Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B03611gsingletonON62623244e-41
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03611g
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03611g Chr2 complement(360764..360952) [189 bp, 62 aa] {ON...   129   4e-41

>CAGL0B03611g Chr2 complement(360764..360952) [189 bp, 62 aa] {ON}
          some similarities with uniprot|Q05676 Saccharomyces
          cerevisiae YEL059ca SOM1
          Length = 62

 Score =  129 bits (324), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MALSAHCLKSLVKGMHTNMSLCTPWPCVFGAQWYCVSDFKGQSRLASAGIPSITGVGGAI 60
          MALSAHCLKSLVKGMHTNMSLCTPWPCVFGAQWYCVSDFKGQSRLASAGIPSITGVGGAI
Sbjct: 1  MALSAHCLKSLVKGMHTNMSLCTPWPCVFGAQWYCVSDFKGQSRLASAGIPSITGVGGAI 60

Query: 61 PM 62
          PM
Sbjct: 61 PM 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.135    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,370,919
Number of extensions: 134369
Number of successful extensions: 313
Number of sequences better than 10.0: 1
Number of HSP's gapped: 313
Number of HSP's successfully gapped: 1
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)