Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B03597g6.11ON54054027470.0
Kpol_1032.26.11ON53955214730.0
NCAS0F002006.11ON54955214720.0
Skud_5.316.11ON55754714440.0
TPHA0M002106.11ON54554814410.0
TDEL0G046006.11ON52853714300.0
YEL058W (PCM1)6.11ON55755614200.0
ZYRO0F00506g6.11ON55055514090.0
TBLA0G009806.11ON55856014040.0
Suva_5.106.11ON55355214010.0
Smik_5.296.11ON55554813980.0
SAKL0E00902g6.11ON54454713950.0
KLLA0D00858g6.11ON54153913930.0
NDAI0K028906.11ON56155313860.0
KAFR0L003406.11ON54054013840.0
Kwal_56.223556.11ON54154413690.0
KLTH0C11506g6.11ON54454513251e-178
Ecym_30146.11ON55155313041e-175
ACR015W6.11ON55253812741e-170
KNAG0E009406.11ON53855812631e-169
TDEL0B005708.840ON63046970.004
Kwal_27.102588.840ON62075970.004
Kpol_1068.88.840ON63230940.008
YMR278W (PGM3)8.840ON62230940.009
NDAI0K004108.840ON62636930.010
TBLA0B032508.840ON64330930.010
Suva_13.4668.840ON62230930.010
Skud_13.4508.840ON62230930.010
KLLA0D01573g8.840ON60736930.011
TPHA0I002508.840ON62935930.012
Smik_13.4918.840ON62230930.012
CAGL0M02981g8.840ON61736920.016
KNAG0J002708.840ON62550910.021
ZYRO0G14190g8.840ON61030900.026
SAKL0D01474g8.840ON62446900.027
ABL126W8.840ON62459900.028
KLTH0C03872g8.840ON62141880.039
Ecym_46118.840ON63029870.052
KAFR0B039208.840ON62427870.059
NCAS0C004108.840ON62521840.12
NCAS0I004807.123ON65754742.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03597g
         (540 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...  1062   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   572   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   571   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   560   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   559   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   555   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   551   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   547   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   545   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   544   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   543   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   541   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   541   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   538   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   537   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   531   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   514   e-178
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   506   e-175
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   495   e-170
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   491   e-169
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    42   0.004
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    42   0.004
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    41   0.008
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    41   0.009
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    40   0.010
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    40   0.010
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    40   0.010
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    40   0.010
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    40   0.011
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    40   0.012
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    40   0.012
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    40   0.016
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    40   0.021
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    39   0.026
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    39   0.027
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    39   0.028
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    39   0.039
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    38   0.052
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    38   0.059
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.12 
NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON}                 33   2.0  

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/540 (95%), Positives = 514/540 (95%)

Query: 1   MSLQLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITA 60
           MSLQLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITA
Sbjct: 1   MSLQLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITA 60

Query: 61  SHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFESTLNAIMQELNISPGHAP 120
           SHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFESTLNAIMQELNISPGHAP
Sbjct: 61  SHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFESTLNAIMQELNISPGHAP 120

Query: 121 QIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHFEDYYYRY 180
           QIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHFEDYYYRY
Sbjct: 121 QIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHFEDYYYRY 180

Query: 181 FLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLHQIDI 240
           FLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLHQIDI
Sbjct: 181 FLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLHQIDI 240

Query: 241 TNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSFDGDADRVVFYYVDDSLTFH 300
           TNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSFDGDADRVVFYYVDDSLTFH
Sbjct: 241 TNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSFDGDADRVVFYYVDDSLTFH 300

Query: 301 LLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVTKKLQVPVSIAKTG 360
           LLDGDKISTLLAYFIN               VVQTAYANGSSTTYVTKKLQVPVSIAKTG
Sbjct: 301 LLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKLQVPVSIAKTG 360

Query: 361 VKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKXXXXXXXXXXXIN 420
           VKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDK           IN
Sbjct: 361 VKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKSTLTLRLLSRLIN 420

Query: 421 QTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQERRLVS 480
           QTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQERRLVS
Sbjct: 421 QTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQERRLVS 480

Query: 481 PAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVTDALIETVKE 540
           PAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVTDALIETVKE
Sbjct: 481 PAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVTDALIETVKE 540

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/552 (54%), Positives = 367/552 (66%), Gaps = 27/552 (4%)

Query: 1   MSLQLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITA 60
           M+ +L+ K C T+D  Y YGTAGFR +A IL++VMFTTG++A LRSIS     VGVMITA
Sbjct: 1   MNSKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITA 60

Query: 61  SHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFESTLNAIMQEL--NISPGH 118
           SHNPP DNGVKIVE +G+ML Q WEP+AT LAN +A   TF+  L A ++E     SP  
Sbjct: 61  SHNPPEDNGVKIVEPNGAMLDQSWEPMATELAN-IAANSTFDD-LKAYVEEKVKKFSPES 118

Query: 119 A----PQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT------A 168
                P +VVG DSRES   LL  LL   +    +A+I N+GLLTTPQLHFLT       
Sbjct: 119 GSKVQPVVVVGRDSRESGSYLLECLLASAENYM-NAKIINYGLLTTPQLHFLTNEINVKK 177

Query: 169 NPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLP 228
           + A  E  YY YF+++WN++  L+ I        L IDTANGIGGP+  ++L       P
Sbjct: 178 SYAVQESSYYNYFIESWNKITALHNITDLYC-SSLTIDTANGIGGPKIQELLK----SWP 232

Query: 229 HLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGI--NADPRNLYCSFDGDAD 286
              K+ L      NN W  P +LN  CGADFVKTNQ+LP G+  N+   +LYCS+DGDAD
Sbjct: 233 FASKVTL-----VNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDAD 287

Query: 287 RVVFYYVDDSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYV 346
           R+VFY+ D    FHLLDGDKISTL A  I                VVQTAYANGSST Y+
Sbjct: 288 RIVFYFQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYL 347

Query: 347 TKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHD 406
              L VPVS AKTGVKHLHHEAVTNYDIGVYFEANGHGT+IFS HFY+V E  L  N+  
Sbjct: 348 QGTLNVPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSES 407

Query: 407 KXXXXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDR 466
                       INQT+GDAISDML +++VL I+  S   WD+EYTDLPN LTKV+VPDR
Sbjct: 408 IAVNTLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDR 467

Query: 467 SIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKL 526
           S+FITTDQER+L+SP GLQ KID  +++   GRSF+RASGTEDAVRVYAEA + E  ++L
Sbjct: 468 SVFITTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKEL 527

