Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B03619g6.14ON46846824080.0
Skud_5.296.14ON60847215460.0
Smik_5.276.14ON60847215430.0
YEL060C (PRB1)6.14ON63547215340.0
Suva_5.76.14ON66447215360.0
SAKL0E01012g6.14ON54447715210.0
TDEL0G045506.14ON56446815210.0
KLTH0C11396g6.14ON55048614760.0
Kwal_56.223876.14ON54347414700.0
TBLA0A073006.14ON57347114560.0
NDAI0K028806.14ON70447414630.0
NCAS0F002206.14ON69542714400.0
KLLA0D00979g6.14ON56147714210.0
ZYRO0C07942g6.14ON54847214120.0
Kpol_1032.56.14ON68047213980.0
ACR012C6.14ON54148613830.0
Ecym_30186.14ON57547513760.0
KAFR0L003606.14ON50242213171e-179
KNAG0E009206.14ON53146513191e-178
Kpol_1045.756.14ON47742212941e-175
TPHA0M002306.14ON58544512571e-168
Smik_15.1726.14ON47841811441e-153
Suva_15.1786.14ON47641511411e-152
YOR003W (YSP3)6.14ON47841811401e-152
Skud_15.1646.14ON48241811391e-152
CAGL0E02651g6.14ON48542310211e-134
KAFR0B065506.14ON4563569631e-126
NCAS0D026306.14ON4513679261e-120
KNAG0F02970singletonON4203478761e-113
NDAI0I022806.14ON4823438751e-112
CAGL0L13266gsingletonON5794246655e-80
Kpol_1018.56.313ON4654424935e-56
Suva_3.846.313ON5273224722e-52
Smik_3.1496.313ON4913204641e-51
NCAS0D043906.313ON4923244641e-51
SAKL0A02002g6.313ON4793704631e-51
TDEL0A072806.313ON4364224602e-51
KLTH0A06094g6.313ON4963174599e-51
YCR045C (RRT12)6.313ON4913264581e-50
ZYRO0D08822g6.313ON4903534536e-50
Skud_3.1246.313ON5403274548e-50
TBLA0F039706.313ON7343264628e-50
Kpol_1028.616.313ON5183204442e-48
KNAG0I024706.313ON4753514377e-48
CAGL0L10802g6.313ON5173414397e-48
AAR069W6.313ON7683024392e-46
Kwal_23.61836.313ON4933264282e-46
NDAI0I005606.313ON4834504263e-46
KAFR0J024506.313ON4783494246e-46
Ecym_21056.313ON6103694228e-45
TPHA0D037606.313ON6073434174e-44
KLLA0F06028g6.313ON5083283984e-42
Kwal_33.133721.78ON3773003476e-36
KLTH0F02288g1.78ON3803083266e-33
TBLA0A067006.313ON4973293202e-31
Kpol_2000.691.78ON3863042961e-28
ZYRO0F16764g1.78ON3863162731e-25
TDEL0C062301.78ON3643052543e-23
TPHA0B045201.78ON3882682385e-21
TBLA0A054101.78ON3823132083e-17
NCAS0A008802.6ON83375840.100
SAKL0G00440g2.6ON83669830.15
YNL238W (KEX2)2.6ON814139800.35
NDAI0F038902.6ON83369800.35
Skud_14.1012.6ON819138790.44
NCAS0F004905.85ON98759770.85
ZYRO0F15598g2.6ON79063761.0
KNAG0L011507.185ON1055159741.6
Kpol_1050.725.85ON98941741.9
Suva_14.1062.6ON80964732.4
CAGL0I10945g8.608ON39267704.0
KAFR0B043405.85ON98741714.0
Ecym_64862.6ON78169714.2
KAFR0A080402.6ON76675714.5
Smik_14.972.6ON81464704.9
ZYRO0B08140g5.85ON98445696.5
TPHA0A052005.85ON99148697.0
Smik_16.665.85ON98741697.2
KLTH0H00418g2.6ON81169697.3
SAKL0F15070g7.482ON58667697.4
Skud_7.5745.85ON98741688.7
YGR240C (PFK1)5.85ON98741689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03619g
         (468 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   932   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   600   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   598   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   595   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   596   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   590   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   590   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   573   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   570   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   565   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   568   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   559   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   551   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   548   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   543   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   537   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   534   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   511   e-179
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   512   e-178
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   503   e-175
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   488   e-168
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   445   e-153
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   444   e-152
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   443   e-152
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   443   e-152
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   397   e-134
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   375   e-126
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     361   e-120
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              342   e-113
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   341   e-112
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   260   5e-80
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   194   5e-56
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   186   2e-52
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   183   1e-51
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   183   1e-51
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   182   1e-51
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   181   2e-51
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   181   9e-51
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   181   1e-50
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   179   6e-50
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   179   8e-50
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   182   8e-50
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   175   2e-48
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   172   7e-48
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   173   7e-48
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   173   2e-46
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   169   2e-46
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    168   3e-46
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   167   6e-46
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   167   8e-45
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   165   4e-44
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   157   4e-42
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   138   6e-36
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   130   6e-33
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   127   2e-31
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   118   1e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   109   1e-25
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...   102   3e-23
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    96   5e-21
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    85   3e-17
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    37   0.100
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    37   0.15 
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    35   0.35 
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    35   0.35 
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    35   0.44 
NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85 ...    34   0.85 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    34   1.0  
KNAG0L01150 Chr12 (203191..206358) [3168 bp, 1055 aa] {ON} Anc_7...    33   1.6  
Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa] ...    33   1.9  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    33   2.4  
CAGL0I10945g Chr9 (1079542..1080720) [1179 bp, 392 aa] {ON} simi...    32   4.0  
KAFR0B04340 Chr2 complement(898716..901679) [2964 bp, 987 aa] {O...    32   4.0  
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    32   4.2  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    32   4.5  
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    32   4.9  
ZYRO0B08140g Chr2 (635368..638322) [2955 bp, 984 aa] {ON} highly...    31   6.5  
TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa] ...    31   7.0  
Smik_16.66 Chr16 (123019..125982) [2964 bp, 987 aa] {ON} YGR240C...    31   7.2  
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    31   7.3  
SAKL0F15070g Chr6 (1213643..1215403) [1761 bp, 586 aa] {ON} simi...    31   7.4  
Skud_7.574 Chr7 complement(945547..948510) [2964 bp, 987 aa] {ON...    31   8.7  
YGR240C Chr7 complement(970771..973734) [2964 bp, 987 aa] {ON}  ...    31   9.1  

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/468 (97%), Positives = 455/468 (97%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPRGGIKDL 60
           MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPRGGIKDL
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPRGGIKDL 60

Query: 61  FNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDR 120
           FNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDR
Sbjct: 61  FNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDR 120

Query: 121 LNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTH 180
           LNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTH
Sbjct: 121 LNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTH 180

Query: 181 CAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGST 240
           CAGTIASKHYGI             SDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGST
Sbjct: 181 CAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGST 240

Query: 241 ANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDD 300
           ANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDD
Sbjct: 241 ANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDD 300

Query: 301 RAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSD 360
           RAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSD
Sbjct: 301 RAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSD 360

Query: 361 SEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSAD 420
           SEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSAD
Sbjct: 361 SEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSAD 420

Query: 421 EQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
           EQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII
Sbjct: 421 EQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/472 (63%), Positives = 361/472 (76%), Gaps = 18/472 (3%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGL---PRGGI 57
           ++P++YI+V KKGV  EA       V  A   ++ +L  E  FF       L     GGI
Sbjct: 151 IIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGI 210

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
           +D FNI+++F G IGYF + ++ L+ ++ +V+FVERDSVV A++FDTQN+APWGLARISH
Sbjct: 211 QDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISH 270

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           R+RLNLG+FNKYLYD+  G GVT+YVIDTG+NV H +F+ RA WGKTIPLND D+DGNGH
Sbjct: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 330

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236
           GTHCAGTIASKHYG+             S+GSGTMSDV+KGVEYAA+AH K+++  KK F
Sbjct: 331 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGF 390

Query: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296
           KGSTANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPASA+KAITVGAST
Sbjct: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450

Query: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356
           LSDDRAYFSNWGKCVDIFAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQ
Sbjct: 451 LSDDRAYFSNWGKCVDIFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQ 509

Query: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416
           P SDSEF++  +  +TP QLK KLI YSTK++L D+P+ D+PN LIYNG G DL  FWN 
Sbjct: 510 PGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPE-DTPNALIYNGGGQDLSAFWND 568

Query: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
           T     S      R   EL +D   + +G +   TD +F QVR++LDK+NII
Sbjct: 569 TKKSHSS------RFKQELNMD---EFIGSK---TDLIFEQVRDVLDKLNII 608

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/472 (63%), Positives = 361/472 (76%), Gaps = 18/472 (3%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGI 57
           ++P++YIVV KKGV  E V      V  A   ++ +L  E  FF       L     GGI
Sbjct: 151 IIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGI 210

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
           +D FNI+++F G IGYF + ++ L+ ++ +V+FVERDSVV A+ FDTQN+APWGLARISH
Sbjct: 211 QDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISH 270

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           R+RLNLG+FNKYLYD+  G GVT+YVIDTG+N+ H +F+ RA WGKTIPLND D+DGNGH
Sbjct: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 330

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236
           GTHCAGTIASKHYG+             S+GSGTMSDV+KGVEYAA+AH K+++  KK F
Sbjct: 331 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKKGF 390

Query: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296
           KGSTANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPASA+KAITVGAST
Sbjct: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450

Query: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356
           LSDDRAYFSNWGKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQ
Sbjct: 451 LSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGLLTYFLSLQ 509

Query: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416
           P SDSEF++  +  +TP QLKKKLI YSTK++L D+P+ D+PN LIYNG G DL  FWN 
Sbjct: 510 PGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPE-DTPNFLIYNGGGQDLSAFWND 568

Query: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
           T        HP      EL +D   + +G +   TD LF QVR++LDK+NII
Sbjct: 569 T-----KKSHPSGS-KHELNMD---EFIGSK---TDLLFEQVRDVLDKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/472 (62%), Positives = 360/472 (76%), Gaps = 18/472 (3%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGI 57
           ++P++YI+V K+G   E +     +V  A   ++ +L  E  FF       L     GGI
Sbjct: 178 IIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGI 237

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
           +D FNI++LF G IGYF + +V L+ ++ +V+FVERDS+V A+ FDTQN+APWGLARISH
Sbjct: 238 QDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISH 297

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           R+RLNLG+FNKYLYD+  G GVT+YVIDTG+N+ H +F+ RA WGKTIPLND D+DGNGH
Sbjct: 298 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 357

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236
           GTHCAGTIASKHYG+             S+GSGTMSDV+KGVEYAA+AH KE++  KK F
Sbjct: 358 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKGF 417

Query: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296
           KGSTANMSLGGGKSPALD+AVNAAV  GIHFAVAAGNENQDACNTSPASA+KAITVGAST
Sbjct: 418 KGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGAST 477

Query: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356
           LSDDRAYFSNWGKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQ
Sbjct: 478 LSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQ 536

Query: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416
           P SDSEF++  +  +TP QLKKKLI YSTK++L D+P+ D+PN+LIYNG G DL  FWN 
Sbjct: 537 PGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPE-DTPNVLIYNGGGQDLSAFWND 595

Query: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
           T     S          EL +D   + +G +   TD +F QVR++LDK+NII
Sbjct: 596 TKKSHSSG------FKQELNMD---EFIGSK---TDLIFDQVRDILDKLNII 635

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/472 (63%), Positives = 360/472 (76%), Gaps = 17/472 (3%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGI 57
           ++P++YI+V KK V PE  A     V  A   ++ +L  E  FF       L     GGI
Sbjct: 206 IIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGI 265

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
           +D FNI+ LF G IGYF + +V L+ ++ +V+FVE+DSVV A++FDTQN+APWGLAR+SH
Sbjct: 266 QDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH 325

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           R+RLNLG+FNKYLYD+  G GVT+YVIDTG+NV H +F+ RA WGKTIPLND D+DGNGH
Sbjct: 326 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 385

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236
           GTHCAGTIASKHYG+             S+GSGTMSDV+KGVEYAA+AH K+++  KK F
Sbjct: 386 GTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKKGF 445

Query: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296
           KGSTANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPASA+KAITVGAST
Sbjct: 446 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 505

Query: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356
           LSDDRAYFSN+GKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQ
Sbjct: 506 LSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGLLTYFLSLQ 564

Query: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416
           P SDSEF++  +  +TP QLKKKLI YSTK++L D+PD D+PN LIYNG G DL  FWN 
Sbjct: 565 PGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPD-DTPNALIYNGGGQDLSAFWND 623

Query: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
           T        H       EL LD   + +G +   TD +F QVR++LDK+NII
Sbjct: 624 T-----KKSHSSSGFKQELNLD---EFIGSK---TDLIFEQVRDVLDKLNII 664

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/477 (62%), Positives = 360/477 (75%), Gaps = 18/477 (3%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFF--------NFVNAEGL 52
           ++PH+YI+V KK  +PE ++     +S AHA ++  L  +  FF         +  A   
Sbjct: 77  IIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKS 136

Query: 53  PRGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGL 112
             GGI++ F+I ++  G IGYF + VV  +  +  VEF+E+DS+V AS FDTQN APWGL
Sbjct: 137 SEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGL 196

Query: 113 ARISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDI 172
           +RISHR+RLNLG+FNKYLYD+  G+GVT+YVIDTGINV H +F+GRA WGKT+P ND D 
Sbjct: 197 SRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDA 256

Query: 173 DGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKN 232
           DGNGHGTHCAGTIAS+HYG+             S+GSGTMSDV+KGVE+AAQ+H + SK 
Sbjct: 257 DGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKK 316

Query: 233 NKK-FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAIT 291
           NKK FKGSTANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPA+AE AIT
Sbjct: 317 NKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAIT 376

Query: 292 VGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTY 351
           VGASTLSDDRAYFSNWGKCVDIFAPGLN+LSTYIG +   TA+LSGTSMASPHVAGLLTY
Sbjct: 377 VGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIG-SETATATLSGTSMASPHVAGLLTY 435

