Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B03575g6.9ON41941921120.0
ZYRO0F00462g6.9ON39339512991e-178
NCAS0F001906.9ON41141112691e-174
Kpol_1045.786.9ON39240012631e-173
NDAI0K029006.9ON43842412651e-173
TDEL0G046206.9ON39240112461e-170
TPHA0M001906.9ON39139912291e-168
KNAG0E009806.9ON41441911871e-161
YEL056W (HAT2)6.9ON40139911451e-155
Ecym_30126.9ON39738411421e-154
Smik_5.316.9ON42740611351e-153
Skud_5.336.9ON40139911261e-152
Suva_5.126.9ON40139911251e-152
SAKL0E00814g6.9ON39840111121e-150
ACR017W6.9ON42337710641e-142
KLTH0C11550g6.9ON39838710541e-141
KLLA0D00814g6.9ON40840410441e-139
TBLA0A071206.9ON40741210261e-137
Kwal_56.223456.9ON39638610141e-135
KAFR0L003206.9ON39138810041e-134
ZYRO0A13068g8.548ON3974083817e-41
NDAI0C055108.548ON4194253756e-40
Kwal_27.120708.548ON4184323642e-38
Kpol_1024.398.548ON4174223643e-38
Ecym_70428.548ON4144213615e-38
AEL250C8.548ON4174273546e-37
SAKL0H09900g8.548ON4254303546e-37
KLTH0E12694g8.548ON4184263476e-36
Skud_2.3218.548ON4224443442e-35
YBR195C (MSI1)8.548ON4224293442e-35
TBLA0H036508.548ON4194173371e-34
Smik_2.3358.548ON4224303335e-34
KLLA0E23541g8.548ON4174063319e-34
CAGL0M05291g8.548ON4194193292e-33
KAFR0I008408.548ON4134273282e-33
Suva_4.4498.548ON4244353274e-33
KNAG0A036708.548ON4264273274e-33
NCAS0B021708.548ON4144313204e-32
TPHA0L017208.548ON4194113124e-31
TDEL0B029808.548ON4124082922e-28
TPHA0G026502.401ON5164001962e-15
Suva_13.3112.401ON5104001863e-14
Skud_13.2912.401ON5094011829e-14
ZYRO0F05808g7.310ON12822261802e-13
NCAS0F019702.401ON5114031783e-13
Kpol_1019.307.310ON12522091794e-13
TDEL0A004403.25ON4512681764e-13
KLLA0F05159g7.310ON12312161776e-13
Smik_14.143.25ON4662681756e-13
Suva_16.1598.672ON4512011747e-13
KLTH0E09394g2.401ON5224011731e-12
Suva_14.223.25ON4692681721e-12
Skud_14.223.25ON4672681721e-12
YMR131C (RRB1)2.401ON5113991722e-12
KNAG0E021802.401ON5174011712e-12
Kwal_47.178272.401ON5234361712e-12
YNL317W (PFS2)3.25ON4652681684e-12
TPHA0P014903.25ON4592681684e-12
KLTH0F19294g3.25ON4512681675e-12
NCAS0C044503.25ON4612701676e-12
TDEL0C023607.310ON12642231687e-12
KLLA0F17237g2.401ON5234441651e-11
Kwal_55.220673.25ON4512681641e-11
CAGL0M04081g3.25ON4552681632e-11
TDEL0A068906.276ON4472231632e-11
Kpol_1048.598.544ON8502391642e-11
Kpol_1041.202.401ON5153981632e-11
Kpol_1014.193.25ON4522681613e-11
KLTH0B03410g5.201ON4771791613e-11
Smik_4.457.310ON12702151634e-11
Kpol_1060.246.276ON4861991614e-11
NDAI0G038303.25ON5102741605e-11
ZYRO0C03124g3.25ON4452681596e-11
YNL035C2.283ON3892071587e-11
Smik_6.3488.672ON4512011561e-10
Skud_14.2982.283ON3892091551e-10
AEL269C7.534ON4552071552e-10
ZYRO0F07282g8.672ON4272041542e-10
KNAG0A012503.25ON4522681542e-10
ZYRO0G20152g2.431ON3192431522e-10
ADR242C2.401ON5214011542e-10
ADR090W7.310ON12332001553e-10
YPL151C (PRP46)8.672ON4512011533e-10
NCAS0G011206.276ON4941681533e-10
Smik_14.2962.283ON3891981524e-10
TPHA0I032407.534ON4772431524e-10
TDEL0A061808.672ON4342091515e-10
SAKL0H06666g8.672ON4412041507e-10
ZYRO0D17292g6.363ON7182301517e-10
Kwal_33.151365.201ON4731951507e-10
Skud_16.1318.672ON4512011508e-10
SAKL0C13266g3.25ON4592691499e-10
KLLA0F15598g5.201ON4781741491e-09
KAFR0L013207.310ON12402111501e-09
NCAS0F018502.431ON3182421452e-09
NCAS0A042702.431ON3182421452e-09
KAFR0E039005.429ON4392451462e-09
Smik_6.4516.276ON5231701472e-09
YPL247C6.276ON5232341472e-09
Ecym_80617.310ON12281871473e-09
TPHA0I018808.544ON10341791473e-09
KAFR0A005102.431ON3192481433e-09
CAGL0J08998g7.310ON12812131464e-09
KNAG0M017505.201ON4851741444e-09
SAKL0A02970g6.276ON4152541444e-09
ADL184W3.25ON4492711444e-09
ACR137W8.672ON4252041435e-09
KAFR0E012303.259ON3692241425e-09
TBLA0B087303.25ON4612741435e-09
KLLA0E08449g2.283ON4222081427e-09
AAL157C5.201ON4792401428e-09
TDEL0H003707.534ON4652191428e-09
KAFR0I028403.25ON4562681428e-09
Ecym_21396.276ON4352691418e-09
Suva_14.3112.283ON3892051419e-09
Kwal_56.244787.310ON12962081421e-08
Smik_12.525.201ON4891311411e-08
KLTH0G12430g8.316ON3672991401e-08
TBLA0C018408.672ON4232041401e-08
KAFR0F010606.276ON5531741411e-08
KAFR0H024508.672ON4172041401e-08
SAKL0A00660g6.363ON6603021401e-08
Ecym_25236.363ON6462821402e-08
TDEL0E042805.201ON4811781392e-08
TBLA0F021407.310ON13002241402e-08
KAFR0J009805.201ON4801721392e-08
TPHA0G016108.672ON4142481382e-08
TPHA0G023802.431ON3182451372e-08
SAKL0A03872g6.239ON8782121392e-08
ZYRO0E08184g6.276ON5061761382e-08
KLLA0F19734g8.288ON11331271392e-08
NCAS0F033405.429ON4481921373e-08
TPHA0E030805.201ON4881711383e-08
Suva_10.645.201ON4901311373e-08
Skud_16.4827.534ON4652091373e-08
NCAS0D027305.201ON4751741373e-08
CAGL0D05588g5.201ON4771291373e-08
NDAI0F012406.276ON5241651373e-08
KNAG0B028007.310ON13072291374e-08
AGL234W6.363ON6292821364e-08
NDAI0H027102.431ON3182421344e-08
Skud_12.565.201ON4891311364e-08
NDAI0H022402.469ON5142281355e-08
TDEL0C022407.322ON12012481375e-08
Kpol_2002.995.201ON4872421355e-08
YBR198C (TAF5)8.544ON7982271356e-08
KNAG0E023102.431ON3192481336e-08
Suva_16.606.276ON5261721356e-08
KLTH0H02772g6.276ON4202551346e-08
Suva_13.2952.431ON3192461337e-08
Skud_13.2752.431ON3192461337e-08
Smik_13.3052.431ON3192461337e-08
YMR116C (ASC1)2.431ON3192461337e-08
SAKL0G12892g5.201ON4761741347e-08
KLTH0H02134g7.310ON12992241358e-08
Skud_16.326.276ON5222181348e-08
YLL011W (SOF1)5.201ON4891831331e-07
Kpol_297.72.431ON3182451311e-07
Kpol_1013.377.534ON4681781331e-07
AEL246C8.544ON8152121341e-07
Kpol_2001.637.310ON12762131341e-07
KNAG0B027207.322ON12042471331e-07
YCR072C (RSA4)6.340ON5151711321e-07
KNAG0J016808.672ON3982061311e-07
NDAI0A020907.322ON12002471331e-07
TPHA0D035906.276ON5981791321e-07
KLLA0E07085g3.25ON4522681312e-07
Kwal_26.87768.672ON4332061302e-07
Smik_2.3388.544ON8002271322e-07
SAKL0F15972g7.534ON4702321302e-07
CAGL0I03718g7.322ON12012511322e-07
TBLA0B091002.431ON3172371292e-07
AFR199C2.431ON3342421292e-07
Ecym_20263.25ON4512741302e-07
TDEL0A020702.431ON3192391282e-07
NDAI0I021805.201ON4791121302e-07
KLTH0E15576g1.247ON7231941312e-07
CAGL0M02277g8.672ON4272071292e-07
Kpol_467.202.469ON5812131303e-07
Ecym_70388.544ON8002321303e-07
Suva_4.4528.544ON8002341303e-07
CAGL0G09845g7.534ON5002181293e-07
Ecym_55285.429ON4712151293e-07
KLTH0E12606g8.544ON7551551303e-07
Suva_4.997.322ON12012481303e-07
Skud_4.1097.322ON12012481303e-07
TPHA0J025406.239ON8662111303e-07
NCAS0D047806.363ON6212471293e-07
Ecym_60982.431ON3182391273e-07
KLLA0E04093g8.316ON3723041283e-07
Suva_4.537.310ON12712221304e-07
KAFR0A033801.247ON6661721284e-07
Ecym_71055.201ON4841631284e-07
YMR093W (UTP15)2.469ON5132111284e-07
SAKL0H09988g8.544ON7492111285e-07
KLLA0D16390g8.324ON9362671285e-07
TBLA0H036208.544ON8122471285e-07
KAFR0C047406.363ON6652301285e-07
Kpol_1072.178.672ON4331991275e-07
Kwal_27.120538.544ON7552351285e-07
SAKL0E07766g2.283ON3981261275e-07
TPHA0A031007.310ON12652491285e-07
Skud_2.3248.544ON8022271285e-07
KNAG0D007406.276ON5041641276e-07
KAFR0A069906.239ON8852171276e-07
CAGL0M05335g8.544ON8062561276e-07
ZYRO0D08206g6.340ON5152541266e-07
CAGL0H00781g6.276ON5131731266e-07
Kpol_1028.236.363ON7442861277e-07
KAFR0E031808.544ON8142461277e-07
KLLA0C08547g6.340ON5152571258e-07
SAKL0F10648g7.322ON12032481268e-07
TPHA0D045007.322ON12082521269e-07
Smik_13.2772.469ON5132051259e-07
AFL157C6.276ON4382111259e-07
Smik_3.1726.340ON5151711259e-07
AER263C6.340ON5133011259e-07
Suva_3.1096.340ON5151711259e-07
KNAG0E024702.469ON5092011251e-06
ZYRO0B10450g5.201ON4821381251e-06
ZYRO0D01122g7.534ON4662031241e-06
CAGL0A02772g5.429ON4411781241e-06
TBLA0B059202.283ON4031151231e-06
SAKL0E03960g2.431ON3202391221e-06
NCAS0B022008.544ON8222461242e-06
KLTH0F16192g5.429ON4621781232e-06
KLTH0C07634g3.259ON4251711232e-06
TBLA0C050107.356ON5721951232e-06
Kwal_27.126671.247ON7211921242e-06
TBLA0H020005.201ON4731121232e-06
AFL118W6.239ON8322091242e-06
KNAG0G024508.324ON9421401242e-06
AAR078W7.356ON5621971232e-06
Ecym_42498.316ON3743031212e-06
KNAG0I028406.340ON5192571222e-06
Smik_7.1356.239ON8872111232e-06
SAKL0H15708g8.316ON3683011212e-06
KNAG0C014101.247ON6531711222e-06
Suva_7.1276.239ON8912111232e-06
SAKL0F10384g7.310ON12612241232e-06
Kpol_1028.416.340ON5122631222e-06
KLTH0D04466g2.431ON3192391202e-06
NDAI0E024008.672ON4342061212e-06
