R KE 
Sbjct: 307 TDYNTRSSRSHAIVTI---KVTCTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEG 360

Query: 397 GSINQSLLTLGRVINSLADKS----------------EHIPFRESKLTRLLQDSLGGNTK 440
             IN+SLL LG VI+ L+  S                 H+P+R+SKLTR+LQ +L G++ 
Sbjct: 361 AFINKSLLALGTVISKLSAVSGASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSI 420

Query: 441 TALIATISPAKMTSEETCSTLEYASKAKNI 470
              I TI        ET +T+ +AS+AKN+
Sbjct: 421 VTTICTIDTKPDAMSETVNTIRFASRAKNV 450

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 79/147 (53%), Gaps = 21/147 (14%)

Query: 341 TKMNDFSSRSHSIFTITLYKEQ--NGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGS 398
           T  N  SSRSH+I  + L      NG     + ++L DLAGSE  S      +R KE   
Sbjct: 275 TDYNMRSSRSHAIIQVKLITTNLLNGTTH-FNTLSLCDLAGSEKASE---QLERRKEGSF 330

Query: 399 INQSLLTLGRVINSLADKS---------------EHIPFRESKLTRLLQDSLGGNTKTAL 443
           IN+SLL LG VI+ L+ +S                HIP+R+SKLTRLLQ +L  ++    
Sbjct: 331 INKSLLALGTVISKLSAESNAHDSSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTA 390

Query: 444 IATISPAKMTSEETCSTLEYASKAKNI 470
           I TI P K    ET +TL +AS+AKN+
Sbjct: 391 ICTIDPTKEAMTETVNTLRFASRAKNV 417

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 11/129 (8%)

Query: 79  AKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD 138
           A  +   +  D VFGP+A+ + ++ E+   L +    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 139 EKLHNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNS 198
              HN  +    G    V   + +  +  +    V  S++E+YNE++ DLL+S     N 
Sbjct: 179 ---HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLNS-----NC 228

Query: 199 DNKKLRIFD 207
            N++L++ D
Sbjct: 229 RNEELKVRD 237

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 76/131 (58%), Gaps = 3/131 (2%)

Query: 340 STKMNDFSSRSHSIFTITLYKEQN-GELFRVSKMNLVDLAGSENISRSGAMNQRA--KEA 396
           ST MN+ SSRSHS+F + +       +     ++NLVDLAGSE + +   +  +   KE 
Sbjct: 539 STHMNNASSRSHSVFMMKITGHNRITQEHSTGRLNLVDLAGSERLQQQEQITSQETLKET 598

Query: 397 GSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEE 456
            SIN+SL  L  VI+S+  +  +IPFR SKLT LL++SL   +KT +   ISP   +  E
Sbjct: 599 TSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLMYVNISPNINSIRE 658

Query: 457 TCSTLEYASKA 467
           T ++L  A K 
Sbjct: 659 TINSLRLARKV 669

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 54/108 (50%), Gaps = 14/108 (12%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +T DK+FG       V+++I   L Q  + GYN  I  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 146 LGDAAGIIPRV---LFELFDTLEANKDDYLVKCSFVELYNEELKDLLD 190
           L +  GII +    +      L     +Y ++  F+E+YNE ++DLL+
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 84/175 (48%), Gaps = 21/175 (12%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V  R R   + E +  SS+ +D    G ++E   N T  + I  +     +T D+ F
Sbjct: 362 NIRVFCRLRPHLDNEKEDSSSISID----GFSDE---NGTQCITIKREAKYHKFTFDRCF 414

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGI 152
           G   S K ++ EI + L Q  + GYN  I  YG T +GKTYTM   E           GI
Sbjct: 415 GAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMLNPED----------GI 463

Query: 153 IPRVLFELFDTLEANKD---DYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLR 204
           IP  L  +F  +E  K+    Y +   F+E+YNE +KDL    +T  +  ++ L+
Sbjct: 464 IPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDDGSEALK 518

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 84/175 (48%), Gaps = 21/175 (12%)

Query: 33  NILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVF 92
           NI V  R R   + E +  SS+ +D    G ++E   N T  + I  +     +T D+ F
Sbjct: 362 NIRVFCRLRPHLDNEKEDSSSISID----GFSDE---NGTQCITIKREAKYHKFTFDRCF 414

Query: 93  GPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGI 152
           G   S K ++ EI + L Q  + GYN  I  YG T +GKTYTM   E           GI
Sbjct: 415 GAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMLNPED----------GI 463

Query: 153 IPRVLFELFDTLEANKD---DYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLR 204
           IP  L  +F  +E  K+    Y +   F+E+YNE +KDL    +T  +  ++ L+
Sbjct: 464 IPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDDGSEALK 518

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 88/179 (49%), Gaps = 23/179 (12%)