Query: 352 FLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLG 411
           FLSLQPDSDSEF+ AS  G+TPAQLKKKLIAYSTK+VL +LP+ D+PN LIYNG G DL 
Sbjct: 436 FLSLQPDSDSEFFQAS--GITPAQLKKKLIAYSTKDVLYELPE-DTPNYLIYNGGGQDLS 492

Query: 412 VFWNSTSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
            FW  +  +EQ  E    +   +     L++++      TD LF +VR++ DK+NII
Sbjct: 493 DFWGKS--EEQVKEEGSIQDFKDF---KLSELIESFDTKTDLLFEEVRSVFDKLNII 544

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/468 (64%), Positives = 364/468 (77%), Gaps = 17/468 (3%)

Query: 3   PHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGL-PRGGIKDLF 61
           PH+YIVVLK   SPE +A  +  ++ +   ++ +L ++  FF+   A+G+   GGI+D F
Sbjct: 112 PHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFS---AQGVRTTGGIQDSF 167

Query: 62  NINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDRL 121
           ++  L  G +GYF + VV+L+ KS +V+FVE DS VHAS FDTQN APWGL+RISHR+RL
Sbjct: 168 DVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERL 227

Query: 122 NLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHC 181
           NLG+FNKYL+D+  G+GVT+YVIDTGINVKH +F+GRA WGKTIP ND D+DGNGHGTHC
Sbjct: 228 NLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHC 287

Query: 182 AGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-FKGST 240
           AGTIASKHYG+             S+GSG+MSDVIKGVE+AAQ+H K  K+ KK FKGST
Sbjct: 288 AGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFKGST 347

Query: 241 ANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDD 300
           ANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPA+AE+A+TVGASTLSDD
Sbjct: 348 ANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDD 407

Query: 301 RAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSD 360
           RAYFSN+GKCVDIFAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQPDSD
Sbjct: 408 RAYFSNYGKCVDIFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPDSD 466

Query: 361 SEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSAD 420
           S+F+DA   GVTP QLKKKLIAYSTK++L DLP+ D+PN LIYNG G  L  FW+     
Sbjct: 467 SDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPE-DTPNALIYNGGGHGLKGFWDG---- 521

Query: 421 EQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
                H +Q          L ++  +  A TD+LF QVR++LD++NII
Sbjct: 522 -----HDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/486 (60%), Positives = 356/486 (73%), Gaps = 33/486 (6%)

Query: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFF----NFVNAEGLP---- 53
           +PH+YIVV K+ +SPE V      VS AH  ++  L   H+FF    NFV          
Sbjct: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138

Query: 54  --------RGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQ 105
                    GGI+D F+++ L  G IGYF + +V  +  + +V+FVE+DSVV A  F TQ
Sbjct: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198

Query: 106 NNAPWGLARISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTI 165
           N APWGL+RISHR++LNLG+FNKYLYD+  G+GVT+YVIDTG+NV H +F+GRA WGKTI
Sbjct: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258

Query: 166 PLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQA 225
           P NDLD DGNGHGTHCAGTIASKHYG+             S+GSG+MSDV+KGVE+AA++
Sbjct: 259 PTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKS 318

Query: 226 HLKESKNNKK-FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPA 284
           H    K NKK FKGSTANMSLGGGKSPALDMAVNAAV AGIHFAVAAGNENQDACN+SPA
Sbjct: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378

Query: 285 SAEKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPH 344
           SAE A+TVGASTL+DDRAYFSNWGKCVDIFAPGLN+LSTYIG ++  TA+LSGTSMASPH
Sbjct: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SDTATATLSGTSMASPH 437

Query: 345 VAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYN 404
           VAGLLTYFLSLQPDSDSE++ A+  G+TP+QLKKKLIAYSTKNVL D+PD D+ N LI+N
Sbjct: 438 VAGLLTYFLSLQPDSDSEYFHAAG-GITPSQLKKKLIAYSTKNVLGDIPD-DTVNYLIFN 495

Query: 405 GAGGDLGVFWNSTSADEQSAEHPEQRIAAELG--LDSLAKMVGDRHAATDSLFGQVRNLL 462
           G G  L  FW      E   +  E  I++E+   +D+L +        TD L+ ++R + 
Sbjct: 496 GGGEGLDDFW----GKESVVDEVEDTISSEIESFIDALEE-------KTDVLYEEIREVF 544

Query: 463 DKMNII 468
           D MNII
Sbjct: 545 DHMNII 550

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/474 (61%), Positives = 354/474 (74%), Gaps = 17/474 (3%)

Query: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGL------PRG 55
           +PH+YIVV K  V PE V   +  VS AHA ++  L     FF     E +        G
Sbjct: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139

Query: 56  GIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARI 115
           GI D F++N + +G IGYF + +V  +  + +V FVE+DS+V+A+ FDTQN APWGL+RI
Sbjct: 140 GILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRI 199

Query: 116 SHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGN 175
           SHR++LNLG+FNKYLYD+A G+GVT+YVIDTGIN+ H +F+GRA WGKT+P NDLD DGN
Sbjct: 200 SHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGN 259

Query: 176 GHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK 235
           GHGTHCAGTIASKHYG+             S+GSG+MSDV+KGVE+AA++H    K NKK
Sbjct: 260 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKK 319

Query: 236 -FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGA 294
            FKGSTANMSLGGGKSPALDMAVNAAV AGIHFAVAAGNENQDACN+SPA+AE AITVGA
Sbjct: 320 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGA 379

Query: 295 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLS 354
           STL+DDRAYFSNWGKCVDIFAPGLN+LSTYIG +   TA+LSGTSMASPHVAGLLTYFLS
Sbjct: 380 STLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SETATATLSGTSMASPHVAGLLTYFLS 438

Query: 355 LQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
           LQPDSDSE++ A+  G+TP+QLKKKLIAYSTKN L DLP+ D+ N LIYNG G DL  FW
Sbjct: 439 LQPDSDSEYFHAAG-GITPSQLKKKLIAYSTKNALGDLPE-DTVNYLIYNGGGQDLDDFW 496

Query: 415 NSTSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
                 E+     +   A+E   +S+   + ++   TD L+ ++R + + +NII
Sbjct: 497 --VKDLEEKVADAKDNTASE--FESIIDALEEK---TDGLYEEIREIFEGLNII 543

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/471 (61%), Positives = 353/471 (74%), Gaps = 24/471 (5%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLP-RGGIKD 59
           ++PH+YI+  KK V+PE +      ++     +I  LP +H +FN V  EGL  +  I D
Sbjct: 124 IIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSV--EGLDLQQPIID 181

Query: 60  LFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRD 119
            FNIN L QG IGYF + V+  +  + +V+FVE+DS V+ + FDTQN APWGLARISHR+
Sbjct: 182 SFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHRE 241

Query: 120 RLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGT 179
           RLNLG+FNKYL+D+  GEGVTAYVIDTG+NV+H +F+GRA WGKTIP ND D+DGNGHGT
Sbjct: 242 RLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGT 301

Query: 180 HCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-FKG 238
           HCAGTIASKHYG+             S+GSG+MSDV+KGVEYA  +HL + KN K  FKG
Sbjct: 302 HCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKG 361

Query: 239 STANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLS 298
           STANMSLGGGKSP+LD+AVNAAV AGIHFAVAAGNENQDACNTSPASA+ AITVGASTLS
Sbjct: 362 STANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLS 421

Query: 299 DDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPD 358
           DDRAYFSNWGKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLL+YFLSLQP+
Sbjct: 422 DDRAYFSNWGKCVDVFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLSYFLSLQPE 480

Query: 359 SDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWN-ST 417
            DSEF  + K G+TPAQLKK+LI+Y TK++L D+P+  +PN+L++NGAG DL  FWN S 
Sbjct: 481 QDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPEL-TPNVLVFNGAGQDLSDFWNISK 539

Query: 418 SADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
            AD +S E           LD    +VG      D L+ Q   +  KMN++
Sbjct: 540 PADLESNE-------VYKNLD----LVG------DVLYDQFTGIFKKMNLL 573

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/474 (61%), Positives = 351/474 (74%), Gaps = 13/474 (2%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEG---LPRGGI 57
           ++P+KYI+V K  ++ + ++     +S     +   LP  H FF+  + E       GGI
Sbjct: 238 ILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNGGI 297

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
              FNIN++  G  GYF + V+ L+  + +V++VERDS+V  + F+TQNNAPWGL+RISH
Sbjct: 298 ISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISH 357

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           R+RLNLG+FNKYLYD+  G+GVT +VIDTGINV HV+F  RA WGKTIP ND DIDGNGH
Sbjct: 358 RERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGH 417

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFK 237
           GTHCAGTIAS HYG+             S+GSG+MSDVIKGVE+AA+ HL   KN K +K
Sbjct: 418 GTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYK 477

Query: 238 GSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTL 297
           GSTANMSLGGGKSP LD+AVNAAV AGIHF+VAAGNENQDACN+SPASAE AITVGASTL
Sbjct: 478 GSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTL 537

Query: 298 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQP 357
           SDDRAYFSNWG+CVD+FAPGLNILSTY+GD N  TA+LSGTSMASPHVAGLLTYFLSLQP
Sbjct: 538 SDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQP 597

Query: 358 DSDSEFYDASKHG-VTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416
           DS S F+++   G +TP QLKKKLIAYST ++L DLPD  +PN LIYNGAGGD+   WN 
Sbjct: 598 DSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPD-GTPNKLIYNGAGGDISDLWNG 656

Query: 417 TSADEQSAEHP--EQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
               EQ+ E P  E +I  E  +DS + M G     TD  F Q+RN+ +KMNII
Sbjct: 657 -KVQEQAHEEPAHEDKINFENLVDSDS-MSG----KTDLFFDQIRNVFEKMNII 704

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/427 (66%), Positives = 339/427 (79%), Gaps = 13/427 (3%)

Query: 1   MVPHKYIVVLKKGVSPEAV---ATFLNDVSAAHAAAIRDLPKEHDFFNF--VNAEGLPRG 55
           ++P++YIVV KK + PE V      +N +    AA    LPK+  FF+   +  E + +G
Sbjct: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAK---LPKDDKFFSASAIEDESINQG 154

Query: 56  GIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARI 115
           GI   FNI++L  G +GYF + V++L+  + +VE+VE+DS+V A+ FD QNNAPWGLARI
Sbjct: 155 GILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARI 214

Query: 116 SHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGN 175
           SHR+RLNLG+FNKYLYD+  G+GVT YVIDTGIN +H +F+ RA WGKTIPLND DIDGN
Sbjct: 215 SHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGN 274

Query: 176 GHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK 235
           GHGTHCAGTIAS HYG+             S+GSG+MSDVIKGVE+AA++H+K +K  KK
Sbjct: 275 GHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKK 334

Query: 236 -FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGA 294
            FKGSTANMSLGGGKSP LD+AVNAAV AGIHFAVAAGNENQDACNTSPASAE+AITVGA
Sbjct: 335 GFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA 394

Query: 295 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLS 354
           STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGD +  TA+LSGTSMASPHVAGLLTYFLS
Sbjct: 395 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDD-ATATLSGTSMASPHVAGLLTYFLS 453

Query: 355 LQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
           LQP SDSEF+D ++  +TPAQ+KKKLI YS+K+VL DLP+  +PN LI+NGAGG+L   W
Sbjct: 454 LQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLPE-GTPNKLIFNGAGGNLDDLW 510

Query: 415 NSTSADE 421
           N  S +E
Sbjct: 511 NKKSQEE 517

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/477 (59%), Positives = 350/477 (73%), Gaps = 22/477 (4%)

Query: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAE----GLP---- 53
           +P++YI+V KK  S + V      VS  HA A+  L     FF   + E    G+     
Sbjct: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156

Query: 54  RGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLA 113
            GGI+D F+I     G +GYF + V+  + +S +VEFVE DS+V +++F+TQN+APWGLA
Sbjct: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216

Query: 114 RISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDID 173
           RISHR++LNLG+FNKYLYD+  G+GVTAYV+DTG+NV H +FDGRA WGKTIP +D D+D
Sbjct: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276

Query: 174 GNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNN 233
           GNGHGTHCAGTI S HYG+             S+GSGTMSDV+KGVEY A+AH K  +  
Sbjct: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336

Query: 234 KK-FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITV 292
           KK FKGSTANMSLGGGKSPALD+AVNAAV AG+HFAVAAGNENQDACNTSPA+AE AITV
Sbjct: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396

Query: 293 GASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYF 352
           GASTLSD+RAYFSNWGKCVDIF PGLNILSTYIG ++  TA+LSGTSMA+PHV GLLTYF
Sbjct: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIG-SDTATATLSGTSMATPHVVGLLTYF 455

Query: 353 LSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGV 412
           LSLQPD+DSE++ A+  G+TP+QLKKKLI +STKNVL+DLP+ D+ N LIYNG G DL  
Sbjct: 456 LSLQPDADSEYFHAAG-GITPSQLKKKLIDFSTKNVLSDLPE-DTVNYLIYNGGGQDLDD 513

Query: 413 FW-NSTSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
            W    S  ++ + +PE          SL  ++    + TD++F  VR LLD+ NII
Sbjct: 514 LWGKDYSIGKEPSANPEF---------SLESLINSLDSKTDAIFDDVRQLLDQFNII 561

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/472 (58%), Positives = 346/472 (73%), Gaps = 15/472 (3%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGL---PRGGI 57
           ++ ++YI++ KKGV+P+ +      +   H   +  LP+EH FF  +  +G+   P GGI
Sbjct: 88  VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGI 147

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
              F+IN +  G  GYFP  V+ ++  S ++E VE+DSVV+    DT+N APWGLARISH
Sbjct: 148 DHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISH 207

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           R+RLNLG++NKYLYD  GG GVT+YVIDTG+NV H +F GRA+WGKTIP  DLD DGNGH
Sbjct: 208 RERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGH 267

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236
           GTHCAGTI S  YG+             S+GSG+MSDV+KGVE+AAQ H    K  K  F
Sbjct: 268 GTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGF 327

Query: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296
           KGSTANMSLGGGKSP+LD AVNAAV+AG++FAVAAGNE+QDACNTSPASA   ITVGAST
Sbjct: 328 KGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGAST 387

Query: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356
           LSDDRAYFSN+GKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLL YFLSLQ
Sbjct: 388 LSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDSSTATLSGTSMASPHVAGLLAYFLSLQ 446