Query: 527 STEVTDALIETV 538
           +  VT  + E+V
Sbjct: 528 NALVTKLVKESV 539

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/552 (53%), Positives = 374/552 (67%), Gaps = 31/552 (5%)

Query: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63
           Q+YN  C TRD  YTYGTAGFR  A  LD+VMF TG+IA  RS+     PVGVM+TASHN
Sbjct: 10  QVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTASHN 69

Query: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFESTLNAIMQELNISPG-----H 118
           PP DNGVK+VE  G+ML+Q+WEPL T+LAN +A   +FE   + I+ E++  P      +
Sbjct: 70  PPLDNGVKVVEPTGAMLIQEWEPLTTKLAN-IAANESFEKVYDFIL-EVSKDPKFPFQEN 127

Query: 119 APQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTA---------- 168
            P +++GHDSRESSPRL   L++    +  +A I N+GL+TTPQLHF+T+          
Sbjct: 128 KPSLIIGHDSRESSPRLTKLLVNTAVEIY-NADIHNYGLVTTPQLHFITSLWNAKYNKNT 186

Query: 169 NPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLP 228
           N     D YY YF  +W++  ELY    FKSF+ L+ID+ANGIGGP+   ++S   + L 
Sbjct: 187 NDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPSTL- 245

Query: 229 HLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGI-NADPRNLYCSFDGDADR 287
                    + I NNSW NP++LN+ CGAD+VKTNQ+LP+GI N    NL+CSFDGDADR
Sbjct: 246 ------RGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADR 299

Query: 288 VVFYYVDD-SLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYV 346
           +VFYY+ +    FHLLDGDKI+TL A F++               VVQTAYANGSST Y+
Sbjct: 300 IVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYL 359

Query: 347 TKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHD 406
           T  L+VPVS  KTGVKHLHHEA T YDIG+YFEANGHGTV+FS+ F +V+++     A  
Sbjct: 360 TNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTTA-- 417

Query: 407 KXXXXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDR 466
                       INQT+GDA++DML +ITVL +   +P+ WD  Y DLPNKL KV+VPDR
Sbjct: 418 --TQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDR 475

Query: 467 SIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKL 526
           S+FITT+QER+L SP GLQ+KID+ V+    GRSF+RASGTEDAVRVYAEA T E TEKL
Sbjct: 476 SVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKL 535

Query: 527 STEVTDALIETV 538
           S EV   ++ +V
Sbjct: 536 SQEVCKFVLSSV 547

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/547 (53%), Positives = 361/547 (65%), Gaps = 27/547 (4%)

Query: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63
           +LY++ C T++  Y+YGTAGFR  A+ LD+VMFTTG++A LRS+  Q   VGVMITASHN
Sbjct: 10  KLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHN 69

Query: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVA---DYHTFESTLNAIMQELNISPGH-- 118
           P +DNGVKIVE DGSMLL  WEP A +LAN+ +    +  F + L  +++   I  G   
Sbjct: 70  PYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDLGASN 129

Query: 119 -APQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT---------- 167
            AP IVVG DSRESSP LL  L   + +V   AR+ + G +TTPQLH++T          
Sbjct: 130 VAPHIVVGRDSRESSPYLLRCLTSTMASVF-HARVLDLGCVTTPQLHYITDLSNRREREG 188

Query: 168 --ANPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQT 225
             A  A  E  YY +F+ A+N+LF  Y +E   S  KL IDTANGIGGPQ  K+L+    
Sbjct: 189 DSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLASKDW 248

Query: 226 DLPHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADP-RNLYCSFDGD 284
            +P        QI+I N+    P +LNS CGAD+VKTNQRLP+G++     +LYCSFDGD
Sbjct: 249 VVPS------DQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFDGD 302

Query: 285 ADRVVFYYVDDSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTT 344
           ADRVVFYYVD  L FHLLDGDKISTL A F++               VVQTAYANGSST 
Sbjct: 303 ADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTA 362

Query: 345 YVTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAK-N 403
           Y+   L  PVS  KTGVKHLHHEA T YDIG+YFEANGHGT+IFS+ F++ IE  L+K N
Sbjct: 363 YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPN 422

Query: 404 AHDKXXXXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVV 463
            H             INQT+GDA+SDMLA++  L IL  +P  WD EY DLPNKL K +V
Sbjct: 423 GHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCIV 482

Query: 464 PDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEAT 523
           PDRSIF TTDQER+L +P GLQ KID ++A  P GRSF+RASGTEDAVRVYAE Q +   
Sbjct: 483 PDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSKL 542

Query: 524 EKLSTEV 530
           ++   E+
Sbjct: 543 DQFCNEI 549

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/548 (52%), Positives = 359/548 (65%), Gaps = 25/548 (4%)

Query: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64
           ++   C TR+  Y YGTAGFR DA +LD+VM TTG++A LRSI+     VGVMITASHN 
Sbjct: 9   VFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQ 68

Query: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHT---FESTLNAIMQELNISPGHAPQ 121
           P DNGVKIVE DGSML Q WEP AT LAN  +  H+   F+  L     +  +  G  P 
Sbjct: 69  PCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPV 128

Query: 122 IVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT-------ANPAHFE 174
           +VVG DSR+S PRLL   L+ +       +I ++GLLTTPQLHFLT       +     E
Sbjct: 129 LVVGRDSRDSGPRLL-QCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTE 187

Query: 175 DYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIR 234
           D YY +F+DAW  +  L+GI+  +S  +L ID ANGIGGP+  K+              +
Sbjct: 188 DDYYSFFMDAWVSITALHGIKVLQS-PRLYIDAANGIGGPKVSKLFEVWP---------Q 237

Query: 235 LHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGIN----ADPRNLYCSFDGDADRVVF 290
             Q  + NN W  P++LN+ CGAD+VKTNQRLP+ I+    +DP  LYCSFDGDADR+VF
Sbjct: 238 AGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVF 297

Query: 291 YYVDDSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVTKKL 350
           YY D   +FHLLDGDKISTL A FI+               VVQTAYANG+ST Y+   L
Sbjct: 298 YYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVL 357

Query: 351 QVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKXXX 410
            +PVS AKTGVKHLHHEA+TNYD+G+YFEANGHGT++FS  F+E  E  L +N       
Sbjct: 358 NIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNESLEVK 417

Query: 411 XXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFI 470
                   INQT+GDAISDML ++ VL I+  +P+ WD EYTDLPN LTKVVVPDRS+F 
Sbjct: 418 TLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFT 477

Query: 471 TTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEV 530
           TTDQER+L++P G Q KID +VA    GRSF+RASGTEDAVRVYAEA T +    L+ EV
Sbjct: 478 TTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEV 537