Query: 307 ASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKEQN-GE 365
           +SI I+NL   ++TS +E                      SSRS  I  IT+ +  N  E
Sbjct: 187 SSISIKNLRCVYVTSLLEALSYCEKGRSLA----------SSRSSVIIRITVEQRDNVKE 236

Query: 366 LFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSE------- 418
           +F+     LVDL  S+ I +   +    +    INQS++TL  V  SLA   +       
Sbjct: 237 VFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRP 296

Query: 419 -----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKN 472
                +IP++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K +KN
Sbjct: 297 RSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKN 355

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 55/114 (48%), Gaps = 11/114 (9%)

Query: 79  AKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGD 138
           A  N K + VD++F P A  K     I          GYN  I+ YG T +GKT TM G 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFGY 123

Query: 139 EKLHNGELGDAAGIIPRVLFELFDTLEA---NKDDYLVKCSFVELYNEELKDLL 189
            K      GD  G+I  V  ++F T+E    N  DY +  S +E+  E ++DLL
Sbjct: 124 NK------GD--GVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 92/170 (54%), Gaps = 21/170 (12%)

Query: 341 TKMNDFSSRSHSI--FTITLYKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGS 398
           T  N  SSRSH+I    +T Y  + G     S ++L DLAGSE   R+     R KE   
Sbjct: 307 TDFNTRSSRSHAIVLLRLTRYDLKTGS-EATSTLSLCDLAGSE---RAVTQIVRRKEGAF 362

Query: 399 INQSLLTLGRVINSLA------------DKSEHIPFRESKLTRLLQDSLGGNTKTALIAT 446
           IN+SLL LG VI  L+              + HIP+R+SKLTR+LQ +L G++    I T
Sbjct: 363 INKSLLALGTVIAKLSMLGSQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICT 422

Query: 447 ISPAKMTSEETCSTLEYASKAKNIK---NKPQLGAFIMKDILVRSITSEL 493
           I     +S ET +T+ +AS+AKNI     K ++ +   KD +++++  +L
Sbjct: 423 IDSKAESSTETTNTVRFASRAKNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 65/123 (52%), Gaps = 12/123 (9%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D VF      + VY+ +  P+     +GYN TI  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 146 LGDAAGIIPRVLFELFDTLEANKDD----YLVKCSFVELYNEELKDLLDSTNTATNSDNK 201
                G+IP+ +  +FD + +        Y VK S++E+YNE++ DLL+  +    S  +
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLNYVDRQAGSTGQ 257

Query: 202 KLR 204
             R
Sbjct: 258 PSR 260

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 84/172 (48%), Gaps = 43/172 (25%)

Query: 338 VASTKMNDFSSRSHSIFTITLYKE--QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKE 395
           +  T  N  SSRSH+I  I L     ++G   R S ++L DLAGSE   R+    +R KE
Sbjct: 332 IGETDYNARSSRSHAIVLIRLTSTDVRDGT-SRSSTLSLCDLAGSE---RATGQQERRKE 387

Query: 396 AGSINQSLLTLGRVINSL-ADK------------------------------------SE 418
              IN+SLL LG VI+ L ADK                                    S 
Sbjct: 388 GSFINKSLLALGTVISKLSADKTNSVGSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSN 447

Query: 419 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNI 470
           HIP+R+SKLTRLLQ +L G++    I T+      + ET +TL +AS+AKN+
Sbjct: 448 HIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 12/110 (10%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D VF    +   VYE+ ++P+    + G+N TI  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 146 LGDAAGIIPRVLFELFDTL---EANKD-DYLVKCSFVELYNEELKDLLDS 191
           L    G+IP  +  LF  +     N D  + V  S++E+YNE + DLL+S
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLES 264

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 61/109 (55%), Gaps = 12/109 (11%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +T D+VF  + +   +YE  + P+    ++G+N T+  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 146 LGDAAGIIPRVLFELFDTL----EANKDDYLVKCSFVELYNEELKDLLD 190
             D AG+IP  +  LF  +          Y V  S++E+YNE++ DLLD
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLD 212

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 105/218 (48%), Gaps = 30/218 (13%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYKE-- 361
           D    + I  L E    S+ E              + T  N  SSRSH+I  + L     
Sbjct: 246 DLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDL 305

Query: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVI----------- 410
           ++GE    S ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI           
Sbjct: 306 RSGETVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKN 361

Query: 411 -------NSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEY 463
                   +  + + HIP+R+SKLTR+LQ +L GN+    I TI      + ET +T+ +
Sbjct: 362 GPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRF 421

Query: 464 ASKAKN----IKNKPQL--GAFIMKDILVRSITSELAK 495
           AS+AKN    +  +P +  G++  KD  + ++T +L K
Sbjct: 422 ASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEK 459

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 87/184 (47%), Gaps = 20/184 (10%)