Query: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416
           P SDSEF   S   ++P QLKKKL+A+STK+VL+D+P   +PNLLIYNG GGDL  FW S
Sbjct: 447 PGSDSEFDAGSS--ISPDQLKKKLLAFSTKDVLSDIPS-GTPNLLIYNGGGGDLSGFWGS 503

Query: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
               ++ A+  E     +L L  L   +G +   TD++FGQ+R L+D+++II
Sbjct: 504 ----KEVAQELEFNEKVDLELHDLVDELGSK---TDAVFGQIRGLMDRLDII 548

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/472 (60%), Positives = 349/472 (73%), Gaps = 26/472 (5%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDF-FNFVNAEGLPR--GGI 57
           ++P+KYI+V KK            DVS       +DL     F +  V+ E      GGI
Sbjct: 231 VIPNKYIIVFKK------------DVSVKDMQIHKDLIARAQFQYASVSDETSSSILGGI 278

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
           ++ FN+ +LF G IG+F E +V+ +  S IV+FVE+DS+VHA+  DTQNNAPWGLARISH
Sbjct: 279 EEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISH 338

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           RD LNLG++NKYLYD+  GEGVTAYVIDTGIN+KH EF GRA WGKTIP ND D+DGNGH
Sbjct: 339 RDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGH 398

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236
           GTHCAGTIASK+YG+             SDGSGTMSDV+KGVEYAA +H K  +  KK F
Sbjct: 399 GTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGF 458

Query: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296
           KGSTANMSLGGGKS +LD+AV+AAV +GIHFAVAAGNENQDACN+SPA++E AITVGAST
Sbjct: 459 KGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGAST 518

Query: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356
           LSDDRAYFSNWGKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLL+YFLS+Q
Sbjct: 519 LSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGLLSYFLSMQ 577

Query: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416
           PD+DSEF+ +  + ++PAQLKKKLIAYSTKN+  DLP+  +PNLL+YN AG ++  FW  
Sbjct: 578 PDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEK-TPNLLVYN-AGHNISDFWKP 635

Query: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
            S  E SAE P +R A E  L+ L   V       D+    ++ + ++M++ 
Sbjct: 636 KS--ESSAE-PNER-AKEFELEDL---VDSAQWIADTWLNGIQQVFERMDLF 680

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/486 (56%), Positives = 348/486 (71%), Gaps = 34/486 (6%)

Query: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEG--------LP 53
           +PHKYIVV ++GVS E  A  +  V AAHA ++  L ++H FF     E           
Sbjct: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130

Query: 54  RGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLA 113
            GGI+  F + +  +G +GYF E +V LL  +  V FVE DS+V AS+F TQN APWGLA
Sbjct: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLA 190

Query: 114 RISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDID 173
           R+SHR++LN G+FNKYLYD+  GEGVT+YVIDTGIN+ HV+F+ RA WGKTIP ND D D
Sbjct: 191 RVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250

Query: 174 GNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKES-KN 232
           GNGHGTHCAGTIASK YG+             S+G+G+MSDV++GVEYA +AH K + K 
Sbjct: 251 GNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310

Query: 233 NKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITV 292
           +K FKGSTANMSLGGG+S ALD+AV+AAV AGIHFAVAAGNENQDACNTSPA+++KAITV
Sbjct: 311 DKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITV 370

Query: 293 GASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYF 352
           GASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIG ++   A+LSGTSMASPHVAGLLTYF
Sbjct: 371 GASTLADDRAYFSNWGRCVDLFAPGMNILSTYIG-SDTAVATLSGTSMASPHVAGLLTYF 429

Query: 353 LSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGV 412
           LSLQPD DSEF +  K  ++P  LKKK+I + TK+ L+ LP   + N+LIYNG G DL  
Sbjct: 430 LSLQPDGDSEFRN--KQTISPEVLKKKVIDFGTKDALSSLP-ARTANVLIYNGGGADLSD 486

Query: 413 FWNS----------TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLL 462
           FW +          T AD++ A          +G D L +++ +  ++TD++F   R +L
Sbjct: 487 FWGNKPKKVSGPKFTYADDEEA----------MGSD-LDRLIHELESSTDAMFSGFRTIL 535

Query: 463 DKMNII 468
           D+MNII
Sbjct: 536 DRMNII 541

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/475 (57%), Positives = 344/475 (72%), Gaps = 16/475 (3%)

Query: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNF---VNAEGLP----R 54
           +PH+YIV+ K GV+   V    + V+ AH   I  L   H FF+    ++ EG+      
Sbjct: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168

Query: 55  GGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLAR 114
           GGI+++F I    +G  GYF + ++ L+ +S +V+ +E+DS+VHAS+F+TQ  APWGLAR
Sbjct: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228

Query: 115 ISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDG 174
           +SHR+RLNLG+FNKYLYD+  G+GVTAYVIDTGIN+ HVEF+GRAQWGKTIP ND D DG
Sbjct: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288

Query: 175 NGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNK 234
           NGHGTHCAGTIASK YG+             ++G+GTMSDV++GVEY    H K S  + 
Sbjct: 289 NGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKAS-GDP 347

Query: 235 KFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGA 294
            FKGSTANMSLGGGKS AL++AV+AAV+AGIHFAVAAGNENQDACNTSPAS++K ITV A
Sbjct: 348 NFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAA 407

Query: 295 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLS 354
           STLSDDRAYFSNWG CVDIFAPGLNILSTYIG ++   A+LSGTSMASPHVAGLL YFLS
Sbjct: 408 STLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTSMASPHVAGLLAYFLS 466

Query: 355 LQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
           LQPDS SE+Y  S   ++P  LKKK++AY +KN+L ++P   + N LI+NG GG L  FW
Sbjct: 467 LQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVP-ARTANNLIFNGGGGSLDSFW 523

Query: 415 NS-TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
           NS     EQ         A +   +SL   +   H+ + SLFG++RN LD++++I
Sbjct: 524 NSKCDGCEQEKVSSSHGKADDFESESLMDCL---HSTSHSLFGEIRNFLDRLDLI 575

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  511 bits (1317), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 312/422 (73%), Gaps = 13/422 (3%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAE-GLPR----- 54
           ++PH+YI+V K GVS E +      ++  H    +     +DF  ++  +  +P      
Sbjct: 57  IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQ--QSSAFSNDFTEYLQTDINVPESMRQS 114

Query: 55  -GGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLA 113
            GGI   F+I+ L  G I Y  + ++  +  + ++ F+E D++VH ++F+TQNNAPWGLA
Sbjct: 115 LGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLA 174

Query: 114 RISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDID 173
           RISHR+ LNL NFNKYLYD+  G+ V AYVIDTG++V HVEF  RA WGKTIPLND DID
Sbjct: 175 RISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDID 234

Query: 174 GNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNN 233
           GNGHGTH AGTI S+HYG+             S+GSG+MSDV+KGVE+A  +HL+  KN 
Sbjct: 235 GNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNE 294

Query: 234 KKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVG 293
           K  KGS ANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQ+ACN+SPASAE+A+TVG
Sbjct: 295 KNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVG 354

Query: 294 ASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFL 353
           AST+SD+RAYFSNWG+CVDIFAPGLNILSTYIG  +  TA+LSGTSMASPHVAGLL Y+L
Sbjct: 355 ASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYL 414

Query: 354 SLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVF 413
           SLQP+  SEF   S   ++ +QLKKKLI Y+TK+VL DLP+  +PN+LIYNG G DL  F
Sbjct: 415 SLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPE-GTPNVLIYNGGGQDLSDF 470

Query: 414 WN 415
           WN
Sbjct: 471 WN 472

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  512 bits (1319), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 269/465 (57%), Positives = 335/465 (72%), Gaps = 31/465 (6%)

Query: 5   KYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPRGGIKDLFNIN 64
           KYI++ K+GV+ E ++        AH   ++ +  E    + V+A+G+    + D F++ 
Sbjct: 97  KYIILFKEGVTAEQIS--------AHKQLLQQVLLE---TSDVSAQGIV-ADVLDSFDLE 144

Query: 65  DLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDRLNLG 124
            +  G +      V++L+ +S  V+ VE+DS VH + FDTQNNAPWGLARISHRD L+LG
Sbjct: 145 GVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLG 204

Query: 125 NFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGT 184
           +FNKYLYD+A GEGV +Y+IDTGINVKH EF+GRAQWGKTIP ND D DGNGHGTHCAGT
Sbjct: 205 SFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGT 264

Query: 185 IASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESK-NNKKFKGSTANM 243
           IASKHYG+             S+GSG+MSDVI GVE+AA+ H  ++K N+KKFKGSTANM
Sbjct: 265 IASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANM 324

Query: 244 SLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDRAY 303
           SLGGGKSP+LD  V+AAV  G+HF+VAAGNENQDACNTSPA++E+AITVGASTLSDDRAY
Sbjct: 325 SLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAY 384

Query: 304 FSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEF 363
           FSNWG CVDIFAPGLNILSTY G ++  TA+LSGTSMASPHVAGLLTYFLSLQP+  S+F
Sbjct: 385 FSNWGSCVDIFAPGLNILSTYTG-SDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQF 443

Query: 364 YDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSADEQS 423
             +++  +TP QLKKKL+ YSTK VL DLP+ D+PN LIYNG G DL  FW     D+  
Sbjct: 444 GTSAQ--ITPEQLKKKLLDYSTKGVLFDLPE-DTPNALIYNGGGADLSDFW----GDKGK 496

Query: 424 AEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468
             H              A    +  A++D++F QVR +  K+NI 
Sbjct: 497 KSHKPL----------FAHEYDNVWASSDAMFEQVRAMFGKLNIF 531

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  503 bits (1294), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 310/422 (73%), Gaps = 10/422 (2%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNF-----VNAEGLPRG 55
           ++P+ YIVV  +GV+   ++  +  +S     ++ DLP +H+FF       VN+ GL  G
Sbjct: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGL-LG 92

Query: 56  GIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARI 115
           G++D+F I +   G  G F + VV+ L  S +V+F+ERDS+VH +   TQ NAPWGLARI
Sbjct: 93  GVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARI 152

Query: 116 SHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGN 175
           SHR RLNL  FNKYLYD+ GG+GV AYVIDTGIN+ +V+F GRA WGKTIP  + ++DGN
Sbjct: 153 SHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGN 212

Query: 176 GHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKK 235
           GHGTH AGTIAS HYG+             S+G+G+MSDV+KGVEY   AH ++      
Sbjct: 213 GHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQRDV-GTAG 271

Query: 236 FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAS 295
           FKGS ANMSLGGGKS +LD+AVNAAV AG+HFAVAAGNENQDACNTSPA+AE+AITVGAS
Sbjct: 272 FKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVGAS 331

Query: 296 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSL 355
           TLSD RAYFSNWG+CV IFAPGLNILSTYIG  +  TA+LSGTSMASPH+AGL+ YFLSL
Sbjct: 332 TLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPD-ATATLSGTSMASPHIAGLVAYFLSL 390

Query: 356 QPDSDSEFYDASK-HGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
           QP   S+FY   +   +TP QLKKK++A+ TKN L DLP  ++PN++ YNGAG  L  FW
Sbjct: 391 QPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLP-ANTPNVIAYNGAGKSLEDFW 449

Query: 415 NS 416
           N+
Sbjct: 450 NA 451

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  488 bits (1257), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 271/445 (60%), Positives = 320/445 (71%), Gaps = 19/445 (4%)

Query: 5   KYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPRG--GIKDLFN 62
           +YI+V KKGV  E V   L  +SA      R L +E        A  L  G   + D F 
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMMSAL----FRRLSEEQRPAAAPGASALRDGFDRVMDTFE 190

Query: 63  INDLFQGLIGYFPEP-VVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDRL 121
           +   F G I     P +V  +  + +V++VE+DSVVH+ + +TQNNAPWGLARISHR+ L
Sbjct: 191 VAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGL 249

Query: 122 NLGNFNKYLY-DNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTH 180
           NLGNFNKYLY  N+ G+GVTAYV+DTGI+V H+EF  RA+WGKTIP+ND DIDGNGHGTH
Sbjct: 250 NLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTH 309

Query: 181 CAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAA---QAHLKESKNNKK-- 235
           CAGTI S+HYG+             SDGSGTMSDV+KGVE+ A     HL+ES+ +K   
Sbjct: 310 CAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSN 369

Query: 236 FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAS 295
           +KG+TANMSLGGGKSPALD AVNAAV AG+HFAVAAGNENQDACN+SPA+AE AITVGAS
Sbjct: 370 YKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGAS 429

Query: 296 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSL 355
           TLSDDRAYFSN+GKCVDIFAPGLNILSTYIG TN  TA+LSGTSMASPHVAGLLTY LSL
Sbjct: 430 TLSDDRAYFSNYGKCVDIFAPGLNILSTYIG-TNDATATLSGTSMASPHVAGLLTYLLSL 488

Query: 356 QPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWN 415
           QPD  SEFY  +   +TP Q+KKK+I Y+TKN L DLP  D+PN LIYNG G +   FW 
Sbjct: 489 QPDKGSEFYVPNSE-LTPLQMKKKIIDYATKNALADLP-ADTPNKLIYNG-GFNSTDFWA 545

Query: 416 STSADEQSAEHPEQRIAAELGLDSL 440
           S +A  QS +    R +    LDS+
Sbjct: 546 SAAA-PQSHKVKTNRYSLGSFLDSI 569

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  445 bits (1144), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 299/418 (71%), Gaps = 9/418 (2%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVN---AEGLPRGGI 57
           ++P++YIVV  + +S +++ +    V  AH+ ++  L ++  F   V+   A  L  GGI
Sbjct: 66  LIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGI 125

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
              F+IN LF+G  GYF + ++ L+ +  +++F+E++S V  SN   Q +APWGL RISH
Sbjct: 126 DSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISH 185

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           R++   G   +YLY++A G GVT+YV+DTGI+ +H +F+GRA WG  IP ND   D NGH
Sbjct: 186 REKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGH 245

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKES-KNNKKF 236
           GTHCAG I SKHYG+             S+G GT+SDVIKG+EY A+ H++ S K +K+F
Sbjct: 246 GTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEF 305