NDAI0A028807.310ON12892281232e-06
YGL137W (SEC27)6.239ON8892111222e-06
KNAG0F018406.239ON9112111223e-06
NCAS0G038702.283ON3891351203e-06
ADL186C3.22ON13611971223e-06
KLTH0A06754g6.340ON5142571213e-06
SAKL0H16390g8.288ON11401281223e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03575g
         (419 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   818   0.0  
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   504   e-178
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   493   e-174
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   491   e-173
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     491   e-173
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   484   e-170
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   478   e-168
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   461   e-161
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   445   e-155
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   444   e-154
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   441   e-153
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   438   e-152
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   437   e-152
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   432   e-150
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   414   e-142
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   410   e-141
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   406   e-139
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   399   e-137
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   395   e-135
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   391   e-134
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   151   7e-41
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   149   6e-40
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   144   2e-38
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   144   3e-38
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   143   5e-38
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   140   6e-37
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   140   6e-37
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   138   6e-36
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   137   2e-35
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   137   2e-35
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   134   1e-34
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   132   5e-34
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   132   9e-34
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   131   2e-33
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   130   2e-33
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   130   4e-33
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   130   4e-33
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   127   4e-32
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   124   4e-31
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   117   2e-28
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    80   2e-15
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    76   3e-14
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    75   9e-14
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    74   2e-13
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    73   3e-13
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    74   4e-13
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    72   4e-13
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    73   6e-13
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    72   6e-13
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    72   7e-13
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    71   1e-12
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    71   1e-12
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    71   1e-12
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    71   2e-12
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    70   2e-12
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    70   2e-12
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    69   4e-12
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    69   4e-12
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    69   5e-12
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      69   6e-12
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    69   7e-12
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    68   1e-11
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    68   1e-11
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    67   2e-11
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    67   2e-11
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    68   2e-11
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    67   2e-11
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    67   3e-11
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    67   3e-11
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    67   4e-11
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    67   4e-11
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      66   5e-11
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    66   6e-11
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    65   7e-11
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    65   1e-10
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    64   1e-10
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    64   2e-10
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    64   2e-10
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    64   2e-10
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    63   2e-10
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    64   2e-10
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    64   3e-10
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    64   3e-10
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    64   3e-10
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    63   4e-10
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    63   4e-10
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    63   5e-10
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    62   7e-10
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    63   7e-10
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    62   7e-10
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    62   8e-10
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    62   9e-10
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    62   1e-09
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    62   1e-09
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    60   2e-09
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    60   2e-09
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    61   2e-09
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    61   2e-09
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    61   2e-09
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    61   3e-09
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    61   3e-09
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    60   3e-09
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    61   4e-09
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    60   4e-09
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    60   4e-09
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    60   4e-09
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    60   5e-09
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    59   5e-09
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    60   5e-09
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    59   7e-09
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    59   8e-09
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    59   8e-09
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    59   8e-09
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    59   8e-09