Query: 304 DQSASIYIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYK-EQ 362
           D    + + +L E  + S  E                T  N  SSRSH+I  + L + E 
Sbjct: 271 DSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCEL 330

Query: 363 NGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSE---- 418
                  S ++L DLAGSE   R+     R KE   IN+SLL LG VI  L+  S     
Sbjct: 331 KTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGS 387

Query: 419 ------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASK 466
                       HIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T+ +AS+
Sbjct: 388 GSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASR 447

Query: 467 AKNI 470
           AKNI
Sbjct: 448 AKNI 451

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 61/112 (54%), Gaps = 13/112 (11%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D VF    +   VY  + +P+     +GYN TI  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 146 LGDAAGIIPRVLFELFD-----TLEANKDDYLVKCSFVELYNEELKDLLDST 192
                G+IP  +  +FD     T ++ +  Y VK S++E+YNE++ DLL  T
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSIT 248

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 92/188 (48%), Gaps = 32/188 (17%)

Query: 13  ERDAEPVQEPLVEKLATEELNILV-AVRCRG--RNEREIKAKSSVVVDVPDNGV----TN 65
           E+ A  V  P ++      +++L+ A+  +G   +E   KA SS      DN V    +N
Sbjct: 9   EQAASSVPLPTIDNSEPCHIDVLLRAIPEKGLPNDESTFKASSS------DNTVLFRTSN 62

Query: 66  EVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYG 125
               NTT D          T+  DKVF  +A+QK V + + +P   D + GYN TIL YG
Sbjct: 63  GPLQNTTGDT-------HSTFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYG 115

Query: 126 MTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTL---EANK-DDYLVKCSFVELY 181
            + +GK+Y++ G +        D  GI+P +   LF TL   E NK +++ V     E+Y
Sbjct: 116 PSFSGKSYSLIGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIY 167

Query: 182 NEELKDLL 189
            E+  DLL
Sbjct: 168 MEKTYDLL 175

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 13/137 (9%)

Query: 348 SRSHSIFTITL-YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTL 406
           SRSH +F + +  + +  ++ + S + L+DL G+E   +             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 407 GRVINSL----------ADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEE 456
              + SL          A  S    +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 457 TCSTLEYASKAKNIKNK 473
           T STL++    + I N+
Sbjct: 352 TLSTLKFGDSIRQINNR 368

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 71/133 (53%), Gaps = 12/133 (9%)

Query: 61  NGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCT 120
           N V N V   T+  +  A      T+  DKVF  +A+QK V + +  P  +D + GYN T
Sbjct: 50  NSVDNTVLFRTSKPLHNATGSPHSTFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNST 109

Query: 121 ILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEANKD----DYLVKCS 176
           IL YG + +GK+Y++ G +  +N       G++P +   LF+TLE N++    ++ V   
Sbjct: 110 ILTYGPSFSGKSYSLLGSQ--YN------EGVLPNICQVLFETLEENEETKGTNFCVSVL 161

Query: 177 FVELYNEELKDLL 189
             E+Y E+  DLL
Sbjct: 162 AFEIYMEKSYDLL 174

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 348 SRSHSIFTITLYKEQNGE-LFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTL 406
           S+SH +F + + +    E + + S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 407 GRVINSLADK----------SEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEE 456
             ++  LA K          S    +RES+LT +L+DSLGGN K  +I T   + + +  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 457 TCSTLEYASKAKNIKNK 473
           T STLE+    + I NK
Sbjct: 351 TISTLEFGDNIRQIINK 367

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 68/129 (52%), Gaps = 12/129 (9%)

Query: 65  NEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVY 124
           N V   T + +    K    T+  DKVF  +A+Q+ V + +  P+  D + GYN T++ Y
Sbjct: 54  NTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITY 113

Query: 125 GMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEANK----DDYLVKCSFVEL 180
           G + +GK+Y++ G +        ++ GI+P +   LFDTLE N+    D + V     E+
Sbjct: 114 GPSFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEI 165

Query: 181 YNEELKDLL 189
           Y E+  DLL
Sbjct: 166 YMEKTYDLL 174

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 348 SRSHSIFTITL-YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTL 406
           SRSH +F + +  + +  ++ + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 407 GRVINSLADK----------SEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEE 456
              + SL+ K          S    +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 457 TCSTLEYASKAKNIKNK 473
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGDSIRQINNK 367

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 62/110 (56%), Gaps = 12/110 (10%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  D VF    +   VYE  ++P+    + G+N TI  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 146 LGDAAGIIPRVLFELFDT---LEANKD-DYLVKCSFVELYNEELKDLLDS 191
           L    G+IP  +  LF     L  N D  + V  S++E+YNE + DLL+S
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLES 264

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 82/165 (49%), Gaps = 35/165 (21%)