Query: 531 TDALIETV 538
           + A++ +V
Sbjct: 538 SKAVLASV 545

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/537 (54%), Positives = 354/537 (65%), Gaps = 23/537 (4%)

Query: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64
           L  + C TR   Y YGTAGFR D+  LD+VMF TG++A LRS      PVGVMITASHNP
Sbjct: 8   LIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNP 67

Query: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFESTLNAIMQELNISPGHAPQIVV 124
             DNGVK+VE DGSML+Q WE  AT LAN +A+    E     + Q  +      PQ++V
Sbjct: 68  SGDNGVKVVEPDGSMLIQSWESTATELANLLAN-RPLEDIKAKVGQLTSGESSVRPQLIV 126

Query: 125 GHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANP----AHF-EDYYYR 179
           G DSR S P LL+ L+    ++  DA+IT++GLLTTPQLHFLT       AH  E  Y+ 
Sbjct: 127 GRDSRVSGPHLLSCLVASATSLF-DAKITDYGLLTTPQLHFLTNETMITGAHVDEQAYFA 185

Query: 180 YFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLHQID 239
           +FL AW+Q+  L  ++       +V+D ANGIGGP+   +L+         Q     Q  
Sbjct: 186 HFLGAWDQIAALQPVK----LPNVVVDCANGIGGPKMSALLT---------QWGFAKQCS 232

Query: 240 ITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSFDGDADRVVFYYVDDSLTF 299
           + N+    P +LN GCGADFVKT+QRLP G+  +  +LYCSFDGDADRVVFYY+D +L F
Sbjct: 233 VINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDGDADRVVFYYLDQNLGF 292

Query: 300 HLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVTKKLQVPVSIAKT 359
           HLLDGDKISTL AYF+                VVQTAYANGSST Y+   LQVPVS  KT
Sbjct: 293 HLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKT 352

Query: 360 GVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKXXXXXXXXXXXI 419
           GVKHLHHEAV NYDIG+YFEANGHGTV+FS  F+E + +   +    K           I
Sbjct: 353 GVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYLAKL---I 409

Query: 420 NQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQERRLV 479
           NQT+GDAISDM+A++ VL IL WSP+ WD E+TDLPNKLTKVVV DRS F TTDQERRLV
Sbjct: 410 NQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLV 469

Query: 480 SPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVTDALIE 536
           SPAGLQDKID  VA    GRSF+RASGTEDAVRVYAEA T    ++LS+ V D + E
Sbjct: 470 SPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVRE 526

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/556 (52%), Positives = 367/556 (66%), Gaps = 31/556 (5%)

Query: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63
           +LY+  C T++  ++YGTAGFR  A+ LD+VMF+TG++A LRS+  Q   VGVMITASHN
Sbjct: 10  KLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHN 69

Query: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVA---DYHTFESTLNAIMQ--ELNISPGH 118
           P +DNGVKIVE DGSMLL  WEP A +LAN+ +   ++  F   L  +++  +++++   
Sbjct: 70  PYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDLNTTV 129

Query: 119 APQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT----------- 167
            P IVVG DSRESSP LL  L   + +V   A++ + G +TTPQLH++T           
Sbjct: 130 VPHIVVGRDSRESSPYLLRCLTSSMASVF-HAQVLDLGCVTTPQLHYITDLSNRRKLEGD 188

Query: 168 ANPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDL 227
             P   E  YY +F+ A+N+LF  Y +E   S  KL IDTANGIGGPQ  K+L+    D+
Sbjct: 189 TAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASEDWDV 248

Query: 228 PHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADP-RNLYCSFDGDAD 286
           P        Q+++ N+    P +LN  CGAD+VKTNQRLP+G++     +LYCSFDGDAD
Sbjct: 249 P------AEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGDAD 302

Query: 287 RVVFYYVDDSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYV 346
           RVVFYYVD    FHLLDGDKISTL A F++               VVQTAYANGSST Y+
Sbjct: 303 RVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYI 362

Query: 347 TKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAK---N 403
              L  PVS  KTGVKHLHHEA T YDIG+YFEANGHGT+IFS+ F+  I+  L+K   N
Sbjct: 363 KNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLN 422

Query: 404 AHDKXXXXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVV 463
                          INQT+GDAISDMLA++  L IL  SP  WD EYTDLPNKL K +V
Sbjct: 423 GDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIV 482

Query: 464 PDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEAT 523
           PDRSIF TTDQER+L++P GLQDKID++VA  P GRSF+RASGTEDAVRVYAE +    +
Sbjct: 483 PDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKD---S 539

Query: 524 EKLSTEVTDALIETVK 539
            KL  +  D ++E VK
Sbjct: 540 SKLG-QFCDEVVEHVK 554

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/555 (51%), Positives = 361/555 (65%), Gaps = 33/555 (5%)

Query: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63
           +L ++ C   D+HY YGTAGFR  A  LD+V+F TG++A LRS++ +   +GVM+TASHN
Sbjct: 9   KLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTASHN 68

Query: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVA-----------DYHTFESTLNAIMQEL 112
           PP DNGVK+VE DGSM+ + WEPLAT LAN++A            +   +  L   +Q  
Sbjct: 69  PPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQSA 128

Query: 113 NIS--PGHAPQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANP 170
           N S   G  P +VVG DSRES P+LL+ L+   K +   A+I + GLLTTPQLHFLT+  
Sbjct: 129 NNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELF-HAKIHDQGLLTTPQLHFLTSET 187

Query: 171 AH-----FEDYYYRYFLDAWNQLFELYGI-EGFKSFDKLVIDTANGIGGPQFLKMLSYSQ 224
           A       E  YY +FL AW+ + +L+GI E   +   L ID ANGIG P+  ++LS   
Sbjct: 188 AKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQELLS--- 244

Query: 225 TDLPHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSFDGD 284
                 Q     Q+   N+ W NP +LN  CGADFVK+NQR P G N D   L CS+DGD
Sbjct: 245 ------QWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN-DSTGLGCSYDGD 297

Query: 285 ADRVVFYYVDDSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTT 344
           ADRVVFYY++++  F LLDGD+IS L A+F                 VVQTAYANG+ST 
Sbjct: 298 ADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTE 357

Query: 345 YVTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNA 404
           Y+ K LQVPVS AKTGVKHLHHEAVT YDIG+YFEANGHGT+IFS  FY+VI+++  ++ 
Sbjct: 358 YLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERSV 417

Query: 405 HDKXXXXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVP 464
                         INQT+GDAISDML ++  L I  W+P  W  E+TDLPN+L KVVVP
Sbjct: 418 ---AVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVP 474