Query: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296
           KGSTAN+SLG  KS A++MAV+AAV +G+HFA+AAGNEN+DAC +SPA A+K+ITVGAST
Sbjct: 306 KGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGAST 365

Query: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356
            SDDRA+FSNWG CVD+FAPG+NI+STYIG  N  T SLSGTSMA+PHVAG+L+YFLSLQ
Sbjct: 366 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGMLSYFLSLQ 424

Query: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
           P  DSE++D   + ++P +LK+K++ +ST  VL D+ D ++PN LIYNG G  L   W
Sbjct: 425 PAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGD-NTPNRLIYNGGGKILDDLW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  444 bits (1141), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/415 (53%), Positives = 292/415 (70%), Gaps = 7/415 (1%)

Query: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEG-LPRGGIKDL 60
           +P++YI+   +  S  ++ +    +      ++  L K+  FF   +A   L  GGI   
Sbjct: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSF 126

Query: 61  FNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDR 120
           F+IN LF+G  GYF E V+K + +  I++F+E++S V  +N   Q  APWGL RISHR++
Sbjct: 127 FDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREK 186

Query: 121 LNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTH 180
              G   +YLY++A G GVT+YV+DTGI++ H +F+GRA WG  IP ND   D NGHGTH
Sbjct: 187 AKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTH 246

Query: 181 CAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKN-NKKFKGS 239
           CAG I S+H+G+             S+G GT+SDVIKG+EY  + H+  SK    KFKGS
Sbjct: 247 CAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFKGS 306

Query: 240 TANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSD 299
           TAN+SLG  KSPA++MAVNAAV +G+HFA+AAGNE++DAC +SPA AEK+ITVGAST SD
Sbjct: 307 TANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSD 366

Query: 300 DRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDS 359
           DRA+FS+WG CVD+FAPG+NILSTYIG  N  + SLSGTSMA+PHVAG+L+YFLSLQP S
Sbjct: 367 DRAFFSDWGTCVDVFAPGVNILSTYIGSRN-ASLSLSGTSMAAPHVAGILSYFLSLQPSS 425

Query: 360 DSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
           DSEF+D++   V+P QLK+K+I +ST+ VL D+ + D+PN LIYNG G  L  FW
Sbjct: 426 DSEFFDST---VSPQQLKEKIINFSTQGVLGDVGE-DTPNRLIYNGGGRKLDNFW 476

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  443 bits (1140), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 215/418 (51%), Positives = 300/418 (71%), Gaps = 9/418 (2%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGI 57
            +P++Y++V  + +S + + + +  V   H+ ++  L +   F+  +++    +   GGI
Sbjct: 66  FLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQFGGI 125

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
            + F+IN LF+G  GYF + ++K++ +  I++FVE+++ V  SN   Q  APWGL R+SH
Sbjct: 126 DNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHRVSH 185

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           R++   G   +YLY++A G+GVT+YV+DTGI+ +H +F+GRA+WG  IP ND   D NGH
Sbjct: 186 REKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNGH 245

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKES-KNNKKF 236
           GTHCAG I SKH+G+             S+G GT+SDVIKG+EY  + H++ S K NK+F
Sbjct: 246 GTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKEF 305

Query: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296
           KGSTAN+SLG  KS A++MAVNAAV +G+HFA+AAGNE++DAC +SPA AEK+ITVGAST
Sbjct: 306 KGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGAST 365

Query: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356
            SDDRA+FSNWG CVD+FAPG+NI+STYIG  N  T SLSGTSMASPHVAG+L+YFLSLQ
Sbjct: 366 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNA-TLSLSGTSMASPHVAGILSYFLSLQ 424

Query: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
           P  DSEF++ +    +P +LK+K++ +ST+ VL D+ D D+PN LIYNG G  L  FW
Sbjct: 425 PAPDSEFFNDAP---SPQELKEKVLKFSTQGVLGDIGD-DTPNKLIYNGGGKKLDGFW 478

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  443 bits (1139), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/418 (51%), Positives = 292/418 (69%), Gaps = 11/418 (2%)

Query: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGIK 58
           +P++YI+V  + ++   + +    +  A   ++  + ++  F   V+A   P    GGI 
Sbjct: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128

Query: 59  DLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHR 118
             F+IN LF+G  GYF + V++++ +  +V+F+E +S V  SN   Q +APWGL RISHR
Sbjct: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188

Query: 119 DRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHG 178
           +R   G   +YLY++A G GVT+YV+DTGI+ +H +F+GRA+WG  IP ND   D NGHG
Sbjct: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248

Query: 179 THCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNN-KKFK 237
           THCAG I S+H+G+             S+G GT+SDVIKG+EY A+ H+  SK    KFK
Sbjct: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGSKFK 308

Query: 238 GSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTL 297
           GSTAN+SLG  KSPA++MAVNAAV  G+HFA+AAGNE++DAC +SPA AEK+ITVGAST 
Sbjct: 309 GSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368

Query: 298 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQP 357
           SDDRA+FSNWG CVD+FAPG+NI+STYIG  N  T SLSGTSMA+PHVAG+L+Y LSLQP
Sbjct: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGILSYLLSLQP 427

Query: 358 DSDSE-FYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
             DSE FYD     V+P QLK+K++ +ST+ VL D+ + ++PN L+YNG G  L  FW
Sbjct: 428 AQDSEFFYDT----VSPQQLKEKILKFSTRGVLGDV-NEETPNRLVYNGGGKKLDEFW 480

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  397 bits (1021), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 214/423 (50%), Positives = 286/423 (67%), Gaps = 17/423 (4%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDF-----FNFVNAEGLPRG 55
           ++P++YIV+ K  V+ + + + L+ +   ++++I    ++ DF     +N ++  G+   
Sbjct: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDISTRGI--- 127

Query: 56  GIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARI 115
           G++  F+I     G IGYF E   K +  S +VE VE DS+V  +N+  Q + PWGL RI
Sbjct: 128 GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRI 187

Query: 116 SHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGN 175
           S R++L +     Y YD+ GG+    +VIDTGI V H +F+GRA WGKTI  ND D D N
Sbjct: 188 SQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLN 247

Query: 176 GHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAH--LKESKNN 233
           GHGTHCAGTIASKHYGI             SDGSG+MSDVI+GVEY  +A+  LK++K+N
Sbjct: 248 GHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSN 307

Query: 234 KKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVG 293
              KG+  NMSLG  KS AL+ A++AA +AGI FAVAAGNE+ DACN+SPASA   ITVG
Sbjct: 308 --LKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVG 365

Query: 294 ASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFL 353
            STLSDD A+FSN+G+CVDIFAPG+NI+STYIG  N  T SLSGTSM+SPHVAG+L Y+L
Sbjct: 366 GSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKN-ATESLSGTSMSSPHVAGVLAYYL 424

Query: 354 SLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVF 413
           SLQPD  S+FY      ++P  LKKK++ Y+T   L+ LP  ++ NLL+YNG G +L  F
Sbjct: 425 SLQPDHKSQFYHEHS-AISPKILKKKVLNYATNGTLSYLP-AETVNLLVYNGGGKNLSKF 482

Query: 414 WNS 416
           W +
Sbjct: 483 WGT 485

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  375 bits (963), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 246/356 (69%), Gaps = 8/356 (2%)

Query: 59  DLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHR 118
           ++F I     G I   P   ++LL +  IV+ +E DS VHA     Q + PWGL+RIS R
Sbjct: 106 NIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQR 165

Query: 119 DRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHG 178
            R+ +G    Y YD+A    VTAYV+DTGI + H +F+GRA+WGKTI  ND+D D +GHG
Sbjct: 166 PRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHG 225

Query: 179 THCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKG 238
           TH AG IAS  +G+             S+G G MSDV+KG+E+    H   SKN    KG
Sbjct: 226 THVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---SKNKNYSKG 282

Query: 239 STANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLS 298
           S  N+SLG  KSPAL +A++AA+S  IHFAVAAGNEN DAC TSPA A +AITVGAS  S
Sbjct: 283 SVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFS 342

Query: 299 DDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPD 358
           D+RA+FSNWG+CVD+FAPG+N++STYIG  N  T SLSGTS A+P+ AGL+ Y+LSLQPD
Sbjct: 343 DERAFFSNWGECVDVFAPGMNVMSTYIGSDN-ATLSLSGTSAAAPYTAGLIAYYLSLQPD 401

Query: 359 SDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
            DS ++      +TP++LK+K++A+ +K+VL +LP+ ++PN++IYNGAG +L  FW
Sbjct: 402 KDSGYFTGE---MTPSKLKEKIVAFGSKDVLYELPE-NTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  361 bits (926), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 236/367 (64%), Gaps = 6/367 (1%)

Query: 53  PRGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGL 112
           P+  I   F +    QG     PE +++ L    I++ +E+DS VHA     Q ++PWGL
Sbjct: 86  PQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGL 145

Query: 113 ARISHRDRLNLGNFNKYLYDNAGGEGVT-AYVIDTGINVKHVEFDGRAQWGKTI-PLNDL 170
           ARIS R+RL L     Y YD++G    T  Y++DTGIN  H EF GRA+WG    P+   
Sbjct: 146 ARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPN 205

Query: 171 DIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKES 230
             D NGHGTHCAG I S  YG+             + G G MS VI+G+EY  Q H ++ 
Sbjct: 206 QEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDM 265

Query: 231 KNNKK--FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEK 288
           K   +  FKGS  N+SLG GKSPAL   + AAV  G+HFAVAAGNE+ DAC+TSPA +  
Sbjct: 266 KKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPH 325

Query: 289 AITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGL 348
           A+TVGAS+ SDDR +FSNWG CVD+FAPG+NI+STYIG  N ET SLSGTSM++P V GL
Sbjct: 326 ALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGL 385

Query: 349 LTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGG 408
           + YFLSLQPD+ S+FY       TP QLK K+I++ST+ VL ++P+  +PN ++YNG G 
Sbjct: 386 IAYFLSLQPDTKSQFYTGIT-SPTPYQLKYKIISFSTEGVLHEIPE-GTPNRIVYNGGGH 443

Query: 409 DLGVFWN 415
            L  FWN
Sbjct: 444 SLKDFWN 450

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  342 bits (876), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/347 (48%), Positives = 232/347 (66%), Gaps = 8/347 (2%)

Query: 61  FNINDLFQGL-IGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRD 119
           F+I D   G  +  FP   V  L +   VE VE +S V+A N   Q + PWGL R+S RD
Sbjct: 77  FHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRD 136

Query: 120 RLNLGNFNKYLYDNAG-GEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHG 178
           R+ +G+   Y YD  G  + V  Y++DTGI V H EF+GRA+WGKTI  ND D D NGHG
Sbjct: 137 RVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHG 196

Query: 179 THCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKG 238
           THCAG +    YG+             + G G MSDVI+G+E+A   HL  ++N  + +G
Sbjct: 197 THCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHL--TRNQDEVRG 254

Query: 239 STANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLS 298
           S  N+SLG G+SPAL   V AA++ G+HFAVAAGNE+ +AC +SPA+ +  +TVG ST S
Sbjct: 255 SIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFS 314

Query: 299 DDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPD 358
           DDRA+FSNWG C+D+FAPG+N+ S+Y+G    +T SLSGTS ++PHVAGL+ Y LSL+PD
Sbjct: 315 DDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPD 374

Query: 359 SDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNG 405
           + S+F+ A  +   PAQLK+KL++ +T+  L ++PD D+ NL+I+NG
Sbjct: 375 TKSQFHTAWSN---PAQLKQKLVSLATEGKLFEVPD-DTANLMIFNG 417

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  341 bits (875), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 178/343 (51%), Positives = 234/343 (68%), Gaps = 13/343 (3%)

Query: 87  IVEFVERDSVVHASNFDTQNNAPWGLARISHRDRLNLGNFNKYLYD-NAGGEGVTAYVID 145
           I++ +ERDS VH + F TQ ++ WGL+RIS R+ L L     Y YD N  G+GV  Y++D
Sbjct: 143 IIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILD 202

Query: 146 TGINVKHVEFDGRAQWGKTIPLNDLDI-DGNGHGTHCAGTIASKHYGIXXXXXXXXXXXX 204
           TGIN  H+EF+GRA WG ++P+ +  + D NGHGTHCAG I SK YG+            
Sbjct: 203 TGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVL 262

Query: 205 XSDGSGTMSDVIKGVEYAAQAHLKESKN-------NKKFKGSTANMSLGGGKSPALDMAV 257
              G G+MSDVI G+E+ A +H  ++ N       + +FKGS  N+SLG  KSP+LD+A+
Sbjct: 263 DFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIAL 322

Query: 258 NAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDRAYFSNWGKCVDIFAPG 317
            +A   GIH  VAAGNE++DAC TSPA +   ITVGAS+ SDDRA+FSNWG CVD+FAPG
Sbjct: 323 ESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPG 382

Query: 318 LNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLK 377
           +NI STYIG  N ET SLSG+SM+SP V+GL  Y+LSLQPD  S+F+D+    +TP QLK
Sbjct: 383 INIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQFHDSL---MTPDQLK 439

Query: 378 KKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSAD 420
           +K+I +ST  +L +LP  D+ N L+YNG G DL  FWN+T  +
Sbjct: 440 RKIIDFSTNGMLKELP-LDTANKLVYNGGGKDLSGFWNATRKE 481

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  260 bits (665), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 153/424 (36%), Positives = 233/424 (54%), Gaps = 12/424 (2%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGI 57
           +VP++YIV+ K       +   +  V+         L     FF+    +       GG+
Sbjct: 68  IVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKEFSTEELGGV 127

Query: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117
              F+I   F G +GYF + VV+ + K  IV++VE DS++   + +T +N+ W LARISH
Sbjct: 128 LYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHLARISH 187

Query: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177
           R +L L NFN+Y +D  GG+ + AY++DTG+   H  +  R   G  I  N+ + D NGH
Sbjct: 188 RPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDERDMNGH 247

Query: 178 GTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFK 237
           GT  AG +  +  G+               G GT+S++IKG+ +    H +  + N    
Sbjct: 248 GTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRIEKNGVL- 306

Query: 238 GSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTL 297
           G+    S+ G KS +L+ A +  VS+GIH  V AG +  +ACN+SPAS+ K ITV   ++
Sbjct: 307 GAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITVAGMSI 366