Query: 338 VASTKMNDFSSRSHSIFTITLYK-EQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEA 396
           +  T  N  SSRSH+I  I L   +      R S ++L DLAGSE   R+    +R KE 
Sbjct: 332 IGETDYNARSSRSHAIVLIRLTSTDLESGTSRSSTLSLCDLAGSE---RATGQQERRKEG 388

Query: 397 GSINQSLLTLGRVINSL-ADK------------------------------SEHIPFRES 425
             IN+SLL LG VI+ L ADK                              + HIP+R+S
Sbjct: 389 SFINKSLLALGTVISKLSADKINPTGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDS 448

Query: 426 KLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNI 470
           KLTRLLQ +L G++    I T+      + ET +TL +AS+AKN+
Sbjct: 449 KLTRLLQPALSGDSIVTTICTVDTRNDAAAETINTLRFASRAKNV 493

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 75/150 (50%), Gaps = 14/150 (9%)

Query: 344 NDFSSRSHSIFTITLYKEQN-GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQS 402
           N+   RSH+I  +++ K     E   +S + +VDLAGS+ I ++ +     ++A  IN  
Sbjct: 225 NNLIQRSHTIMEVSIEKRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQ 284

Query: 403 LLTLGRVINSLA----------DKS---EHIPFRESKLTRLLQDSLGGNTKTALIATISP 449
           + ++  VIN L           D S     +P++ S LTRLL D LGGN KT  + T S 
Sbjct: 285 IKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSL 344

Query: 450 AKMTSEETCSTLEYASKAKNIKNKPQLGAF 479
            K    ET STL++    K+    P++  F
Sbjct: 345 KKNDWNETLSTLKFGYNCKSANTNPRINRF 374

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 65/112 (58%), Gaps = 16/112 (14%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           Y  DKVF  S    + ++E  E   +  ++GYN +I+ YG + TGK++ + G+++     
Sbjct: 73  YKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGEQQ----- 126

Query: 146 LGDAAGIIPRVLFELFDTLEA-----NKD-DYLVKCSFVELYNEELKDLLDS 191
                G+I ++L +LF+ ++      NK+  Y VK SF+E+Y E++ DL+DS
Sbjct: 127 ----DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLMDS 174

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 77/147 (52%), Gaps = 22/147 (14%)

Query: 50  AKSSVVVDVPDNGV---TNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIA 106
           ++S+  +D  +N V   T+E S  TT D          T+  DKVF  +A+Q+ V + + 
Sbjct: 43  SESTFKIDPHENTVLFRTSEPSHETTGDT-------YSTFKFDKVFDTNATQEDVQDFLV 95

Query: 107 EPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLEA 166
            P   D + GYN TI+ YG + +GK+Y++ G +        +  GI+P +   LF+TLE 
Sbjct: 96  RPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEK 147

Query: 167 NKD----DYLVKCSFVELYNEELKDLL 189
           NK+    ++ V     E++ E+  DLL
Sbjct: 148 NKETKGNNFSVSVLAFEIFMEKTYDLL 174

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 72/137 (52%), Gaps = 13/137 (9%)

Query: 348 SRSHSIFTITL-YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTL 406
           S+SH +F + +  + +N ++ R S + L+DL G+E   +   +         +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 407 GRVINSLADK----------SEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEE 456
             ++  L+ K          S    +RES+LT +L+DSLGGN KT +I T   + +++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 457 TCSTLEYASKAKNIKNK 473
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 99/212 (46%), Gaps = 16/212 (7%)

Query: 311 IQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDFSSRSHSIFTITLYK-EQNGELFRV 369
           + NL + H+ S  E             V ++K ++   R+++IF I + K ++  E    
Sbjct: 211 VDNLRQVHVASFKETLYYFNQAMS---VLNSKHDNSFPRTNTIFNINIEKLDKLDESTTS 267

Query: 370 SKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKS------------ 417
           S + LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+  S            
Sbjct: 268 SSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEFSLE 327

Query: 418 EHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLG 477
             +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K  PQ+ 
Sbjct: 328 NSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVPQIN 387

Query: 478 AFIMKDILVRSITSELAKIKSDLLSTKSKEGV 509
            F + +    SI  E  K+K +    +  E V
Sbjct: 388 KFGLNENKTLSIALENFKLKENNFKIQQAESV 419

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 91  VFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAA 150
           +F   ++  L+   I   +  + ++GYN  ++ YG   +GKTY++ G+      ++ D+ 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYSLYGN------DVDDSF 142

Query: 151 GIIPRVLFELFDTLEANKDD------YLVKCSFVELYNEELKDLLDSTN 193
           G+   +  +LF  +  +  D      ++VK SF+E++ +++ DLL   N
Sbjct: 143 GLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLLAPQN 191

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 60/108 (55%), Gaps = 8/108 (7%)