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    59   9e-09
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    59   1e-08
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    59   1e-08
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    59   1e-08
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    59   1e-08
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    59   1e-08
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    59   1e-08
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    59   1e-08
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    59   2e-08
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    58   2e-08
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    59   2e-08
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    58   2e-08
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    58   2e-08
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    57   2e-08
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    58   2e-08
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    58   2e-08
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    58   2e-08
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    57   3e-08
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    58   3e-08
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    57   3e-08
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    57   3e-08
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     57   3e-08
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    57   3e-08
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    57   3e-08
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    57   4e-08
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    57   4e-08
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    56   4e-08
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    57   4e-08
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    57   5e-08
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    57   5e-08
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    57   5e-08
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    57   6e-08
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    56   6e-08
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    57   6e-08
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    56   6e-08
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    56   7e-08
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    56   7e-08
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    56   7e-08
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    56   7e-08
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    56   7e-08
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    57   8e-08
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    56   8e-08
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    56   1e-07
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    55   1e-07
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    56   1e-07
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    56   1e-07
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    56   1e-07
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    56   1e-07
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    55   1e-07
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    55   1e-07
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    56   1e-07
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    55   1e-07
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    55   2e-07
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    55   2e-07
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    55   2e-07
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    55   2e-07
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    55   2e-07
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    54   2e-07
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    54   2e-07
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    55   2e-07
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    54   2e-07
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    55   2e-07
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    55   2e-07
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    54   2e-07
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    55   3e-07
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    55   3e-07
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    55   3e-07
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    54   3e-07
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    54   3e-07
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    55   3e-07
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    55   3e-07
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    55   3e-07
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    55   3e-07
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     54   3e-07
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    54   3e-07
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    54   3e-07
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    55   4e-07
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    54   4e-07
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    54   4e-07
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    54   4e-07
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    54   5e-07
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    54   5e-07
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    54   5e-07
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    54   5e-07
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    54   5e-07
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    54   5e-07
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    54   5e-07
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    54   5e-07
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    54   5e-07
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    54   6e-07
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    54   6e-07
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    54   6e-07
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    53   6e-07
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    53   6e-07
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    54   7e-07
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    54   7e-07
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    53   8e-07
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    53   8e-07
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    53   9e-07
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    53   9e-07
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    53   9e-07
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    53   9e-07
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    53   9e-07
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    53   9e-07
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    53   1e-06
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    53   1e-06
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    52   1e-06
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    52   1e-06
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    52   1e-06
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    52   1e-06
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    52   2e-06
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    52   2e-06
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    52   2e-06
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    52   2e-06
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    52   2e-06
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    52   2e-06
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    52   2e-06
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    52   2e-06