Query: 298 SDDRAYFSNWGKCVDIFAPGLNILSTYIG-DTNRET--ASLSGTSMASPHVAGLLTYFLS 354
           +D+     NWG CVDI+ PG  + +TY   + N+ T   S++G+S A+  VAGLL YF S
Sbjct: 367 TDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLLAYFAS 426

Query: 355 LQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414
           LQP   +         +TP +LK++LI + TK  LT+L +  SPN++ +NGAGG+L  F+
Sbjct: 427 LQPGLGT----PDVIPLTPEELKERLIDFGTKGKLTNL-ERMSPNIIAFNGAGGNLDSFF 481

Query: 415 NSTS 418
           N  S
Sbjct: 482 NDGS 485

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  194 bits (493), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 147/442 (33%), Positives = 225/442 (50%), Gaps = 88/442 (19%)

Query: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPRGGIKDL 60
           +V  +Y++ LKK    E++ +FL   + + +  I+D  K H               I++ 
Sbjct: 17  IVGEEYLIKLKKS---ESIQSFLKS-TKSQSLQIKDDIKNH---------------IRER 57

Query: 61  FNINDLFQGLIGYFPEPVVKLLEK----SDIVEFVERDSVVHASNFD----------TQN 106
           F     F+ L+   P  +++ L+K    S+I+  ++ ++  ++S +            Q 
Sbjct: 58  FTFG-AFRALVIDLPNDMIEKLKKNPTISEIIPNLKVNAFANSSTYSELLTYSDKIIIQR 116

Query: 107 NAPWGLARISHRDRL--NLGNFNKYLYDNA---------GGEGVTAYVIDTGINVKHVEF 155
            AP  L+R+S R +L  ++ N ++Y  DNA          G  V AY+IDTGI  +H EF
Sbjct: 117 EAPRHLSRLSRRGQLPYDINNIDRY--DNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 156 DGRAQWGKTIPLNDLDIDG----NGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGT 211
           +GR ++       DL  +G    NGHGTH AG + SK +G+               G G 
Sbjct: 175 EGRVKFAI-----DLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQ 229

Query: 212 MSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAA 271
           +S ++K +E+  + H KES + K      AN+S G  ++  +D A+  A +AGI   VAA
Sbjct: 230 LSTILKALEFTIR-HCKESVDKK----CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAA 284

Query: 272 GNENQDACNTSPASAEKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILS-TYIG 326
           GN N DAC  SPAS++  ITVGA    DDR    A FSNWG CVD+FAPG+ + S ++I 
Sbjct: 285 GNSNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHIN 341

Query: 327 DTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTK 386
            +  +   LSGTSMASP V+G+    L                G+ P  +K K+I  STK
Sbjct: 342 GS--DVLLLSGTSMASPSVSGIAAILLD--------------KGLNPKFVKSKIIESSTK 385

Query: 387 NVL---TDLPDPDSPNLLIYNG 405
           N+    T +  P++PNL+++NG
Sbjct: 386 NIFHQGTIMIKPNTPNLIVFNG 407

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  186 bits (472), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 125/322 (38%), Positives = 167/322 (51%), Gaps = 33/322 (10%)

Query: 99  ASNFDTQNNAPWGLARISHRDRLNL---------GNFNKYLYDNAGGEGVTAYVIDTGIN 149
           A N   Q +AP  LARIS   +L             FN Y  D   G+GV AY++DTGI+
Sbjct: 155 AQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIH 214

Query: 150 VKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGS 209
            +H EF+ R   G  +       D NGHGTH AG + S+ +G               DGS
Sbjct: 215 AEHPEFEDRVIQGVDLTKEGFG-DENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGS 273

Query: 210 GTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAV 269
           G  S+V+ G+E+  +   K S+   + K   AN+SLG  +SP ++MAV  A+  GI F  
Sbjct: 274 GEASNVLSGLEFIVEHCTKVSR--PQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVA 331

Query: 270 AAGNENQDACNTSPASAEKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILS-TYIGD 327
           AAGN N DA   SPASAE  ITVGA     D  A FSNWG CV+IFAPG+ I S +++ D
Sbjct: 332 AAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLND 391

Query: 328 TNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKN 387
              E+  LSGTSM++P V G+    LS               G+ P  + +++   ST+N
Sbjct: 392 N--ESLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPELIAQEIEYLSTRN 435

Query: 388 VL---TDLPDPDSPNLLIYNGA 406
           V    T    P +PN ++YNG 
Sbjct: 436 VFHRRTLFFKPSTPNQILYNGV 457

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  183 bits (464), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 125/320 (39%), Positives = 163/320 (50%), Gaps = 31/320 (9%)

Query: 100 SNFDTQNNAPWGLARISHRDRLNL---------GNFNKYLYDNAGGEGVTAYVIDTGINV 150
            N   Q++AP  LARIS   +L             FN Y  D+  G+ V AY++DTGI  
Sbjct: 120 QNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFA 179

Query: 151 KHVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSG 210
            H EF+ R   G  +       D NGHGTH AG + SK YG               DGSG
Sbjct: 180 DHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSG 238

Query: 211 TMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVA 270
             S+V+ G+E+  +   + S+   + K   AN+SLG  +SP ++MAV  A+  GI F  A
Sbjct: 239 EASNVLSGLEFIVEHCTRVSR--PQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 296

Query: 271 AGNENQDACNTSPASAEKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTN 329
           AGN N DA   SPASAE  ITVGA     D  A FSNWG CV+IFAPG+ I S    + N
Sbjct: 297 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFN 356

Query: 330 RETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVL 389
            +T  LSGTSM++P V G+    LS               G+ P  + ++L   ST+NV 
Sbjct: 357 -DTLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPEMIAQELEYLSTRNVF 401

Query: 390 ---TDLPDPDSPNLLIYNGA 406
              T    P +PN ++YNG 
Sbjct: 402 HRRTLFFKPSTPNQILYNGV 421

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  183 bits (464), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 128/324 (39%), Positives = 174/324 (53%), Gaps = 49/324 (15%)

Query: 104 TQNNAPWGLARISHRDRLNLGNFN---------KYLYD-NAGGEGVTAYVIDTGINVKHV 153
            Q  AP  LAR+S R +L   +F          KY YD  + G  V AY+ID+GI ++H 
Sbjct: 128 VQYGAPRHLARLSRRKQLPY-DFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLEHE 186

Query: 154 EFDGRAQWGKTIPLNDLDIDG----NGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGS 209
           EF+GRA     IP  DL  +G    NGHGTH AG + SK YG+               G 
Sbjct: 187 EFNGRA-----IPGIDLTGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQ 241

Query: 210 GTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAV 269
           G+++ V+ G+E+A + H +E+    +     AN+SLG  ++  L+ A+ AA+ AG+   V
Sbjct: 242 GSLAMVLGGIEFAVK-HCQETSKKGR---CVANLSLGSMRTAILNKAIKAAIDAGLVVVV 297

Query: 270 AAGNENQDACNTSPASAEKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYI 325
           AAGN N +AC  SPASA +AITVGA    DDR    A FSNWG+C+DIFAPG+ I S  I
Sbjct: 298 AAGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSI 354

Query: 326 GDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYST 385
              ++E  + SGTSMASP VAGL    L                GV+  ++K  ++   T
Sbjct: 355 F-KDKEDVTYSGTSMASPTVAGLAALTLD--------------QGVSAEEVKDYILEMGT 399

Query: 386 KNVL---TDLPDPDSPNLLIYNGA 406
            NV    + L  P +PN + +NG 
Sbjct: 400 DNVFHRRSLLFKPGTPNKICFNGV 423

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  182 bits (463), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 132/370 (35%), Positives = 188/370 (50%), Gaps = 45/370 (12%)

Query: 67  FQGLIGYFPEPVVKLLEKSDIVEFVERDSVV------------HASNFDTQNNAPWGLAR 114
           F+G    FP+  V+ L+K+ +V  V  +SV             ++  +  Q +AP  LAR
Sbjct: 61  FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLAR 120

Query: 115 ISHRDRLNLGN-------FNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPL 167
           +S R  L           FN Y      G+ V AY+IDTGI  +H +  GRA +G  + +
Sbjct: 121 LSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM-V 179

Query: 168 NDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHL 227
            +   D NGHGTH AG + S+ +G+             + G G ++ VI  +E++   H 
Sbjct: 180 GEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSVN-HC 238

Query: 228 KESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAE 287
           K+S          AN+SLG  ++  L+ AV AAV +G+   VAAGN N +AC  SPASA 
Sbjct: 239 KKSG-----MLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAI 293

Query: 288 KAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVA 346
            AITVGA    +D  A FSNWG CVD+FA G+ ++S       +  A  SGTSMASP VA
Sbjct: 294 SAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVA-YSGTSMASPSVA 352

Query: 347 GLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVL---TDLPDPDSPNLLIY 403
           GL    L    DS          G+ P  +K+K+I  +T+NV    T +  P +PN + +
Sbjct: 353 GLAAVLL----DS----------GIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAF 398

Query: 404 NGAGGDLGVF 413
           NG   +  +F
Sbjct: 399 NGVRKEDDIF 408

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  181 bits (460), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 148/422 (35%), Positives = 204/422 (48%), Gaps = 60/422 (14%)

Query: 20  ATFLNDVSAAHAAAIRDLPKEHDFFN-FVNAEGLPRGGIKDLFNIN-------DLFQGLI 71
           A+FL   S A    IR   K  D F  F+N +      IK  F+           F+ L 
Sbjct: 10  ASFLTQSSFAEEYLIRF--KTPDAFKLFMNFKSARLQSIKSFFDCKVRRTFSFGSFRALS 67

Query: 72  GYFPEPVVKLLEKSDIV-------EFVERDSV-VHASNFDT-----QNNAPWGLARISHR 118
              P  +V  + +S +V       +FV  D       NF++     Q  AP  L+R+S R
Sbjct: 68  IDVPRDLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRR 127

Query: 119 DRLNL----------GNFNKYLYDNA-GGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPL 167
            +L            G+FN Y YDN   G+G+ AY+IDTGI  +H EF GRA +G+ +  
Sbjct: 128 SQLPYDFEEEDDNYEGSFN-YYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDLT- 185

Query: 168 NDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHL 227
            +   DGNGHGTH AG + S  YG+             + G G ++ VI  +E+A   H 
Sbjct: 186 GEGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVN-HC 244

Query: 228 KESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAE 287
           + S+     KG   N+SLG  ++  ++ AV AA  AGI   VAAGN N +AC  SPASA 
Sbjct: 245 RSSEG----KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAP 300

Query: 288 KAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVA 346
           +AITVGA    +D  A FSNWG CVDIFAPG+ + S      + +    SGTSMASP + 
Sbjct: 301 EAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSL-ASAPHLKPILFSGTSMASPSIT 359

Query: 347 GLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVL---TDLPDPDSPNLLIY 403
           GL    L                GV   ++K  ++  +T +V    T +  P +PN + +
Sbjct: 360 GLAAILLD--------------EGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAF 405

Query: 404 NG 405
           NG
Sbjct: 406 NG 407

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  181 bits (459), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 170/317 (53%), Gaps = 41/317 (12%)

Query: 105 QNNAPWGLARISHRDRL-----NLG----NFNKYLYDNAGGEGVTAYVIDTGINVKHVEF 155
           Q  AP  LARIS R  L     N+     NF+ Y  D   G  V AYVIDTGI  +H + 
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 156 DGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDV 215
           +GRA++G  + + +   D NGHGTH AG I S+ +G+             + G G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 216 IKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNEN 275
           I  +E+    H ++S+     +G  AN+SLG  ++  L+ AV AA+ AG+   VAAGN N
Sbjct: 254 ISAIEFTVN-HCRKSR-----RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSN 307

Query: 276 QDACNTSPASAEKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIGDTNRE 331
            +AC +SPAS+  AITVGA    DDR    A FSNWG CVDIFAPG+ I S       + 
Sbjct: 308 ANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKP 364

Query: 332 TASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVL-- 389
            A  SGTSMASP V+G++   L    DS          G+ P  +K +LI  +T +V   
Sbjct: 365 VA-FSGTSMASPIVSGMVANLL----DS----------GIHPFDIKTELIDLATDSVFHK 409

Query: 390 -TDLPDPDSPNLLIYNG 405
            T L  P +PN + + G
Sbjct: 410 RTLLFKPGTPNRVAFTG 426

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  181 bits (458), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/326 (38%), Positives = 167/326 (51%), Gaps = 31/326 (9%)

Query: 94  DSVVHASNFDTQNNAPWGLARISHRDRL--NLGN-------FNKYLYDNAGGEGVTAYVI 144
           + V    N   Q +AP  LARIS   +L  ++G+       FN Y   +  G+ V AY++
Sbjct: 114 EDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIM 173

Query: 145 DTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXX 204
           DTGI   H EF+ R   G  +       D NGHGTH AG + SK YG             
Sbjct: 174 DTGIFADHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVL 232

Query: 205 XSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAG 264
             DGSG  S+V+ G+E+  +   K S+   + K   AN+SLG  +SP ++MAV  A+  G
Sbjct: 233 GKDGSGEASNVLSGLEFIVEHCTKVSR--PQGKKCVANLSLGSFRSPIINMAVEGAIEEG 290

Query: 265 IHFAVAAGNENQDACNTSPASAEKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILST 323
           I F  AAGN N DA   SPASAE  ITVGA     D  A FSNWG CV+IFAPG+ I S 
Sbjct: 291 IVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESL 350

Query: 324 YIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAY 383
              + N +T  LSGTSM++P V G+    LS               G+ P  + +++   
Sbjct: 351 SHLNYN-DTLILSGTSMSTPIVTGVAAILLS--------------KGIEPEMIAQEIEYL 395

Query: 384 STKNVL---TDLPDPDSPNLLIYNGA 406
           ST+NV    T    P +PN ++YNG 
Sbjct: 396 STRNVFHRRTLFFKPSTPNQILYNGV 421

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  179 bits (453), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 172/353 (48%), Gaps = 45/353 (12%)

Query: 77  PVVKLLEKSDIVEFVERDSVVHASNFD-----------TQNNAPWGLARISHR------- 118
           P ++     D++   E     H  N D            Q  AP  LAR+S R       
Sbjct: 87  PNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNPFKVKVQGEAPRHLARLSRRAPLPYEF 146