Query: 84  KTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHN 143
           +T+++DKVF PSASQ  V   +  P+  +   G N  +   G + TGKT+TM G +    
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQ---- 97

Query: 144 GELGDAAGIIPRVLFELFDTLEANKDDYL-VKCSFVELYNEELKDLLD 190
              G + G++ R+L ++F  +  N+   +    S VEL N+++ DLL+
Sbjct: 98  ---GVSQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLLN 142

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 78/190 (41%), Gaps = 51/190 (26%)

Query: 60  DNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNC 119
           DNG    +++N++ + G     N   Y  DK+F P      +   ++     D  KGYN 
Sbjct: 36  DNGTI--ITLNSSVNQGSLGGSNQ--YRFDKIFEPEKPDDEINSTLSFACINDLFKGYNS 91

Query: 120 TILVYGMTSTGKTYTMTG----------DEKLHNGELG---------------------- 147
           T + YG T TGKTYT+ G          D K  N                          
Sbjct: 92  TYISYGQTGTGKTYTLYGTAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKS 151

Query: 148 -------DAAGIIPRV---LFELFDTLEANKDD--YLVKCSFVELYNEELKDLLDSTNTA 195
                     G+I +V   LFE+ D + A +    +LV  SFVE+Y EE+ DLL   +T 
Sbjct: 152 ANSILQKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLLQHDDTL 211

Query: 196 TNSDNKKLRI 205
           +   NKKL +
Sbjct: 212 S---NKKLSL 218

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 7/134 (5%)

Query: 349 RSHSIFTITLYK-EQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLG 407
           RS +I  I L + +++ +L   S +  VDLAGS+  S+        + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 408 RVINSLADKSEHIP-----FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLE 462
            ++ +LA+ SE I      +R S LTR+L D L GN KT LI + S  K    ET STL 
Sbjct: 325 SMVYTLAN-SESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLG 383

Query: 463 YASKAKNIKNKPQL 476
           ++S A ++ N+ ++
Sbjct: 384 FSSYASSMSNQIKI 397

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 8/105 (7%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           Y  D +F   + +   Y+ I + L  D  KGYN TI+ YG TS+GK++ + GD    N  
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTND- 144

Query: 146 LGDAAGIIPRVLF-ELFDTLEANKDDYLVKCSFVELYNEELKDLL 189
            G    I  R+LF +  D L+      L   S  ELY +++ DLL
Sbjct: 145 -GLINHIADRLLFPQCEDNLKT-----LCSISMWELYIDKVYDLL 183

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 101/218 (46%), Gaps = 41/218 (18%)

Query: 310 YIQNLEEFHITSAMEXXXXXXXXXXXXXVASTKMNDF---SSRSHSIFTITLYKE----- 361
           +I++L + H+TS +E             +  T  N +   S   HS   I +  E     
Sbjct: 198 HIRDLHQIHVTSPIE-------------IKDTLKNGYKNISPLHHSKSQIFVRFEVQCID 244

Query: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADK----S 417
           +  ++ R S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    S
Sbjct: 245 RKDDVTRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNS 304

Query: 418 EHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLG 477
            H  F++S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P + 
Sbjct: 305 SH--FKDSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMN 359

Query: 478 AFIMK-----DILVRSITSE----LAKIKSDLLSTKSK 506
              +      D+LV+ +  +    LAKI  +LL T+ K
Sbjct: 360 KIGLNAKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIK 395

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 55/108 (50%), Gaps = 12/108 (11%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  +KV+     Q+ V E+I      + + G+N +I+ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH----- 122

Query: 146 LGDAAGIIPRVLFELFDTL----EANKDDYLVKCSFVELYNEELKDLL 189
                GI+ R+   +FD L    E + ++  +  +F EL+ E + DLL
Sbjct: 123 ---EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 68/137 (49%), Gaps = 11/137 (8%)

Query: 348 SRSHSIFTITL-YKEQNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTL 406
           SRS +   IT+  + +  E  + S + L+DLA S+ + ++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 407 GRVINSLAD---------KSEHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEET 457
            +V+  L++          S+H   R S+L + LQ ++GG++KT  +   S  K   E T
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHT-HRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENT 342

Query: 458 CSTLEYASKAKNIKNKP 474
             TL   S+ ++I N P
Sbjct: 343 VITLSLGSRLRSIHNFP 359

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 74/140 (52%), Gaps = 11/140 (7%)

Query: 349 RSHSIFTITLYKEQ---NGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLT 405
           RS+SI    ++ EQ     +L+++S ++ +DL G +  ++   +     E   +N  + +
Sbjct: 244 RSNSIIISKIHLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSS 302

Query: 406 LGRVINSLADKSEHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKMTSEETCS 459
              +I +L+D  + +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE   
Sbjct: 303 FQNLITTLSD-PKSLPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIE 361