Query: 465 DRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATE 524
           DRS+FITTDQERRL  P GLQ KID  V     GRSF+RASGTEDAVRVYAEA ++E  E
Sbjct: 475 DRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVE 534

Query: 525 KLSTEVTDALIETVK 539
           KLS  V + ++++V+
Sbjct: 535 KLSNTVKELVVKSVQ 549

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/560 (53%), Positives = 369/560 (65%), Gaps = 41/560 (7%)

Query: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64
           L++K C T++  YTYGTAGFR  A ILD+VMFTTG +A LRS+S     VGVM+TASHNP
Sbjct: 13  LFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNP 72

Query: 65  PRDNGVKIVESDGSMLLQDWEPLATRLAN--SVADYHTFESTLNAIMQELNISPGHAPQI 122
           P DNGVKIVE +GSML QDWEP+AT LAN  S          +NA + ELN      P +
Sbjct: 73  PVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLIELN--SNKVPTL 130

Query: 123 VVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHFEDY------ 176
           +VG DSRESS  LL  L +G   +  DA+I ++ LLTTPQLHFLT N  + E        
Sbjct: 131 IVGRDSRESSTSLLECLKEGSLKLF-DAKIVDYELLTTPQLHFLT-NAYNLEKDLPKETD 188

Query: 177 YYRYFLDAWNQLFELYGIEGFKSFDK---LVIDTANGIGGPQFLKMLSYSQTDLPHLQKI 233
           YY +F +AW+QL  +       + +K   L+ID+ANGIGGP+   +L Y +T+     K+
Sbjct: 189 YYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNY----KV 244

Query: 234 RLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRN------LYCSFDGDADR 287
           RL      NN+W  P  LN+ CGAD+VKTNQ+LP GI  D  N      ++CSFDGDADR
Sbjct: 245 RL-----INNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADR 299

Query: 288 VVFYYVD-DSLTFHLLDGDKISTLLAYFINXXXXXXXX--XXXXXXXVVQTAYANGSSTT 344
           VVFYY D  S TF+LLDGDKISTL A FI+                 VVQTAYANGSST 
Sbjct: 300 VVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTN 359

Query: 345 YVTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVI------ED 398
           Y+ + L++PV+ AKTGVKHLHHEA T YDIGVYFEANGHGT+IFS++FY++I      E 
Sbjct: 360 YLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAES 419

Query: 399 RLAKNAHDKXXXXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKL 458
           ++      +           INQT+GDAISDM+ ++ VL IL W+P  W+ EYTDLPNKL
Sbjct: 420 QIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKL 479

Query: 459 TKVVVPDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQ 518
            K+VVPDRS+F TTDQER+L SPAGLQ KI+ +VA    GRSF+RASGTEDAVRVYAEA 
Sbjct: 480 AKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS 539

Query: 519 TVEATEKLSTEVTDALIETV 538
             +   KL  EV DA  E+V
Sbjct: 540 --DDVNKLCQEVLDATAESV 557

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/552 (52%), Positives = 361/552 (65%), Gaps = 25/552 (4%)

Query: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63
           +LY + C T++  Y+YGTAGFR  A+ LD+VMFTTG++A LRS+  Q   VGVMITASHN
Sbjct: 10  KLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHN 69

Query: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSV---ADYHTFESTLNAIMQELNISPGHAP 120
           P +DNGVKIVE DGSMLL  WEP A +LAN+    A +  F + L  +++   I    AP
Sbjct: 70  PYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDAAP 129

Query: 121 QIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT------------A 168
            +VVG DSRESSP LL  L   + +V   A + + G +TTPQLH++T            A
Sbjct: 130 HVVVGRDSRESSPFLLRCLTSTMASVF-HAHVVDLGCVTTPQLHYVTNLSNKRQREGGSA 188

Query: 169 NPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLP 228
             A  +DYY  +F++A+N+LF    IE   S  KL +DTANGIGGPQ  K+L+     +P
Sbjct: 189 QVATEQDYY-SFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWAVP 247

Query: 229 HLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGIN-ADPRNLYCSFDGDADR 287
                   +I+I N+    P +LN  CGAD+VKTNQRLP+G++ + P +LYCSFDGDADR
Sbjct: 248 S------DEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDADR 301

Query: 288 VVFYYVDDSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVT 347
           VVFYYVD    FHLLDGDKISTL A F++               VVQTAYANGSST+Y+ 
Sbjct: 302 VVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIK 361

Query: 348 KKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAK-NAHD 406
             L  PVS  KTGVKHLHHEA T YDIG+YFEANGHGT+IFS+ F++ IE  L++     
Sbjct: 362 DTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGSL 421

Query: 407 KXXXXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDR 466
                       INQT+GDAISDMLA++  L IL  +P  WD EYTDLPNKL K +VPDR
Sbjct: 422 LALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDR 481

Query: 467 SIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKL 526
           SIF TTDQER+L +PAGLQ KID ++     GRSF+RASGTEDAVRVYAE Q     ++ 
Sbjct: 482 SIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQF 541

Query: 527 STEVTDALIETV 538
             EV + +  +V
Sbjct: 542 CNEVVEYVKSSV 553

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/548 (51%), Positives = 362/548 (66%), Gaps = 27/548 (4%)

Query: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63
           +LY+K C T++  Y+YGTAGFR  A+ LD+VMFTTG++A LRS+  Q   VGVMITASHN
Sbjct: 10  ELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHN 69

Query: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVA---DYHTFESTLNAIMQ--ELNISPGH 118
           P +DNGVKIVE DGSMLL  WEP A +LAN+ +   ++  F + L  +++  ++ +    
Sbjct: 70  PYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTSI 129

Query: 119 APQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT----------- 167
            P IVVG DSRESSP LL  L   + +V   A++ + G +TTPQLH++T           
Sbjct: 130 VPHIVVGRDSRESSPYLLRCLTSTMVSVF-HAQVLDLGCVTTPQLHYITDLSNKREREGG 188

Query: 168 -ANPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTD 226
            A  A  +DYY  +F+ A+N+LF  Y IE   S  +L ID ANGIGGPQ  K+L+     
Sbjct: 189 SAEVATEQDYY-SFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKDWV 247

Query: 227 LPHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRN-LYCSFDGDA 285
           +P        QI++ N+    P +LN  CGAD+VKTNQRLP+G++    + LYCSFDGDA
Sbjct: 248 VPP------DQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDA 301

Query: 286 DRVVFYYVDDSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTY 345
           DRVVFYYVD    FHLLDGDKISTL A F++               VVQTAYANGSST Y
Sbjct: 302 DRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNY 361