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    52   2e-06
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    51   2e-06
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    52   2e-06
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    52   2e-06
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    51   2e-06
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    52   2e-06
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    52   2e-06
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    52   2e-06
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    52   2e-06
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    51   2e-06
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     51   2e-06
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    52   2e-06
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    52   2e-06
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    52   3e-06
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     51   3e-06
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    52   3e-06
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    51   3e-06
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    52   3e-06
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    52   3e-06
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    51   3e-06
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    51   3e-06
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    51   3e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    51   3e-06
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    51   3e-06
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    51   3e-06
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             51   4e-06
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    51   4e-06
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    50   4e-06
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    51   5e-06
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    51   5e-06
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    51   5e-06
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    51   5e-06
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    50   5e-06
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    51   5e-06
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    50   5e-06
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    50   5e-06
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    50   6e-06
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    50   6e-06
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    50   6e-06
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    50   6e-06
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    50   6e-06
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    50   7e-06
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    49   7e-06
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    50   7e-06
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    50   7e-06
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    50   7e-06
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    49   8e-06
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    50   8e-06
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    50   9e-06
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    50   9e-06
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    49   9e-06
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    50   1e-05
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    50   1e-05
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    49   1e-05
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    50   1e-05
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    49   1e-05
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    50   1e-05
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    49   1e-05
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    50   1e-05
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    49   1e-05
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    49   1e-05
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    49   1e-05
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    49   1e-05
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    49   1e-05
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    49   1e-05
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    49   1e-05
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    49   2e-05
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    49   2e-05
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    49   2e-05
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    49   2e-05
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    49   2e-05
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    49   2e-05
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    49   2e-05
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    49   2e-05
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    48   2e-05
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    49   2e-05
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    48   2e-05
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    49   2e-05
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    48   2e-05
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    48   2e-05
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     48   2e-05
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    48   3e-05
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    49   3e-05
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    48   3e-05
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    48   3e-05
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    47   3e-05
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    48   3e-05
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    49   3e-05
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    48   3e-05
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    48   3e-05
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    48   3e-05
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    48   3e-05
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    48   3e-05
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    48   4e-05
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    48   4e-05
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    48   4e-05
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    48   4e-05
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    48   4e-05
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    47   4e-05
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    48   4e-05
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    47   4e-05
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    47   4e-05
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    47   4e-05
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    47   5e-05
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    47   5e-05
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    47   5e-05
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    47   5e-05
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    47   5e-05
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    48   5e-05
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    47   5e-05
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    47   5e-05
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    47   6e-05
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    47   6e-05
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    47   6e-05
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    47   7e-05
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    47   7e-05
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    47   7e-05
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    47   8e-05