Query: 460 TLEYASKAKNIKNKPQLGAF 479
            L++A   K+IKN   +  F
Sbjct: 362 MLKFAMGLKSIKNPLIMNVF 381

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 66/142 (46%), Gaps = 30/142 (21%)

Query: 80  KMNSKTYTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDE 139
           K++S+ +  D +F  ++ Q    E +     +D   GYN + + YG +++GK+ T+    
Sbjct: 63  KLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDLFDGYNQSFITYGKSNSGKSDTL---- 115

Query: 140 KLHNGELGDAAGIIPRVLFE-LFDTLEANKDD--------------YLVKCSFVELY-NE 183
                   +  G+I R+LFE LF  +++   D              +    S +E++ +E
Sbjct: 116 ------FNEKDGLI-RLLFEQLFKKVQSLTADNNNNNTREGNNILTFNFSLSMMEIFSSE 168

Query: 184 ELKDLLDSTNTATNSDNKKLRI 205
           ++ DLL +  T  N   K L++
Sbjct: 169 KIYDLLSNEYTKDNPILKSLKV 190

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 64/133 (48%), Gaps = 17/133 (12%)

Query: 343 MNDFSSRSHSIFTITLYKEQ---NGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSI 399
           M   +SRS+ +  I L  EQ     +L + S + L+D+A S+ I ++ ++   AKEA  +
Sbjct: 266 MKHLTSRSNIVIKINL--EQVFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKL 323

Query: 400 NQSLLTLGRVINSLADKSEHIPFRE-----------SKLTRLLQDSLGGNTKTALIATIS 448
           N  + +    IN LA+     P+ +           S L  ++   +GGN KT  I+TIS
Sbjct: 324 NYPMESFTSYINLLAETGTS-PYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTIS 382

Query: 449 PAKMTSEETCSTL 461
           P      ET  TL
Sbjct: 383 PLLANQNETFITL 395

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 86  YTVDKVFGPSASQK-LVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 141
           + VDKVF     Q  L+  +I +    +   G+N +I+ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 72/147 (48%), Gaps = 9/147 (6%)

Query: 50  AKSSVVVDV---PDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIA 106
           A   V++D+    +  V N   + T +D  +  K+  ++++  KV    A++   + E+A
Sbjct: 53  ASPFVLLDIQRDSNEAVGNSNHVQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELA 110

Query: 107 EPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA---AGIIPRVLFELFDT 163
             +  D + G NC +  YG      +  M G +  ++ E  D+   +G++ +    +F+ 
Sbjct: 111 SKVTDDVLSGINCCVTTYGSGLAADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNA 170

Query: 164 LEANK-DDYLVKCSFVELYNEELKDLL 189
           ++++   +Y V  S  E+Y +++ DLL
Sbjct: 171 IDSDSTSEYQVSLSLCEVYVDKVFDLL 197

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 6/67 (8%)

Query: 418 EHIPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLG 477
           + +P+++S+LT L+Q++LGGN++T ++      K   EET +TL +  + +NI N     
Sbjct: 336 QRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGVQLQNILN----- 390

Query: 478 AFIMKDI 484
            F+  D+
Sbjct: 391 -FVRADV 396

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 59/112 (52%), Gaps = 12/112 (10%)

Query: 86  YTVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGE 145
           +  +KV+        +++ ++E + +D   GY+ +I+ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 146 LGDAAGIIPRVLFELFDT---LEANKDDYL-VKCSFVELYNEELKDLLDSTN 193
             D+ GII     ++      LE +++  + ++ S +E+  E++ D+L S +
Sbjct: 141 --DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDMLHSAD 190

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 79/173 (45%), Gaps = 20/173 (11%)

Query: 348 SRSHSIFTITLYKEQ-NGELFRVSKMNLVDLAGSENISRSG--AMNQRAKEAGSINQSLL 404
           S+SH I  I + +   N ++ +   ++  DLA  + I +    ++   + E   +N    
Sbjct: 219 SKSHLITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLEST 278

Query: 405 TLGRVINSLADKSEH----IPFRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCST 460
           TL   I S+++ SE+    IP++ S LT+LL     GN KT +I T S  K    ET  T
Sbjct: 279 TLKNSIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLET 338

Query: 461 LEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLL--STKSKEGVYM 511
           L+   K ++I +   +    +            +K K DL+    KSKE  YM
Sbjct: 339 LKMGLKLESISSNVHMNKHALN-----------SKKKLDLIVEDMKSKEANYM 380

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 8/91 (8%)

Query: 101 VYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFEL 160
           +Y  I   L  +  +GY+  ++ YG   TGK+    G +  + G      G++   + +L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 161 FDTLEANKDD--YLVKCSFVELYNEELKDLL 189
           +D +++  +D  + V  S +E++ E++ DLL
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 14/68 (20%)