Query: 119 -DRLNLG-NFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNG 176
            D L    +FN Y Y    G  + AY+IDTGI  +H +F GRA +G+     +   D NG
Sbjct: 147 DDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKDFCGRAIFGRDF-TGEGPGDRNG 205

Query: 177 HGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKKF 236
           HGTH AG + S ++G+             + G G ++ VI  VE+A   H K S      
Sbjct: 206 HGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTTVISAVEFAVN-HCKSSGK---- 260

Query: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGA-S 295
           KG  AN+SLG  ++  ++ A+ AA  AG+   VAAGN N +AC  SPASA +AITVGA  
Sbjct: 261 KGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNSNINACWNSPASAPEAITVGAFD 320

Query: 296 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSL 355
             +D  A FSNWG CVDIFA G+ + S      ++  A  SGTSMASP V GL+   L  
Sbjct: 321 DRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIA-FSGTSMASPSVTGLVAILLD- 378

Query: 356 QPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVL---TDLPDPDSPNLLIYNG 405
                         GV P  +K KL+  +T ++L   T    P +PN + +NG
Sbjct: 379 -------------KGVEPENIKAKLVELATHDLLQRRTLFFKPGTPNRIAFNG 418

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  179 bits (454), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 126/327 (38%), Positives = 166/327 (50%), Gaps = 33/327 (10%)

Query: 94  DSVVHASNFDTQNNAPWGLARISHRDRLNL---------GNFNKYLYDNAGGEGVTAYVI 144
           + +  A N   Q++AP  LARIS   +L             FN Y  D+  G+ V AY++
Sbjct: 163 EDIDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIM 222

Query: 145 DTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXX 204
           DTGI   H EF+ R   G  +       D NGHGTH AG + SK YG             
Sbjct: 223 DTGIFSDHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVL 281

Query: 205 XSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAG 264
             DGSG  S+V+ G+E+  +   + S+   + K   AN+SLG  +SP ++MAV  A+  G
Sbjct: 282 GKDGSGEASNVLSGLEFIVEHCTRVSR--PQGKKCVANLSLGSFRSPIINMAVEGAIEEG 339

Query: 265 IHFAVAAGNENQDACNTSPASAEKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILST 323
           I F  AAGN N DA   SPASAE  ITVGA     D  A FSNWG CV+IFAPG+ I S 
Sbjct: 340 IVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIES- 398

Query: 324 YIGDTNRE-TASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIA 382
            +   N E T  LSGTSM++P V G+    LS               G+ PA + +++  
Sbjct: 399 -LSHLNYEDTLILSGTSMSTPIVTGVAAVLLS--------------KGIEPALIAQEIEY 443

Query: 383 YSTKNVL---TDLPDPDSPNLLIYNGA 406
            ST+NV    T    P + N ++YNG 
Sbjct: 444 LSTRNVFHRRTLFFKPSTANQILYNGV 470

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  182 bits (462), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 128/326 (39%), Positives = 168/326 (51%), Gaps = 47/326 (14%)

Query: 100 SNFDTQNNAPWGLARISHRDRL--NLGN-------FNKYLYDNAGGEGVTAYVIDTGINV 150
           S F  Q  AP  LARIS RD+L  N  N        N Y  DN  GEGV AYVIDTGI  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 151 KHVEFDGRAQWGKTIPLNDLDIDG----NGHGTHCAGTIASKHYGIXXXXXXXXXXXXXS 206
           +H +F+ R ++G      DL  +G    NGHGTH AG I SK YG+              
Sbjct: 342 EHKDFEDRVEFG-----TDLTGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSL 396

Query: 207 DGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIH 266
            GS  +S +I+ +EY        S+ +KK      NMSLG      ++ AV +A++ G+ 
Sbjct: 397 TGSTQLSHIIEAIEYTVNDC--NSRVDKK--ACVVNMSLGSFYVKVINEAVESAIAEGVV 452

Query: 267 FAVAAGNENQDACNTSPASAEKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILS 322
           F VAAGN N DAC +SP S++ AITVGA    DDR    A FSNWG+CVDIFA G+ + S
Sbjct: 453 FVVAAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKS 509

Query: 323 TYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIA 382
                   +    SGTSMASP V G ++  LS               GV P  ++++++ 
Sbjct: 510 LS-SQVPYKYIKYSGTSMASPIVCGFVSILLS--------------QGVKPNDVQEEMVK 554

Query: 383 YSTKNVLTD---LPDPDSPNLLIYNG 405
            STK   T    +  P + N +++NG
Sbjct: 555 LSTKGDFTRRSLIFKPFTSNRILFNG 580

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  175 bits (444), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 169/320 (52%), Gaps = 37/320 (11%)

Query: 103 DTQNNAPWGLARISHRDRL-----NLGNFNKYLY----DNAGGEGVTAYVIDTGINVKHV 153
           + Q  AP  L RIS R +L     N   F ++++    D   G  + AY++DTGI  +H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 154 EFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMS 213
           +F+ R   G  +   +   D NGHGTH AG + SK +G+               GSG ++
Sbjct: 212 DFENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 214 DVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGN 273
            V+ G+++A   H +  +  +  K   ANMSLG  ++  ++ A++ A  AG+   VAAGN
Sbjct: 271 TVLSGIQFAVD-HCRLMRETQG-KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGN 328

Query: 274 ENQDACNTSPASAEKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILS-TYIGDT 328
            N  AC TSPASA+ AITVGA    DDR    AYFSNWG CVDIFAPG+ I S +   ++
Sbjct: 329 SNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPES 385

Query: 329 NRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNV 388
           + +  + SGTSMASP VAGL    L                GV P  +K KL+  STK+V
Sbjct: 386 HHKHVTHSGTSMASPVVAGLAAILLD--------------KGVEPFDVKDKLLHLSTKDV 431

Query: 389 ---LTDLPDPDSPNLLIYNG 405
              LT      +PN + YNG
Sbjct: 432 FNKLTLFFKYGTPNKIAYNG 451

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  172 bits (437), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 177/351 (50%), Gaps = 49/351 (13%)

Query: 77  PVVKLLEKSDIVEFVERDSVVHAS---NFDTQNNAPWGLARISHRDRLNLGNFNK----- 128
           P VK +  + +V+  E D+V   S       Q  AP  LARIS R +L     NK     
Sbjct: 80  PFVKEVVPNIMVKAFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRD 139

Query: 129 ---YLYDN-AGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGT 184
              Y YD  A G    AY++DTG+   H EF+ R ++G T    + + D NGHGTH AG 
Sbjct: 140 SFNYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFG-TDCTGEGEGDLNGHGTHVAGL 198

Query: 185 IASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMS 244
           + SK +G+             + G+GT+  ++  +E+A Q   +E ++++       NMS
Sbjct: 199 VGSKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAVQ-DCQEHEDSQ----CVLNMS 253

Query: 245 LGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDR--- 301
           LG  KS  L+ A+N     GI   VAAGN N +AC TSP+SA  AITVGA    DDR   
Sbjct: 254 LGSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGA---FDDRFDT 310

Query: 302 -AYFSNWGKCVDIFAPGLNILSTYIGDTNRETASL---SGTSMASPHVAGLLTYFLSLQP 357
            A FSNWG CVDIFAPG+N+ S      NR+  S    SGTSMASP V G++   L    
Sbjct: 311 IAKFSNWGPCVDIFAPGVNVASL----VNRDWPSFVKYSGTSMASPIVCGMVALLLD--- 363

Query: 358 DSDSEFYDASKHGVTPAQLKKKLIAYSTKNVL---TDLPDPDSPNLLIYNG 405
                       GV P  ++  L   +T  V    T +  P +PN ++YNG
Sbjct: 364 -----------DGVPPEDIRDYLQELATDGVFKKRTLVFKPGTPNSVLYNG 403

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  173 bits (439), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 121/341 (35%), Positives = 164/341 (48%), Gaps = 53/341 (15%)

Query: 104 TQNNAPWGLARISHRDRLNL---------GNFNKYLYDNAGGEGVTAYVIDTGINVKHVE 154
           TQ+ AP  LAR+S R +L            +FN Y Y    G  V AYV+D+G+ + H +
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 155 FDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSD 214
           F+GRA +G     +    D NGHGTH AG I SK YG+             S GSGT+  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 215 VIKGVEYAAQ-------------------AHLKESKNNKKFKGSTANMSLGGGKSPALDM 255
           V+ G+E+ +                           ++ + K    N+SLG  +S  ++ 
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 256 AVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDR----AYFSNWGKCV 311
           A+   +  GI   VAAGN N +AC TSPAS    ITVGA    DDR    A FSNWG CV
Sbjct: 339 AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 312 DIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGV 371
           DIFAPG+ ++ +            +GTSMA+P V GL+   L    DS          G+
Sbjct: 396 DIFAPGV-LVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL----DS----------GI 440

Query: 372 TPAQLKKKLIAYSTKNVL---TDLPDPDSPNLLIYNGAGGD 409
            P Q+KK+L   +T N+    T L  P +PN + +NG   D
Sbjct: 441 KPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRD 481

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 158/302 (52%), Gaps = 38/302 (12%)

Query: 101 NFDTQNNAPWGLARISHRDRLNLG-------NFNKYLYDNAGGEGVTAYVIDTGINVKHV 153
            +  Q +AP  LAR   R  L           FN Y  +   GEGV  YV+D+GI   H 
Sbjct: 424 QYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHP 483

Query: 154 EFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMS 213
           EFDGRA +G      +   D NGHGTH AG + S+ +GI              DG G+ S
Sbjct: 484 EFDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTS 542

Query: 214 DVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGG---GKSPALDMAVNAAVSAGIHFAVA 270
           ++I GVE+A + H ++S      K   ANMSLGG   G S ALD AV AA+  G+ F VA
Sbjct: 543 NIIAGVEFAVK-HCQQSG-----KRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVA 595

Query: 271 AGNENQDACNTSPASAEKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNI--LSTYIGD 327
           AGN  + AC  SPA  + AITVGA    SD  A FSN+GKCVDIFAPG+ +  LS    +
Sbjct: 596 AGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSN 655

Query: 328 TNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKN 387
           T R    L+GTSM++P  AG++   L                G+ P ++K  L++ STK 
Sbjct: 656 TMR---VLNGTSMSAPITAGVVAVLLD--------------QGIEPHEVKDHLLSISTKG 698

Query: 388 VL 389
           + 
Sbjct: 699 LF 700

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  169 bits (428), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 174/326 (53%), Gaps = 35/326 (10%)

Query: 101 NFDTQNNAPWGLARISHRDRL---------NLGNFNKYLYDNAGGEGVTAYVIDTGINVK 151
           +F  Q NAP  LARIS R  L            NF+ Y  D+  G  V AYVIDTGI  +
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 152 HVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGT 211
           H +F GRA++G  + + +   D NGHGTH AG I S+ YG+             + G G 
Sbjct: 189 HRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 212 MSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAA 271
           ++ VI  +E+    H ++SK     +G  AN+SLG  ++  L+ AV AA+ AG+   VAA
Sbjct: 248 LTSVISAIEFTVN-HCRKSK-----RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAA 301

Query: 272 GNENQDACNTSPASAEKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNR 330
           GN N +AC +SPAS+  AI+VGA    +D  A FSNWG CVD+FAPG+ I S        
Sbjct: 302 GNSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLS-NIPPF 360

Query: 331 ETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLT 390
           ++ + SGTSMASP V G++   L    DS          G+ P  +K++LI  +T +V  
Sbjct: 361 KSVAYSGTSMASPLVTGMVAVLL----DS----------GIHPFDIKEELINTATDSVFH 406

Query: 391 D---LPDPDSPNLLIYNGAGGDLGVF 413
               L  P +PN + + G   +  +F
Sbjct: 407 KRALLFKPGTPNRVAFTGVEKEDDIF 432

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  168 bits (426), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 150/450 (33%), Positives = 212/450 (47%), Gaps = 98/450 (21%)

Query: 4   HKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPRGGIKDLFNI 63
           H+Y+V LK   + +++ +F+ D + AH   ++D                  G I   F+ 
Sbjct: 22  HEYLVSLK---NSDSIQSFM-DSTYAHGQLMKDYL---------------HGKISKTFSF 62

Query: 64  NDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFD-------------------- 103
              F+GL     + VV  ++++ +V  V  +  +HA ++D                    
Sbjct: 63  GS-FRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDK 121

Query: 104 ------TQNNAPWGLARISHRDRLNLGNFNKYLYDNA---------GGEGVTAYVIDTGI 148
                  QN AP  LAR+S R  L     +K  Y+++          G  V AY+ID+GI
Sbjct: 122 NSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGI 181

Query: 149 NVKHVEFDGRAQWGKTIPLNDLDIDG------NGHGTHCAGTIASKHYGIXXXXXXXXXX 202
           ++   EF+GRA  G       LD+ G      NGHGTH AG + SK YG+          
Sbjct: 182 DINQEEFEGRATHG-------LDLTGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVK 234

Query: 203 XXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVS 262
                GSG++  VI  +E+    H  +SK+ K      AN+SLG    P L+ A+ A V 
Sbjct: 235 ALDRQGSGSLITVISALEFVVN-HCGKSKSKK----CVANLSLGAFMMPLLNEAIKATVD 289

Query: 263 AGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDR----AYFSNWGKCVDIFAPGL 318
           +G+   VAAGN N DAC  SPAS + AITVGA    DDR    A FSNWG CVDIFAPG+
Sbjct: 290 SGVVVVVAAGNGNIDACWCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDIFAPGV 346

Query: 319 NILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKK 378
            I S  I D N+++   SGTSMASP VAG+++  L                GV    ++ 
Sbjct: 347 AISSLSIKD-NQKSVEFSGTSMASPQVAGIVSILLD--------------QGVENEDIRD 391

Query: 379 KLIAYSTKNVL---TDLPDPDSPNLLIYNG 405
            L   +T +V    T L  P +PN + +NG
Sbjct: 392 YLFELATDDVFQKRTLLFKPRTPNRITFNG 421

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  167 bits (424), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 125/349 (35%), Positives = 175/349 (50%), Gaps = 48/349 (13%)