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    47   8e-05
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    47   8e-05
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    47   8e-05
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    46   9e-05
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    47   9e-05
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    47   9e-05
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    47   9e-05
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    46   9e-05
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    46   1e-04
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    47   1e-04
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    47   1e-04
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    46   1e-04
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    47   1e-04
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    46   1e-04
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    46   1e-04
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    46   1e-04
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    46   1e-04
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    46   1e-04
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     46   1e-04
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    46   1e-04
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    46   1e-04
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    46   1e-04
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    46   1e-04
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    46   1e-04
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    46   1e-04
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    46   1e-04
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    46   1e-04
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    46   1e-04
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    46   1e-04
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    46   1e-04
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    46   1e-04
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    46   2e-04
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    46   2e-04
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    46   2e-04
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    45   2e-04
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    46   2e-04
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    46   2e-04
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    46   2e-04
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               45   2e-04
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    45   2e-04
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    46   2e-04
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    46   2e-04
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    45   2e-04
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    45   2e-04
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    45   2e-04
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    45   2e-04
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    45   2e-04
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    45   2e-04
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    45   2e-04
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    45   2e-04
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    45   2e-04
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    45   2e-04
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    45   2e-04
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    45   2e-04
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    45   2e-04
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    45   2e-04
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    45   2e-04
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    45   2e-04
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    45   2e-04
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    45   2e-04
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    45   3e-04
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    45   3e-04
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    45   3e-04
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    45   3e-04
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    45   3e-04
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    45   3e-04
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    45   3e-04
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    45   3e-04
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    45   3e-04
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    45   3e-04
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    45   3e-04
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    45   3e-04
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    45   3e-04
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    45   3e-04
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    45   4e-04
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    45   4e-04
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    45   4e-04
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    44   4e-04
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              45   4e-04
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    44   4e-04
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       44   4e-04
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    45   4e-04
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    44   4e-04
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    44   4e-04
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    44   5e-04
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    44   5e-04
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    44   5e-04
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    44   5e-04
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    44   5e-04
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    44   5e-04
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    44   5e-04
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    44   5e-04
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    44   5e-04
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    44   5e-04
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    44   5e-04
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    44   5e-04
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    44   5e-04
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    44   6e-04
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    44   6e-04
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    43   6e-04
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    44   6e-04
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    44   6e-04
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    44   6e-04
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    44   6e-04
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    44   7e-04
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    44   7e-04
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    44   7e-04
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    43   7e-04
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    44   7e-04
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    44   7e-04
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    42   7e-04
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    44   7e-04
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    44   7e-04
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    44   7e-04
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    43   7e-04
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    44   7e-04
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    44   8e-04
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    44   8e-04