Query: 106 AEPLFQDFI----KGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELF 161
            EPL  D I    +G +C+++ YG ++TGKT+ +               GIIP  + +L+
Sbjct: 65  PEPLVIDNINELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLY 114

Query: 162 DTLEANKD 169
             LEA  D
Sbjct: 115 IYLEAQSD 122

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 18/106 (16%)

Query: 367 FRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESK 426
           FR   +  VDL   E++                 Q + +L  V+++  D  + I   +S+
Sbjct: 212 FRKCCIEFVDLCAQEDVL----------------QLVCSLVAVLSN--DNDKKIGKEKSQ 253

Query: 427 LTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKN 472
             +LL +S+GGN KT  I   S  +   + +  TLE+  K   + N
Sbjct: 254 FCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

>Suva_13.424 Chr13 complement(729834..731243) [1410 bp, 469 aa] {ON}
           YMR239C (REAL)
          Length = 469

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 926 PQLSRGKAEVPDE--ELHRLEKIPL--GITNKENVVDLQHRYPALQEKRKPEDEVLLQ 979
           P LSR + ++  E   LH L+K P+   I++ ENV D++H+ P LQE  K + E+L Q
Sbjct: 92  PSLSRYQLKLAAELKTLHDLKKDPILREISDYENVFDIEHKQPILQEINKSDMEILEQ 149

>TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.604
           YOR195W
          Length = 781

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 19/133 (14%)

Query: 514 EHYKDLHYDIECYKTELEESKRAIESLT-------AQNAMLQQERLSLKDDNACYKANIA 566
           +H   L   +    +E+E+  + IE L        A+   LQ+++L L+  NAC +++IA
Sbjct: 521 DHSDGLQAGLNARVSEIEQMSKKIEELNDDAEIGKAEIKELQEDKLELERTNACLESSIA 580

Query: 567 SLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFIS 626
            L+D+V   Q+   EQ  K+  I   L+ +Q  N  ++   HL E +Q          + 
Sbjct: 581 ELEDSVRNWQAKYHEQEEKD-KISLELESIQLKNNNIEAE-HLAELEQ----------LH 628

Query: 627 DEISNIRDTLKKH 639
             +S+++D LK++
Sbjct: 629 SNLSSLQDALKEN 641

>SAKL0E02486g Chr5 complement(196218..198395) [2178 bp, 725 aa] {ON}
           similar to uniprot|P49956 Saccharomyces cerevisiae
           YMR078C CTF18 Subunit of a complex with Ctf8p that
           shares some subunits with Replication Factor C and is
           required for sister chromatid cohesion may have
           overlapping functions with Rad24p in the DNA damage
           replication checkpoint
          Length = 725

 Score = 35.8 bits (81), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 142 HNGELGDAAGIIPRVLFELFDTLEANKDDYLVK 174
           HNGEL   + ++P   F+LF  + ANKDD L+K
Sbjct: 458 HNGELLRYSSLVPMAFFQLFSDI-ANKDDSLIK 489

>SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 668

 Score = 35.0 bits (79), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 59/135 (43%), Gaps = 38/135 (28%)

Query: 49  KAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVDKVFGPSASQKLVYEEIAEP 108
           K+K + VV VP+N    E+++ +  D GI   M  K  ++D++  P+ +          P
Sbjct: 98  KSKFTKVVRVPENEAEGEITLASLKDEGIIDNMLYK--SIDRMGFPALT----------P 145

Query: 109 LFQDFIKGYNCT---ILVYGMTSTGKTYTMTGDEKLHNGELGDAAGIIPRVLFELFDTLE 165
           + Q  IK    T   ++    T TGKT                 A +IP     +F+ L 
Sbjct: 146 VQQKTIKPILATTNDVIARAKTGTGKTL----------------AFLIP-----MFEHLL 184

Query: 166 ANKDD--YLVKCSFV 178
           AN+ D  Y+VKC  V
Sbjct: 185 ANRTDSQYMVKCVVV 199

>Suva_8.434 Chr8 (783961..785538) [1578 bp, 525 aa] {ON} YOR377W
           (REAL)
          Length = 525

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 10/141 (7%)

Query: 507 EGVYMSHEHYKDLH--YDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKAN 564
           E  Y+S E+Y   H  +D      EL+     +      NA+++Q    LKD N  Y A 
Sbjct: 89  ENYYLSSEYYSQPHPKHDYISVLPELKFDGVILNEQPEHNALMKQILEELKDSNGSYTAK 148

Query: 565 IASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTF 624
           I  L     T   ++          R +    +G  ++ KK I L      + + SI  F
Sbjct: 149 IFKL-----TTALTIPYAGPTSPTWRLICLPEEGYTDKWKKFIFLSNHCMCDGRTSIHFF 203