Query: 346 VTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAH 405
           +   L+ PVS  KTGVKHLHHEA T YDIG+YFEANGHGT+IFS+ F++VI+  L++   
Sbjct: 362 IENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARG 421

Query: 406 DKXXXXXX-XXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVP 464
           D             INQT+GDA+SDMLA++  L I+  +P  WD EYTDLPNKL K +VP
Sbjct: 422 DMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVP 481

Query: 465 DRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATE 524
           DRSIF T DQER+L +P GLQ KID+++A  P GRSF+RASGTEDAVR+YAE Q     +
Sbjct: 482 DRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLD 541

Query: 525 KLSTEVTD 532
           +   E+ +
Sbjct: 542 QFCNEIVE 549

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/547 (51%), Positives = 359/547 (65%), Gaps = 24/547 (4%)

Query: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63
           +LY+K+C T    YTYGTAGFR  A +LD+VMFTTG++AA+RSI  +   VGVMITASHN
Sbjct: 9   ELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHN 67

Query: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD-YHTFESTLNAIMQELNISPGHAPQI 122
           PP+DNGVKIV+  G ML Q WEP AT LANS +         L+ ++ +L I    + +I
Sbjct: 68  PPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGIDDTESAKI 127

Query: 123 VVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT------ANPAHFEDY 176
            +  DSRES PRLL  ++DG K V  + ++ +  LLTTPQLHFLT      ++    E  
Sbjct: 128 TISRDSRESGPRLLQAVIDGTK-VLKNVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEEST 186

Query: 177 YYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLH 236
           YY  F  AW ++  L+ I       +++ID ANGIGGP+  +ML  +        K    
Sbjct: 187 YYSAFSSAWTKICGLHDINSLPY--RVIIDAANGIGGPKVSEMLLKN--------KFFSS 236

Query: 237 QIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRN--LYCSFDGDADRVVFYYVD 294
            + + NN W +P +LN  CGAD+VKTNQ  P+G++ +  N  +YCSFDGDADR+VFYY D
Sbjct: 237 TVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHD 296

Query: 295 DSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVTKKLQVPV 354
           +   F+LLDGDKISTL A F                 VVQTAYANGSST Y++  L+VPV
Sbjct: 297 EKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPV 356

Query: 355 SIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKXXXXXXX 414
           S   TGVKHLHHEA+ NYDIG+YFEANGHGTVIFS  F++ I+ +L +   +K       
Sbjct: 357 SCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKT 416

Query: 415 X---XXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFIT 471
                  INQT+GDAISDMLA++ VL IL WSP  WD EYTDLPNKL KV+VPDRS+F T
Sbjct: 417 LYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKT 476

Query: 472 TDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVT 531
           ++ ER+LVSP GLQ+KID  V +   GRSF+RASGTEDAVRVYAEA T E  ++L+  V+
Sbjct: 477 SNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVS 536

Query: 532 DALIETV 538
           D +  +V
Sbjct: 537 DLVSRSV 543

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/539 (53%), Positives = 356/539 (66%), Gaps = 24/539 (4%)

Query: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64
           LY + C  +   YTYGTAGFRA   +LD+VMFTTG++A LRSI  +   VGVMITASHNP
Sbjct: 6   LYEQYC-KQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64

Query: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHT-FESTLNAIMQELNISPGHAPQIV 123
           P DNGVK+VE  G ML+Q+WEP+AT+LAN+ +   T  ESTL +I+ ELNI       I 
Sbjct: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANIT 124

Query: 124 VGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFL------TANPAHFEDY- 176
           V  DSRES PRLLA L  GI +V P  +I +  LLTTPQLHFL      ++ P+   D  
Sbjct: 125 VARDSRESGPRLLAALKAGI-SVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDST 183

Query: 177 YYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLH 236
           YY +F+  WNQL +LY +        L ID ANGIG  +  +++S +     H+ +  L 
Sbjct: 184 YYDHFVSIWNQLTQLYEVTELPF--HLTIDCANGIGADKVKQLISQA----GHMLENSLT 237

Query: 237 QIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSFDGDADRVVFYYVDDS 296
            ++    ++    +LN  CGADFVKTNQ  P   N  P  LYCSFDGDADRVVFYYVD  
Sbjct: 238 AVNGETKTF---QLLNESCGADFVKTNQTFPANCNPKPSQLYCSFDGDADRVVFYYVDGK 294

Query: 297 LT-FHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVTKKLQVPVS 355
              FHLLDGDKI+TLLA  I                VVQTAYANGSST Y+T KL++PVS
Sbjct: 295 ENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVS 354

Query: 356 IAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKXX----XX 411
             KTGVKHLHHEAV+ YDIG+YFEANGHGTVIFS+ F E ++ RL + + ++        
Sbjct: 355 CTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLS 414

Query: 412 XXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFIT 471
                  INQT+GDAISDMLA+I  L I    P  WD  Y DLPN+LTKV+VPDRS+F++
Sbjct: 415 LKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVS 474

Query: 472 TDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEV 530
           T+ ER+L+SP GLQ KID+LV   P  RSF+RASGTEDAVRVYAEA+T E+  +L+T+V
Sbjct: 475 TNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKV 533

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/553 (52%), Positives = 371/553 (67%), Gaps = 26/553 (4%)

Query: 6   YNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCA----PVGVMITAS 61
           +N+ C T++ HYTYGTAGFR +A+ LD+VMFTTG++A LRS++ Q +     +GVM+TAS
Sbjct: 16  FNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVMVTAS 75

Query: 62  HNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD------YHTFESTLNAIMQELNIS 115
           HNPP DNGVKI+E +GSMLLQ+WEP AT+ AN  A+      Y     ++  +  +LNI 
Sbjct: 76  HNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLENDLNIK 135

Query: 116 PGHAPQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHF-- 173
               P +++GHDSR+SSP L+ +++     +  +A+I N+  +TTPQLHFLT        
Sbjct: 136 --QPPTLILGHDSRDSSPTLMNHIIKSATLIF-NAKIINYNYVTTPQLHFLTNLTNTTGT 192

Query: 174 --EDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQ 231
             E  YY +F    +QL  LY       FD L+ID ANGIG PQ  K+L +++   P L 
Sbjct: 193 AEEINYYDHFNKYLSQLQSLYPPFNL-PFDNLIIDAANGIGAPQVEKLL-FTKNKFPPLN 250

Query: 232 KIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINAD---PRNLYCSFDGDADRV 288
            I+ + I I NN   NP++LN  CGAD+VKTNQ+LP+GI  D      L+CS+DGDADR+
Sbjct: 251 -IK-NPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRI 308