Query: 75  PEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDRL-----NLGN---- 125
           P  + K  E  ++     ++ V H      Q+ AP  LARIS RD+L     N+ +    
Sbjct: 93  PNILFKAFENDELNNEQTQEYVSHV----VQSEAPRHLARISRRDKLPYDFTNVSSYKKS 148

Query: 126 FNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTI 185
           FN Y      G  V AY++D+G++    +F+GR ++G      D + D NGHGTH AG +
Sbjct: 149 FNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFT-GDGEGDSNGHGTHVAGLV 207

Query: 186 ASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSL 245
            SK YG+               G GT+  V+  +E+A     +  +     K   AN+SL
Sbjct: 208 GSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPE-----KRCVANLSL 262

Query: 246 GGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDR---- 301
           G  K+  ++ A+ AA   G+   VAAGN N +AC TSPASAE+AITVGA    DDR    
Sbjct: 263 GSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITVGA---FDDRIDTI 319

Query: 302 AYFSNWGKCVDIFAPGLNI--LSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDS 359
           A FSNWG CVDI+APG+ +  L+ +    N    S SGTSMASP V G +   L      
Sbjct: 320 AKFSNWGPCVDIYAPGVAVESLANFPMVKN---ISYSGTSMASPIVCGQVAILLD----- 371

Query: 360 DSEFYDASKHGVTPAQLKKKLIAYSTKNVL---TDLPDPDSPNLLIYNG 405
                     G+    +K  LI  +T +V    T L  P++PN +++NG
Sbjct: 372 ---------KGIPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  167 bits (422), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 137/369 (37%), Positives = 180/369 (48%), Gaps = 52/369 (14%)

Query: 105 QNNAPWGLARISHRDRLNLGN-------FNKYLYDNAGGEGVTAYVIDTGINVKHVEFDG 157
           Q+ AP  LAR   R  L           FN Y      GE V  Y++D+GI+  H EF+G
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 158 RAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIK 217
           RA +G     N+   D NGHGTH AG + SK YG               DG G+ S++I 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 218 GVEYAAQAHLKESKNNKKFKGSTANMSLGG---GKSPALDMAVNAAVSAGIHFAVAAGNE 274
           GVE+A + H ++S      K   ANMSLGG   G S ALD AV AA+  G+ F VAAGN 
Sbjct: 389 GVEFAVK-HCQQSG-----KKCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGNS 441

Query: 275 NQDACNTSPASAEKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETA 333
            + AC  SPA  + AITVGA    SD  A FSN+GKCVDIFAPG+ + S      N    
Sbjct: 442 KERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNT-VR 500

Query: 334 SLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVL--TD 391
            L+GTSM++P  AG++   L                GV    +K++LI  STK V     
Sbjct: 501 VLNGTSMSAPITAGVVAVLLD--------------QGVKHEDVKERLIDLSTKGVFHRRR 546

Query: 392 LPDPDSPNLLIYNGAGGDLGVFWNSTSADEQSAEHPEQRIAAELGLDSLAKMVGD--RHA 449
           L    +P+  ++NG   +  VF         + E+P +        D+  K +GD  +  
Sbjct: 547 LVSSRTPDRTLFNGVPQEDDVF--------NAIEYPFED------EDTYIKFIGDDFKKV 592

Query: 450 ATDSLFGQV 458
              SLF +V
Sbjct: 593 QGPSLFRKV 601

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  165 bits (417), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 170/343 (49%), Gaps = 39/343 (11%)

Query: 103 DTQNNAPWGLARISHRDRL--------NLGNFNKYLYDNA-GGEGVTAYVIDTGINVKHV 153
           D Q  AP  L ++S R +L            F  Y YD    G     Y+IDTG+  +H 
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 154 EFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMS 213
           EF  R  +G    + +   D NGHGTH AG I SK +G+               G G ++
Sbjct: 208 EFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 214 DVIKGVEYAAQ-AHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAG 272
            V++G+E+A     LK+    K       NMSLG  ++P ++ A+  A  +GI   VAAG
Sbjct: 267 SVLEGIEFAVNNCKLKQQPMGK---NCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 273 NENQDACNTSPASAEKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNR- 330
           N N  AC TSPAS+  AITVGA    +D  A FSNWG+CVDIFAPG+ I S     +NR 
Sbjct: 324 NNNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSL----SNRM 379

Query: 331 -ETASL-SGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNV 388
            E   + SGTSMASP VAGL+   +              + G    ++K+KLI  S+K++
Sbjct: 380 LENGVIHSGTSMASPIVAGLVAILM--------------EKGYKCDEIKQKLIDDSSKSI 425

Query: 389 LTDLP---DPDSPNLLIYNGAGGDLGVFWNSTSADEQSAEHPE 428
            + L       +PN +IYNG    + V   +    E++ E  E
Sbjct: 426 FSKLTLFFKYGTPNRVIYNGIEEVINVNKENIRQREETDESKE 468

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  157 bits (398), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 163/328 (49%), Gaps = 53/328 (16%)

Query: 99  ASNFDTQNNAPWGLARISHRDRLNL-------GNFNKYLYDNAGGEGVTAYVIDTGINVK 151
           + +F +Q+ AP  LARIS R +L +            + ++   GEGV  YV+D+G+N  
Sbjct: 148 SDDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHD 207

Query: 152 HVEFDGRAQWGKTIPLNDLDIDGNG------HGTHCAGTIASKHYGIXXXXXXXXXXXXX 205
           H +F+GRA  G       +D  G G      HGTH AG I SK YG+             
Sbjct: 208 HPDFEGRAMKG-------IDTTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLD 260

Query: 206 SDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGG-GKSPALDMAVNAAVSAG 264
           S G GT++++I+G+EY     + + +          NMSLG  G    LD AV+A +  G
Sbjct: 261 SMGKGTVTNIIEGLEYVVNQCIGKKRK------CVINMSLGAPGTHSILDKAVSAVIEEG 314

Query: 265 IHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNI 320
           +   VA GN   +AC  SPA   KAITV A    DDR    A FSNWG C+DI+APG+N+
Sbjct: 315 VVVVVAGGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNV 371

Query: 321 LSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKL 380
            S  + +  R T  LSGTSMASP VAG    +L                G  PA+++K L
Sbjct: 372 KS--LSNKGRGTFVLSGTSMASPIVAGAAAIYLD--------------QGADPAEVRKIL 415

Query: 381 IAYSTKNVLTDLP---DPDSPNLLIYNG 405
              +T+ V         P +PN ++Y G
Sbjct: 416 SKTATRGVFKKRAIAVRPRTPNKVLYTG 443

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  138 bits (347), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 159/300 (53%), Gaps = 14/300 (4%)

Query: 61  FNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDR 120
            ++ + F+ + G FP+ +++ L     +  +  D ++  + +  Q +AP  LAR+S +  
Sbjct: 49  ISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKST 108

Query: 121 LNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDI-DGNGHGT 179
           L  G+   Y+Y + GG GV  Y++DTGI+  H E +GR Q    +  N +   D +GHGT
Sbjct: 109 LR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGT 167

Query: 180 HCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQ-AHLKESKNNKKFKG 238
             AG I S  +G              S G+ T+  VI+ +E+A++ A + +       + 
Sbjct: 168 AVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASKLASVTQ-------RP 220

Query: 239 STANMSLGGGKSPALDMAVNAAVS-AGIHFAVAAGNENQDACNTSPASAEKAITVGA--S 295
           S   +     K+  L+ A+ A +    +   VA GN NQ+AC++SPASA  A+T+G+   
Sbjct: 221 SVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDV 280

Query: 296 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSL 355
           T  D  A F+N+G C+D FA G+NI S   GD    T   SGTS+++   +G++ Y++SL
Sbjct: 281 TKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNT-QYSGTSISAGIASGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  130 bits (326), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 93/308 (30%), Positives = 160/308 (51%), Gaps = 15/308 (4%)

Query: 55  GGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLAR 114
           GG      + + F+ + G FP+ +++   +S  +  +  D  +  + +  Q +AP  LAR
Sbjct: 43  GGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLAR 102

Query: 115 ISHRDRLNLGNFN---KYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLD 171
           +S +  L  GN +    Y+Y +  G GV  Y++DTGI+  H  F+GR Q       + + 
Sbjct: 103 LSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVA 162

Query: 172 I-DGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKES 230
             D +GHGT  AG I S  +G+             S G  ++  V++ +E+A+    K +
Sbjct: 163 TGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHAS----KLA 218

Query: 231 KNNKKFKGSTANMSLGGGKSPALDMAVNAAVS-AGIHFAVAAGNENQDACNTSPASAEKA 289
              K+   S   + L   ++  L+ AV A V    I   VAAGNEN+ AC+ SPA A  A
Sbjct: 219 AVTKR--PSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGA 276

Query: 290 ITVGASTLS--DDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAG 347
           +T+G+  ++  D  A F+N+ +CVD+F  G+++ +  +G  +     LSGTS+++   +G
Sbjct: 277 LTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGVASG 334

Query: 348 LLTYFLSL 355
           L+ Y++S+
Sbjct: 335 LVAYYMSI 342

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  127 bits (320), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 100/329 (30%), Positives = 155/329 (47%), Gaps = 30/329 (9%)

Query: 102 FDTQNNAPWGLARISHRDRLNLGN---FNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGR 158
           + TQ NAP  L+R S   +L   +   +N Y   +  G  VT YV+D+GI + H EF+GR
Sbjct: 142 YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 159 AQWGKTIPLNDLDI-DGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIK 217
               +     D  + D  GHGT  AG I SK YG+             + G G +  +++
Sbjct: 202 IL--EAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 218 GVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQD 277
           G+++  + H +E+ N         N SLG      L+ A     +AGI    AAGN   +
Sbjct: 260 GLQFITK-HCEENTNG----NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVN 314

Query: 278 ACNTSPASAEKAITVGASTLSDDR-AYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLS 336
           AC  +PA ++   TVG+    DD  A FSNWG+CVD+ APG+ +  T +    + +   S
Sbjct: 315 ACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYV-RTLLYTNQKGSRESS 373

Query: 337 GTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPD-- 394
           GTS+++P V GL    LS               GV    L  ++    ++++L +     
Sbjct: 374 GTSVSTPIVTGLAAILLS--------------KGVPKENLYDEIRKMGSRDLLRNKEFSR 419

Query: 395 -PDSPNLLIYNGAGGDLGVFWNSTSADEQ 422
            P +PNL++  G   +  V+ +    DE+
Sbjct: 420 LPGTPNLIVNIGPQKEDDVYPDDAYIDEE 448

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  118 bits (296), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 91/304 (29%), Positives = 151/304 (49%), Gaps = 24/304 (7%)

Query: 67  FQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH---RDRLNL 123
           F G  G F + V+  L     V  +  D +++   +  QN+AP  LAR+S+     R++ 
Sbjct: 61  FHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSA 120

Query: 124 GNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDI---DGNGHGTH 180
            N N +++ +  G GV  Y++D+GI+ +H  F  R    K I L D  I   D +GHGT 
Sbjct: 121 KNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHGHGTA 179

Query: 181 CAGTIASKHYGIXXXXXXXXXXXXXSDGSGT-MSDVIKGVEYAAQAHLKESKNNKKFKGS 239
            AG + S  +G+             ++ +G  +S ++K +E+       E+ +    + S
Sbjct: 180 IAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFI------ENHSRATMRPS 233

Query: 240 TANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSD 299
            A +     K+  L+ A+  ++   I   V AGN++  ACN SPASA  + ++ +    D
Sbjct: 234 VAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVGSLD 292

Query: 300 DR-----AYFSNWGKCVDIFAPGLNILSTYIGDTNRE---TASLSGTSMASPHVAGLLTY 351
            R     A FSN+G+CVD+F  G+  + T    TN +    + +SGTSM+    AG + Y
Sbjct: 293 YRSSIEIASFSNYGECVDVFTSGVQ-MDTLHATTNSDENYISKVSGTSMSCAIAAGTVGY 351

Query: 352 FLSL 355
           ++SL
Sbjct: 352 YMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  109 bits (273), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 146/316 (46%), Gaps = 30/316 (9%)

Query: 57  IKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARIS 116
           I D+F +   F+   G F  P+++ L     V  + RD  +       QNNAP  L  +S
Sbjct: 45  ITDIFELGS-FRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS 103

Query: 117 HRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLD----- 171
               L+      ++Y + GG GV  Y++DTGI++KH            + + DL      
Sbjct: 104 SISPLS---HQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKL----NILRMADLTQSPVP 156

Query: 172 --IDGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKE 229
              D  GHGT  AG IAS+ +G+             S+G   +S +++ +    Q H++ 
Sbjct: 157 QGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTL-TQRHIEG 215

Query: 230 SKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASA--- 286
           +   K+       + +  G +P L  A+ A+    +   + AGN  QDA N SPA+    
Sbjct: 216 T---KRPSVVVIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPK 271

Query: 287 -EKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGD------TNRETASLSGTS 339
            +  I VG+  ++++   F+N+G  VD+F  G  I +    D      +N  T  +SGTS
Sbjct: 272 PKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTS 331

Query: 340 MASPHVAGLLTYFLSL 355
            +S   AG++ Y++SL
Sbjct: 332 ASSAITAGVIGYYMSL 347

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 144/305 (47%), Gaps = 25/305 (8%)

Query: 59  DLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHR 118
           ++  + D F+ L G F    ++ L   + V  + RD  +    +  Q  +P  L+++S  
Sbjct: 45  EMITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS-- 102

Query: 119 DRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKH-----VEFDGRAQWGKT-IPLNDLDI 172
              + G+F    +D   G  V  YV DTGI+ KH     V     A +  + +P      
Sbjct: 103 ---SGGSFT---FDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRG---A 153

Query: 173 DGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKN 232
           D +GHGT  AG IAS+ +G+              DG   +S ++KG+  A+ AH + +K 
Sbjct: 154 DPHGHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKR 212

Query: 233 NKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITV 292
              F      M++G  K+  LD  + A +   I   + AGN+  DAC+ SP +    + +
Sbjct: 213 PSVF---VLPMTIGK-KNHILDNFLQA-IPKDIAIVLPAGNQQTDACDLSPPNDHNILVI 267