Query: 625 --ISDEISNIRDTLKKHIEYL 643
             + DE++NI+ T  K ++Y+
Sbjct: 204 QDLRDELNNIK-TPPKKLDYI 223

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 6/72 (8%)

Query: 370 SKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHI---PFRESK 426
           S+  +VD+ G++++ +S  +  +  E   +N SLLTLG+ IN+L      I   P  E  
Sbjct: 427 SEFTIVDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLAEFL 483

Query: 427 LTRLLQDSLGGN 438
           + R L++S  GN
Sbjct: 484 IRRALKNSRLGN 495

>Suva_13.257 Chr13 complement(404214..406430) [2217 bp, 738 aa] {ON}
           YMR078C (REAL)
          Length = 738

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 7/54 (12%)

Query: 142 HNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELK----DLLDS 191
           HNGEL   + ++P V F+ F  + ANKDD  +K S  E    ELK    D++DS
Sbjct: 476 HNGELLRYSSLVPLVFFQTFGDI-ANKDDIRMKNS--EYEQRELKRANLDIVDS 526

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
           MLP2Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved in the Tel1p pathway that
           controls telomere length
          Length = 1679

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 67/140 (47%), Gaps = 25/140 (17%)

Query: 505 SKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKAN 564
           SKEG Y +    K+L  ++E  +++L+   + IES+            S KD    +  N
Sbjct: 771 SKEGQYKAK--IKELENNLERLRSDLQSKIQEIESIR-----------SCKDSQLKWAQN 817

Query: 565 IASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTF 624
             ++ D  + ++S L E   KET I  L  +++  ++E++KT   ++F  Q         
Sbjct: 818 --TIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQ--------- 866

Query: 625 ISDEISNIRDTLKKHIEYLQ 644
            + + S +  TL+K +E +Q
Sbjct: 867 -NSDASTLEPTLRKELEQIQ 885

>NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {ON}
           Anc_4.268 YDL074C
          Length = 712

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 46/77 (59%), Gaps = 12/77 (15%)

Query: 828 HQALGSNLVEIRDVVSSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKN 887
           +Q L  +LV IR    ++RD++ + I+ ++  T   + I+++   N+++ +Q  R+++++
Sbjct: 379 NQILEKDLVRIR----TARDDLLSKIAILEKETTKSKMIKDLQTANEILTEQWNRVEERS 434

Query: 888 KSLSLFKEHSTETATTS 904
           KS++        TAT+S
Sbjct: 435 KSIT--------TATSS 443

>Kpol_1036.4 s1036 (12112..12792) [681 bp, 226 aa] {ON}
           (12112..12792) [681 nt, 227 aa]
          Length = 226

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDL 649
           K+ I+L +F + E    +S  +S+ + N+RD + KHIE  +   DL
Sbjct: 121 KRLINLIQFNKIETPTELSGLLSEYMDNLRDEMIKHIEPTRVYADL 166

>Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 67/135 (49%), Gaps = 17/135 (12%)

Query: 517  KDLHYDIECYKTELEESKRAIESLTAQNAMLQ----QERLSLKDDNACYKANI---ASLK 569
            K+L+   E   TE +  K+ I SLT     L+    Q+  +L+  NA +  ++     + 
Sbjct: 1657 KELYQRYEAVSTECQSLKKTIGSLTKTKEELESDLNQKTEALELSNAAFSKSVRENKEIS 1716

Query: 570  DNVVTLQSSLKEQITKETNIRSLLKDVQGA--------NEEMKKTIHLFEFKQQELQQSI 621
            + +  L+ +LK Q+ +      L+K +Q +        ++E +K IHLFE + Q LQ+  
Sbjct: 1717 EKIQYLEETLKLQMEQNARNGELVKKLQSSCSEYREKFDDEKQKNIHLFE-ENQTLQK-F 1774

Query: 622  STFISDEISNIRDTL 636
            +T +   I N++D L
Sbjct: 1775 NTDLQSHIENLQDRL 1789

>YMR078C Chr13 complement(422503..424728) [2226 bp, 741 aa] {ON}
           CTF18Subunit of a complex with Ctf8p that shares some
           subunits with Replication Factor C and is required for
           sister chromatid cohesion; may have overlapping
           functions with Rad24p in the DNA damage replication
           checkpoint
          Length = 741

 Score = 32.0 bits (71), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 142 HNGELGDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELK 186
           HNGEL   + ++P V F+ F  + ANKDD  +K S  E    ELK
Sbjct: 476 HNGELLRYSALVPLVFFQTFGDI-ANKDDIRMKNS--EYEQRELK 517

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,563,139
Number of extensions: 4018836
Number of successful extensions: 19587
Number of sequences better than 10.0: 704
Number of HSP's gapped: 19788
Number of HSP's successfully gapped: 1100
Length of query: 988
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 869
Effective length of database: 39,836,145
Effective search space: 34617610005
Effective search space used: 34617610005
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)