Query: 289 VFYYVDD-SLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVT 347
           VFYY+D  +  F+LLDGDKI+TL A F +               VVQTAYANGSST Y++
Sbjct: 309 VFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYIS 368

Query: 348 KKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDK 407
            KL+VPVS  KTGVKHLHHEA+T YDIG+YFEANGHGTVIFS  F+  +  +L ++   +
Sbjct: 369 SKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELT-KLKESGSSR 427

Query: 408 XXXXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRS 467
                      INQT+GDA+SDMLA+I VL IL  SP +WD EY DLPNKL KV+VPDRS
Sbjct: 428 EIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPDRS 487

Query: 468 IFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLS 527
            FITTDQER+LV P GLQ  ++  VA    GRSF+RASGTEDAVRVYAEA+T E TE LS
Sbjct: 488 KFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEWLS 547

Query: 528 TEVTDALIETVKE 540
            +V   +IE+V +
Sbjct: 548 KKVCQLVIESVTQ 560

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/540 (52%), Positives = 359/540 (66%), Gaps = 25/540 (4%)

Query: 8   KNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNPPRD 67
           K C TR+  YTYGTAGFRA+A  LD+VMFTTG++A LRS+  Q   +GVMITASHNPP+D
Sbjct: 13  KYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQD 72

Query: 68  NGVKIVESDGSMLLQDWEPLATRLAN--SVADYHTFESTLNAIMQELNISPGHAPQIVVG 125
           NGVKIVE  G+ML++ WE +AT LAN  S  ++  F   L+ ++ +LNI     P+++VG
Sbjct: 73  NGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLIVG 132

Query: 126 HDSRESSPRLLANLLDGIKAVSP--DARITNHGLLTTPQLHFLTA--NPAHFEDYYYRYF 181
           HDSRESSP L+    + ++A +P  D  + NH L+TTPQLH+LT   N    E  YY++F
Sbjct: 133 HDSRESSPYLM----ECLQAAAPVFDTIVINHTLITTPQLHYLTMLQNDVVTEVDYYKFF 188

Query: 182 LDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLHQIDIT 241
             +WN LF LY      +F+ L++D ANG+G  QF K L Y    LP L  +      I 
Sbjct: 189 STSWNNLFSLYPDLNL-TFNNLIVDGANGVGSVQFSKFLPY----LPQLATLT----TII 239

Query: 242 NNSWLNPSMLNSGCGADFVKTNQRLPEGI-NADPRNLYCSFDGDADRVVFYYVDDSLTFH 300
           N+    P MLN  CGADFVKTNQ+LP GI N +P +LY SFDGDADR+VFYYVD++  FH
Sbjct: 240 NDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNKKFH 299

Query: 301 LLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVTKKLQVPVSIAKTG 360
           LLDGDKIST+L   +                VVQTAYANGSST Y+TK L+VPV   KTG
Sbjct: 300 LLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTG 359

Query: 361 VKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHD----KXXXXXXXXX 416
           VKHLHH A + +DIG+YFEANGHGTV+FS  FYEV++  +   +      K         
Sbjct: 360 VKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFS 419

Query: 417 XXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQER 476
             INQT+GD+++D+LA+I  L IL  SP+ WD EY DLPN LTK  V +R +F TTD ER
Sbjct: 420 KLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMER 479

Query: 477 RLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVTDALIE 536
           +L SP+GLQ+KID  V+    GRSF+RASGTEDAVR+YAEA+T    E LS EVT  L+E
Sbjct: 480 KLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQ-LVE 538

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/544 (52%), Positives = 346/544 (63%), Gaps = 27/544 (4%)

Query: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64
           LY  +C T   HY YGTAGFR  A +LD+VMFTTGV+A LRSI  +   VGVMITASHNP
Sbjct: 10  LYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITASHNP 68

Query: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVAD-YHTFESTLNAIMQELNISPGHAPQIV 123
           P DNGVKIV+  G ML Q WE  AT LANS +  +  F +++  +M +L +       IV
Sbjct: 69  PEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVGSNDHGSIV 128

Query: 124 VGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHF-------EDY 176
           V  DSRES PRLL   L G+K ++ + ++T+HGLLTTPQLHFLT+            +  
Sbjct: 129 VARDSRESGPRLLGAFLSGVKVLA-NVKVTDHGLLTTPQLHFLTSKSNELPKGTEIGKSL 187

Query: 177 YYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLH 236
           YY  FL AW ++ EL  I+      KL ID ANGIG P   +MLS          K    
Sbjct: 188 YYDNFLSAWVEIAELCKIDSLPY--KLEIDAANGIGAPVVTEMLSQ--------HKFFKG 237

Query: 237 QIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGI--NADPRNLYCSFDGDADRVVFYYVD 294
              + N+ W  P  LN  CGADFVKTNQ+LP GI    +   + CSFDGDADR+VFYY  
Sbjct: 238 AFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCG 297

Query: 295 DSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVTKKLQVPV 354
            +  FHLLDGDK++TL A F                 VVQTAYANGSST Y+ + L + V
Sbjct: 298 KNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISV 357

Query: 355 SIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIE----DRLAKNAHDKXXX 410
           +   TGVKHLHHEAV  YDIGVYFEANGHGTV+FS  F +VI+    ++L  +A  K   
Sbjct: 358 TCTPTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLK 416

Query: 411 XXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFI 470
                   INQT+GDAISDMLA++ VL IL WSP  WD EYTDLPNKL KV+VPDR++F 
Sbjct: 417 VLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFK 476

Query: 471 TTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEV 530
           T + ER+LVSPAG+Q+KID LVA    GRSF+RASGTEDAVRVYAEA T + TE LS +V
Sbjct: 477 TKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQV 536

Query: 531 TDAL 534
              L
Sbjct: 537 EKLL 540

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  514 bits (1325), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 281/545 (51%), Positives = 347/545 (63%), Gaps = 29/545 (5%)

Query: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64
           LY  +C +    Y YGTAGFR  A +LD+VMFTTGV+A LRSI  +   VGVMITASHNP
Sbjct: 10  LYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNP 68

Query: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHT-FESTLNAIMQELNISPGHAPQIV 123
           P DNGVKIV+  G ML Q WE  AT LANS     T F + L  ++ EL +       + 
Sbjct: 69  PEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLDTDALGSLA 128

Query: 124 VGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHFED-------Y 176
           V  DSRES PRLL  LL+G + V P+ RIT++GLLTTPQLHFLT+      +       +
Sbjct: 129 VARDSRESGPRLLHALLNGSR-VLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAIDRFF 187