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    44   8e-04
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    44   8e-04
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    44   8e-04
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    44   8e-04
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    44   8e-04
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    44   8e-04
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    44   9e-04
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    44   9e-04
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    43   9e-04
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    44   0.001
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    43   0.001
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    43   0.001
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    44   0.001
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    43   0.001
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    43   0.001
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    43   0.001
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    43   0.001
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    43   0.001
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    43   0.001
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    43   0.001
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    43   0.001
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    43   0.001
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    43   0.001
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    43   0.001
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    43   0.001
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    43   0.001
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    43   0.001
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    43   0.001
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    43   0.001
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    43   0.001
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    43   0.001
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    43   0.001
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    43   0.001
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    43   0.001
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    43   0.001
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    42   0.002
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    43   0.002
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    42   0.002
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    43   0.002
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    43   0.002
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    42   0.002
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    42   0.002
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    43   0.002
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    42   0.002
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               42   0.002
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    42   0.002
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    42   0.002
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    42   0.002
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    42   0.002
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    42   0.002
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    42   0.002
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    42   0.002
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      42   0.002
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    42   0.002
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    42   0.002
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    42   0.002
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    42   0.002
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    42   0.002
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    42   0.002
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       42   0.002
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    42   0.003
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    42   0.003
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    42   0.003
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    42   0.003
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    42   0.003
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    42   0.003
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    42   0.003
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    42   0.003
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    42   0.003
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    42   0.003
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    41   0.003
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    41   0.003
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    42   0.003
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    42   0.003
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    42   0.004
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    42   0.004
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    42   0.004
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    42   0.004
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    41   0.004
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    41   0.004
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    42   0.004
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    42   0.004
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    41   0.004
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    41   0.004
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    41   0.004
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    41   0.005
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     41   0.005
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    41   0.005
TBLA0C01740 Chr3 (409315..410889) [1575 bp, 524 aa] {ON} Anc_8.6...    41   0.005
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    41   0.005
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    41   0.005
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    41   0.005
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    41   0.005
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    41   0.005
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    41   0.005
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    41   0.005
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    41   0.005
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    40   0.006
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               41   0.006
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    40   0.006
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    41   0.006
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    40   0.006
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    40   0.006
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               40   0.006
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    40   0.007
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    41   0.007
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    40   0.007
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    40   0.007
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    41   0.007
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    40   0.007
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    40   0.007
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    40   0.007
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    40   0.007
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    40   0.007
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    40   0.008
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     40   0.008
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    40   0.009
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    40   0.009