Query: 293 GASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRET--ASLSGTSMASPHVAGLLT 350
           G+    +  A FSN+G CVD++  G +IL+    D+  E    S +GTS +    AG++ 
Sbjct: 268 GSLDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVG 327

Query: 351 YFLSL 355
           Y +S+
Sbjct: 328 YHMSM 332

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 129/268 (48%), Gaps = 27/268 (10%)

Query: 105 QNNAPWGLARISHRDRLNLGNF----NKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQ 160
           Q +AP  L R++ +D +    +    N+Y++ +  G GV  Y++DTGI+++H  +  +  
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIY-LQNN 154

Query: 161 WGKTIPLNDLDI---DGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGS-GTMSDVI 216
             K I L    I   D NGHGT  AG I S  +G+             ++    TMS V+
Sbjct: 155 IHKLIDLTTSPIPSGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVL 214

Query: 217 KGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQ 276
             +       L E    K  + S   +     K+  L+ A+   +S  I   + AGN++Q
Sbjct: 215 SALS------LIEKHEQKTMRPSIIVLPFQTEKNTILESAIE-NISKKIPVIIPAGNKHQ 267

Query: 277 DACNTSPASAEK---AITVGASTLSDDRAY-----FSNWGKCVDIFAPGLNI--LSTYIG 326
           +AC  SP   +K    + VG+   S+++ Y     FSN+G CVDI+  G++I  L T   
Sbjct: 268 NACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSN 327

Query: 327 DTNRETASLSGTSMASPHVAGLLTYFLS 354
                  +++GTS +   VAG++ Y++S
Sbjct: 328 GGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 82/313 (26%), Positives = 138/313 (44%), Gaps = 32/313 (10%)

Query: 59  DLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHR 118
           +L+++   FQ       +  ++ L     +  +  D  +       Q +AP  L ++   
Sbjct: 51  ELYSVGKNFQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLET 110

Query: 119 DRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEF------DGRAQWGKTIPLNDLDI 172
           +  +    N+++YD+  G GV  Y+ DTGI             D     G   P+ D +I
Sbjct: 111 EAGD----NEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDMPGMPGP--PIRDQEI 164

Query: 173 DGNGHGTHCAGTIASKHYGIXXXXXXXXXXXXXSDGSGTMSDVIKGVEYAAQAHLKESKN 232
               HGT  +G I S  +G+              +G   MS V+KG+    Q H+K +  
Sbjct: 165 LE--HGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLNLVQQ-HVKHTN- 220

Query: 233 NKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEK---A 289
               + S  N S    K+  L+ A +      +  AVAAGN  Q  C+ SP   ++    
Sbjct: 221 ----RPSVINFSYCTLKNAILNSAFDN-FPRDVPIAVAAGNYKQPGCSFSPVGCQRNKSL 275

Query: 290 ITVGASTLSDD---RAYFSNWGKCVDIFAPGLNILSTYIGDTNRETAS-----LSGTSMA 341
           +  G+  ++DD    + FSN+G CV  +APG  +L+  I DT+R  +      +SGTS +
Sbjct: 276 LAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRPNSRDTVIIISGTSGS 335

Query: 342 SPHVAGLLTYFLS 354
           S   AG++ Y+++
Sbjct: 336 SALGAGVIGYYMA 348

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 125 NFNKYLYDNAGGEGVTAYVIDTGI-----NVK-HVEFDGRAQWGKTIPLNDLDIDGNGHG 178
           N  +  Y+N  G G+ A ++D G+     N+K +   +G   +    PL    +  + HG
Sbjct: 180 NVKQLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHG 239

Query: 179 THCAGTI-ASKHYGI 192
           T CAG I ASK+ GI
Sbjct: 240 TRCAGEIAASKNNGI 254

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 125 NFNKYLYDNAGGEGVTAYVIDTGINVKHVEF------DGRAQWGKTIPLNDLDIDGNGHG 178
           N     Y+N  G GV A ++D G++ ++ +       +G   +    PL    +  + HG
Sbjct: 179 NVTALWYENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHG 238

Query: 179 THCAGTIAS 187
           T CAG IA+
Sbjct: 239 TRCAGEIAA 247

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 60/139 (43%), Gaps = 18/139 (12%)

Query: 57  IKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARIS 116
           + DLF  NDLF+ L    P P   +      V+  E    ++   F+ Q    W L   S
Sbjct: 97  VHDLFPRNDLFKRL----PVPAPPMDSSLLPVKEAEDKLSINDPLFERQ----WHLVNPS 148

Query: 117 HR-DRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEF------DGRAQWGKTIPLND 169
                +N+ +     Y+N  G GV A ++D G++ ++ +       +G   +     L  
Sbjct: 149 FPGSDINVLDL---WYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPK 205

Query: 170 LDIDGNGHGTHCAGTIASK 188
             +  + HGT CAG IA+K
Sbjct: 206 PRLSDDYHGTRCAGEIAAK 224

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 6/69 (8%)

Query: 125 NFNKYLYDNAGGEGVTAYVIDTGINVKHVE----FDGRAQW--GKTIPLNDLDIDGNGHG 178
           N  K  Y+N  GEG+   ++D G++ ++ +    F     W       L    +  + HG
Sbjct: 169 NVKKLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDYHG 228

Query: 179 THCAGTIAS 187
           T CAG IA+
Sbjct: 229 TRCAGEIAA 237

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 58/138 (42%), Gaps = 16/138 (11%)

Query: 57  IKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARIS 116
           + DL   NDLF+ L    P P   +      V+  E    ++   F+ Q    W L   S
Sbjct: 97  VHDLSLRNDLFKRL----PVPAPPMDSSLLPVKEAEDRLSINDPLFERQ----WHLVNPS 148

Query: 117 HRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEF------DGRAQWGKTIPLNDL 170
                N  N  K  Y+N  G GV A ++D G++ ++ +       +G   +     L   
Sbjct: 149 FPG--NDMNVLKLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKP 206

Query: 171 DIDGNGHGTHCAGTIASK 188
            +  + HGT CAG IA+K
Sbjct: 207 RLSDDYHGTRCAGEIAAK 224

>NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85
           YGR240C
          Length = 987

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 209 SGTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHF 267
           S + SDV +    +A   LK++ + +K K   A M+  GG SP ++ AV A V  GIHF
Sbjct: 177 SESSSDVSRDASLSAINMLKQTLSGQK-KKKIAVMT-SGGDSPGMNAAVRAVVRTGIHF 233

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 131 YDNAGGEGVTAYVIDTGINVKHVEF------DGRAQWGKTIPLNDLDIDGNGHGTHCAGT 184
           Y+N  G GV A ++D G++ +  +       +G   +     L    +D + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 185 IAS 187
           IA+
Sbjct: 214 IAA 216

>KNAG0L01150 Chr12 (203191..206358) [3168 bp, 1055 aa] {ON}
           Anc_7.185 YFR030W
          Length = 1055

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 68/159 (42%), Gaps = 14/159 (8%)

Query: 304 FSNWGKCVDIFA---PGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLS-LQPDS 359
           F N+   ++++    P L  L T I    R   S++ +    P+   LL   +       
Sbjct: 807 FYNYVDILNLYPSARPSLQQLVTLIAPLKRREYSIASSQKMHPNEVHLLIVVVDWFDNQG 866

Query: 360 DSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSA 419
              F  ASK+ ++  Q  ++L+     +V+   P+P+ P  ++ +G G  L  F      
Sbjct: 867 RKRFGQASKY-ISDLQPGQELVVSVKPSVMKLPPNPEQP--VVMSGLGTGLAPF--KAIV 921

Query: 420 DEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQV 458
           +E+  +  + +   E+ L      +G RH   + L+G++
Sbjct: 922 EEKLWQKQQGQTIGEVYL-----YLGSRHKREEYLYGEL 955

>Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa]
           {ON} complement(157470..160439) [2970 nt, 990 aa]
          Length = 989

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 227 LKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHF 267
           LK+S +    K   A M+  GG SP ++ AV A V AGIH+
Sbjct: 196 LKQSVSTNGIKKKLAVMT-SGGDSPGMNAAVRAVVRAGIHY 235

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 131 YDNAGGEGVTAYVIDTGINVKHVEF------DGRAQWGKTIPLNDLDIDGNGHGTHCAGT 184
           Y+N  G GV A ++D G++ ++ +       +G   +     L    +  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 185 IASK 188
           IA+K
Sbjct: 221 IAAK 224

>CAGL0I10945g Chr9 (1079542..1080720) [1179 bp, 392 aa] {ON} similar
           to uniprot|Q08601 Saccharomyces cerevisiae YOR197w
          Length = 392

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 44  FNFVNAEGLPRGGIKDLFNINDLFQGLIGYFPEPVVKLL-EKSDIVEFVERDSVVHASNF 102
            N++ ++   RG I D  NI +      GY PE +V L  ++ ++V+   +++++ A  +
Sbjct: 105 INYIGSKNALRGCINDAHNIFNYLTTYCGYRPEDIVMLTDDQREMVKIPLKENIIRAMQW 164

Query: 103 DTQNNAP 109
             ++  P
Sbjct: 165 LVKDAQP 171

>KAFR0B04340 Chr2 complement(898716..901679) [2964 bp, 987 aa] {ON}
           Anc_5.85 YGR240C
          Length = 987

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 227 LKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHF 267
           LK S N  K K   A M+  GG SP ++ AV A V  G+H+
Sbjct: 193 LKSSLNAYKTKKKIAVMT-SGGDSPGMNAAVRAVVRTGLHY 232

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 6/69 (8%)

Query: 125 NFNKYLYDNAGGEGVTAYVIDTGINVKHVEF------DGRAQWGKTIPLNDLDIDGNGHG 178
           N  +  Y+N  G GV A ++D G++ +  +       +G   +     L    +  + HG
Sbjct: 148 NITELWYNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGDDNHG 207

Query: 179 THCAGTIAS 187
           T CAG IA+
Sbjct: 208 TRCAGEIAA 216

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 125 NFNKYLYDNAGGEGVTAYVIDTGINVKHVEF------DGRAQWGKTIPLNDLDIDGNGHG 178
           N     Y N  G+GV A V+D G++ ++ +       +G   +     L    +  + HG
Sbjct: 146 NVQDVWYQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHG 205

Query: 179 THCAGTIAS-KHYGI 192
           T CAG IA+ K+ GI
Sbjct: 206 TRCAGEIAAVKNNGI 220

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 131 YDNAGGEGVTAYVIDTGINVKHVEF------DGRAQWGKTIPLNDLDIDGNGHGTHCAGT 184
           Y+N  G GV A ++D G++ ++ +       +G   +     L    +  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDYHGTRCAGE 220

Query: 185 IASK 188
           IA+K
Sbjct: 221 IAAK 224

>ZYRO0B08140g Chr2 (635368..638322) [2955 bp, 984 aa] {ON} highly
           similar to uniprot|P16861 Saccharomyces cerevisiae
           YGR240C PFK1 Alpha subunit of heterooctameric
           phosphofructokinase involved in glycolysis indispensable
           for anaerobic growth activated by fructose-2 6-
           bisphosphate and AMP mutation inhibits glucose induction
           of cell cycle-related genes
          Length = 984

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 223 AQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHF 267
           A   LK S    + K   A M+  GG SP ++ AV A V  GIHF
Sbjct: 190 AVKELKNSLARSQKKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHF 233

>TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa]
           {ON} Anc_5.85 YGR240C
          Length = 991

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 220 EYAAQAHLKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHF 267
           E+  ++ + +SKN    K   A M+  GG SP ++ AV A V  GIH+
Sbjct: 194 EFLQKSLINKSKNGS-IKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHY 239

>Smik_16.66 Chr16 (123019..125982) [2964 bp, 987 aa] {ON} YGR240C
           (REAL)
          Length = 987

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 227 LKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHF 267
           L+++ +  + K   A M+  GG SP ++ AV A V  GIHF
Sbjct: 195 LRQTLSTSQKKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHF 234

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 6/69 (8%)

Query: 125 NFNKYLYDNAGGEGVTAYVIDTGINVKHVE----FDGRAQW--GKTIPLNDLDIDGNGHG 178
           N +   Y+N  G  V   V+D G++ +  +    F     W      P+    +  + HG
Sbjct: 149 NVSGLWYENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDYHG 208

Query: 179 THCAGTIAS 187
           T CAG IA+
Sbjct: 209 TRCAGEIAA 217

>SAKL0F15070g Chr6 (1213643..1215403) [1761 bp, 586 aa] {ON} similar
           to uniprot|P27614 Saccharomyces cerevisiae YJL172W CPS1
           Vacuolar carboxypeptidase yscS expression is induced
           under low-nitrogen conditions
          Length = 586

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 13/67 (19%)

Query: 89  EFVERDSVVHASNFDTQNNAPWGLARISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGI 148
           +FV + S++ A  FD + +  +G   IS           K LY+  G +G+ A +ID G+
Sbjct: 223 DFVPKRSIIVAVGFDEEASGYFGAKYIS-----------KLLYERYGQDGIYA-IIDEGV 270

Query: 149 N-VKHVE 154
           N +K VE
Sbjct: 271 NGIKEVE 277

>Skud_7.574 Chr7 complement(945547..948510) [2964 bp, 987 aa] {ON}
           YGR240C (REAL)
          Length = 987

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 227 LKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHF 267
           L+++  + + K   A M+  GG SP ++ AV A V  GIHF
Sbjct: 195 LRQTLGSSQKKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHF 234

>YGR240C Chr7 complement(970771..973734) [2964 bp, 987 aa] {ON}
           PFK1Alpha subunit of heterooctameric phosphofructokinase
           involved in glycolysis, indispensable for anaerobic
           growth, activated by fructose-2,6-bisphosphate and AMP,
           mutation inhibits glucose induction of cell
           cycle-related genes
          Length = 987

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 227 LKESKNNKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHF 267
           L+++  + + K   A M+  GG SP ++ AV A V  GIHF
Sbjct: 195 LRQTLGSSQKKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHF 234

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,503,864
Number of extensions: 2260193
Number of successful extensions: 4660
Number of sequences better than 10.0: 94
Number of HSP's gapped: 4477
Number of HSP's successfully gapped: 94
Length of query: 468
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 355
Effective length of database: 40,524,141
Effective search space: 14386070055
Effective search space used: 14386070055
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)