Query: 177 YYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLH 236
           YY+ FL AW+ +  L GI+      KL ID ANGIG P+  +MLS          K    
Sbjct: 188 YYKEFLSAWDDITALCGIQSLPY--KLEIDAANGIGAPRVKEMLS--------THKFFDG 237

Query: 237 QIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINA--DPRNLYCSFDGDADRVVFYYVD 294
              + N+ W  P+ LN  CGAD+VKTNQRLP GI A  D + + CSFDGDADR+VFY+ D
Sbjct: 238 VFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCD 297

Query: 295 DSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVTKKLQVPV 354
               F LLDGDK++TL A F                 VVQTAYANGSST Y+ + L +PV
Sbjct: 298 SEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPV 357

Query: 355 SIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHD-----KXX 409
           +   TGVKHLHHEA+ NYDIGVYFEANGHGTV+FS+ F EV+   L+ N H      +  
Sbjct: 358 TCTPTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLS-NKHQSDSSLQSL 415

Query: 410 XXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIF 469
                    INQT+GDAISDM+ ++ VL IL W+P  W+ EYTDLPNKL KV+VPDR++F
Sbjct: 416 EVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVF 475

Query: 470 ITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTE 529
            TT+ ER+L+SP GLQ KI+ LVA+    RSF+RASGTEDAVRVYAEA T E  + L++ 
Sbjct: 476 KTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASR 535

Query: 530 VTDAL 534
           V+  +
Sbjct: 536 VSQVV 540

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  506 bits (1304), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 278/553 (50%), Positives = 351/553 (63%), Gaps = 37/553 (6%)

Query: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63
           +LY+K+C +R + Y YGTAGFR  A ILD+V+FTTGV+A LRS+  +   VG MITASHN
Sbjct: 9   KLYDKHCCSRFK-YIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHN 67

Query: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD-YHTFESTLNAIMQELNISPGHAPQI 122
           PP+DNGVK+V+  G ML Q+WE  AT LAN  +D  H F   L  +M +  I      +I
Sbjct: 68  PPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADSEARI 127

Query: 123 VVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHF--------- 173
           VV  DSRES  RLL  L+DG  +V  +  I ++ +LTTPQLHFLT +             
Sbjct: 128 VVARDSRESGSRLLKALVDGT-SVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEV 186

Query: 174 -EDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQ----FLKMLSYSQTDLP 228
            E +YY +FL A  +L EL+ I G      LVID ANG+GG +    F+K   +  +   
Sbjct: 187 NEAFYYSHFLSALKELTELFNIPGLPY--PLVIDAANGVGGAKAEELFMKNTFFKDS--- 241

Query: 229 HLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINA--DPRNLYCSFDGDAD 286
                      I N +W    +LNS CGAD+VKTNQ LP+GI+A  D  +L+CSFDGDAD
Sbjct: 242 ---------TTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDAD 292

Query: 287 RVVFYYVDDSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYV 346
           RV+FYY D    FHLLDGDKISTL A F                 VVQTAYANGSST Y+
Sbjct: 293 RVIFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYL 352

Query: 347 TKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAK---N 403
           ++ L VPVS   TGVK+LH +AV NYD+G+YFEANGHGTVIFS++F   +  RL +   +
Sbjct: 353 SEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLS 412

Query: 404 AHDKXXXXXXXX-XXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVV 462
           A  K            INQT+GDA+SDM+A++ VL IL W+P  WD EYTDLPN L KVV
Sbjct: 413 AESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVV 472

Query: 463 VPDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEA 522
           VPDRS+F TT+ ER+LVSP GLQ +ID ++      RSF+RASGTEDAVR+YAEA T E 
Sbjct: 473 VPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQ 532

Query: 523 TEKLSTEVTDALI 535
            + LS +++  +I
Sbjct: 533 ADDLSIKISQLVI 545

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  495 bits (1274), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 264/538 (49%), Positives = 346/538 (64%), Gaps = 25/538 (4%)

Query: 17  YTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNPPRDNGVKIVESD 76
           Y YGTAGFR+ A +L  V+F TG++A LRS+    A VGVM+TASHNPP DNGVK+V+  
Sbjct: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80

Query: 77  GSMLLQDWEPLATRLANSVAD-YHTFESTLNAIMQELNISPGHAPQIVVGHDSRESSPRL 135
           G ML  +WE  AT LAN  +         L+ ++  L +      ++VV  DSR S P+L
Sbjct: 81  GEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGLDLALRARVVVARDSRASGPQL 140

Query: 136 LANLLDGIKAVSPDARITNHGLLTTPQLHFLT-------ANPAHFEDYYYRYFLDAWNQL 188
           L  LLDG + +  D  + + G+LTTPQLHFLT       +     ED YY +F+ A  +L
Sbjct: 141 LDALLDGTRMLE-DVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVAALEEL 199

Query: 189 FELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLHQIDITNNSWLNP 248
             L+G+E       LV+DTANG+G  +  ++   S    P  +    +++ I N++W   
Sbjct: 200 AALHGLETLPF--PLVVDTANGVGALKARELFRRS----PLFK----NRVSIINDNWSQH 249

Query: 249 SMLNSGCGADFVKTNQRLPEGINAD--PRNLYCSFDGDADRVVFYYVDDSLTFHLLDGDK 306
            +LNSGCGAD+VKT Q LP+GI+AD    +L+CS+DGDADRV+FYY+D    FHLLDGDK
Sbjct: 250 ELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDK 309

Query: 307 ISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANGSSTTYVTKKLQVPVSIAKTGVKHLHH 366
           ISTL+A F+                VVQTAYANGSST Y+++ L+VPVS   TGVKHLH 
Sbjct: 310 ISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHR 369

Query: 367 EAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKXXXXXXXXXXX----INQT 422
           EAV  YD+G+YFEANGHGTVIFS+HF   +E  L   A                  INQT
Sbjct: 370 EAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQT 429

Query: 423 IGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQERRLVSPA 482
           IGDAI+DMLA+I +L IL WSP  WD +YTDLPN L KVVVPDRS+F TT+ E++L SPA
Sbjct: 430 IGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPA 489

Query: 483 GLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVTDALIETVKE 540
           GLQ+ ID +V     GRSF+RASGTEDAVR+YAEA + +  ++L+T+V+  ++E+  +
Sbjct: 490 GLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVESTND 547

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  491 bits (1263), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 277/558 (49%), Positives = 346/558 (62%), Gaps = 52/558 (9%)

Query: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64
           +++  C T+   YTYGTAGFR  A +LD+VMF TG +A LRS     A VGVM+TASHNP
Sbjct: 9   VFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNP 68

Query: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVAD--YHTFESTLNAIMQELNISPGHAPQI 122
           P DNGVK+V+ +G ML + WEPLATRLAN  A+  +  +     ++++E N + G   ++
Sbjct: 69  PEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTGG--ARL 126

Query: 123 VVGHDSRESSPRLLANLLDGIKAVSPDA------RITNHGLLTTPQLHFLTA-------N 169
            VGHD+RESSPRLL NL+D   AVS  +       ITNH     PQLH+LT+       +
Sbjct: 127 CVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNH-----PQLHYLTSLQRDGVTD 181

Query: 170 PAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGG---PQFLKMLSYSQTD 226
            A + D+    F   W +LF   G+  +  FD+L IDTANG+G     QF K  +  Q  
Sbjct: 182 AAAYNDH----FQGCWQKLFP-DGVVAW-PFDRLFIDTANGVGAVQLQQFFKGWAVDQ-- 233

Query: 227 LPHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLP------EGINADPRNLYCS 280
                K RL      N  +  P  LN  CGADFVKTN RLP       G +    +LYCS
Sbjct: 234 ----NKFRL-----LNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCS 284

Query: 281 FDGDADRVVFYYVDDSLTFHLLDGDKISTLLAYFINXXXXXXXXXXXXXXXVVQTAYANG 340
           FDGDADR+VFY+V +   FHLLDGDKISTL A FI                VVQTAYANG
Sbjct: 285 FDGDADRIVFYFVKNK-QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANG 343

Query: 341 SSTTYVTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRL 400
           +ST Y+  +L +P +  KTGVKHLHH A T YDIG+YFEANGHGTV+FS  F EV+    
Sbjct: 344 NSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVA 403

Query: 401 AKNAHDKXXXXXXXXXXXINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTK 460
           + N               INQT+GDAI+DML ++ VL  L W+P  W  EYTDLPN LTK
Sbjct: 404 STN---DAASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTK 460

Query: 461 VVVPDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTV 520
           VVVPDRSIF TTDQERRLVSP GLQ+KID  V      RSF+RASGTE+AVR+Y EA+  
Sbjct: 461 VVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDP 520

Query: 521 EATEKLSTEVTDALIETV 538
           +  ++LS +VT+A++ +V
Sbjct: 521 QEVQELSKQVTEAVLNSV 538

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD 97
           A VGVMITASHNP  DNG K+  S+G  ++    P  + +A S+ +
Sbjct: 157 ASVGVMITASHNPKMDNGYKVYYSNGCQII---PPHDSEIAQSIEE 199

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 23  GFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLLQ 82
           GF AD +  D+ + T  V  A+  +    A  GVMITASHNP  DNG K+  S+G  ++ 
Sbjct: 128 GFNADPK-KDAFVHTPMVPFAIDRLG---ASAGVMITASHNPKMDNGYKVYYSNGCQII- 182

Query: 83  DWEPLATRLANSVAD 97
              P    +A S+ D
Sbjct: 183 --PPHDRLIAQSILD 195

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81
           A VGVMITASHNP  DNG K+  S+G  ++
Sbjct: 155 ASVGVMITASHNPKMDNGYKVYYSNGCQII 184

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81
           A VGVMITASHNP  DNG K+  S+G  ++
Sbjct: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%)

Query: 46  SISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLL 81
           S++   A +GVMITASHNP  DNG K+  S+G  ++
Sbjct: 146 SVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQII 181

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81
           A VGVM+TASHNP  DNG K+  S+G  ++
Sbjct: 164 ASVGVMVTASHNPKMDNGYKVYYSNGCQII 193

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81
           A VGVMITASHNP  DNG K+  S+G  ++
Sbjct: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81
           A VGVMITASHNP  DNG K+  S+G  ++
Sbjct: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%)

Query: 46  SISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLL 81
           +++   A VG+MITASHNP  DNG K+  ++G  ++
Sbjct: 146 TVNATGASVGIMITASHNPKMDNGYKVYYTNGCQII 181

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 24/35 (68%)

Query: 47  ISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLL 81
           I+   A +GVMITASHNP  DNG K+  ++G  ++
Sbjct: 150 INLYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81
           A VGVM+TASHNP  DNG K+  S+G  ++
Sbjct: 149 ASVGVMVTASHNPKMDNGYKVYYSNGCQII 178

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 46  SISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLL 81
           S+    A VGVMITASHNP  DNG K+  ++G  ++
Sbjct: 140 SVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQII 175

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 15/50 (30%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSML---------------LQDWEP 86
           A VGVMITASHNP  DNG K+  ++G  +               L+ WEP
Sbjct: 152 ASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEP 201

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81
           A VGVMITASHNP  DNG K+  ++G  ++
Sbjct: 145 ASVGVMITASHNPKLDNGYKVYYANGCQII 174

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD 97
           A  G+MITASHNP  DNG K+  S+G  ++    P   RL +   D
Sbjct: 153 ASAGIMITASHNPKMDNGYKVYYSNGCQII----PPHDRLISETID 194

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 32  DSVMFTTGVIAALRSISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLLQDWEPLATR 90
           D  + T  V  A+ ++       GVMITASHNP  DNG K+  ++G  ++   + L  R
Sbjct: 137 DVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIPPHDELIGR 195

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 55  GVMITASHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSV 95
           G+MITASHNP  DNG K+  S+G  ++    P   R++ S+
Sbjct: 157 GIMITASHNPKMDNGYKVYYSNGCQII---PPHDQRISQSI 194

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 52  APVGVMITASHNPPRDNGVKIVESDGSML 80
           A  G+MITASHNP  DNG K+  S+G  +
Sbjct: 161 ASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 55  GVMITASHNPPRDNGVKIVESDGSMLL 81
           GVMITASHNP  DNG K+  S+G  ++
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 52  APVGVMITASHNPPRDNGVKI 72
           A VGVMITASHNP  DNG K+
Sbjct: 151 ASVGVMITASHNPKMDNGYKV 171

>NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON} 
          Length = 657

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 259 FVKTNQRLPEGINADP--RNLYCSFDGDADRVVFYYVDDSLTFHLLDGDKISTL 310
            +K + RL + I  D   R +YC+F G  +      VDDS T ++LD D  S L
Sbjct: 583 LIKPDGRLNKWIQIDECQRRMYCAFIGGPEAAKPGAVDDSKTLYMLDKDGKSKL 636

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,857,795
Number of extensions: 2222037
Number of successful extensions: 5373
Number of sequences better than 10.0: 42
Number of HSP's gapped: 5359
Number of HSP's successfully gapped: 42
Length of query: 540
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 426
Effective length of database: 40,409,475
Effective search space: 17214436350
Effective search space used: 17214436350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)