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    40   0.009
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    40   0.009
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    40   0.010
KLTH0F16830g Chr6 complement(1361983..1364532) [2550 bp, 849 aa]...    40   0.010
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      40   0.011
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    40   0.011
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    40   0.011
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    40   0.011
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               40   0.011
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    40   0.012
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    40   0.012
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    39   0.012
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    40   0.012
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    40   0.012
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    40   0.013
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    39   0.013
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    40   0.013
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    39   0.014
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    40   0.014
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    39   0.014
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    40   0.014
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    39   0.014
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    39   0.015
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      39   0.015
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    39   0.016
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    39   0.016
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    39   0.017
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    39   0.017
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    39   0.017
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    39   0.017
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    39   0.017
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    39   0.018
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    39   0.019
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    39   0.019
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    39   0.020
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    39   0.020
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    39   0.021
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    39   0.021
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    39   0.022
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    39   0.023
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    39   0.024
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    39   0.024
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    39   0.024
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    39   0.024
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    39   0.025
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    39   0.026
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    39   0.027
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    39   0.027
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    38   0.028
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    39   0.029
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    39   0.029
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    39   0.029
CAGL0K11638g Chr11 complement(1124172..1125950) [1779 bp, 592 aa...    39   0.029
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    39   0.030
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    38   0.030
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    39   0.030
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    39   0.031
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    39   0.032
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    39   0.032
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               38   0.032
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    38   0.033
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    39   0.033
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    38   0.033
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    39   0.033
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    38   0.035
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    39   0.035
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    38   0.035
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    38   0.036
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    38   0.036
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    38   0.037
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    38   0.038
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    38   0.038
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    38   0.039
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    38   0.040
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    38   0.041
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    38   0.041
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    38   0.041
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     38   0.042
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    38   0.043
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    38   0.043
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    38   0.043
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    38   0.044
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    38   0.044
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    38   0.044
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    38   0.045
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    38   0.047
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    38   0.047
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    38   0.048
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    38   0.049
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    38   0.049
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    38   0.050
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    38   0.050
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    38   0.051
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    38   0.051
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    37   0.053
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    38   0.053
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    38   0.053
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    38   0.054
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    37   0.056
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    38   0.056
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    37   0.057
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    38   0.057
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    37   0.061
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    37   0.063
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    37   0.064
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    38   0.064
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    37   0.065
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    37   0.068
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    37   0.068
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    37   0.069
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    37   0.069
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    37   0.070
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    37   0.071
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    37   0.071
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    37   0.072
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    37   0.072
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    37   0.073
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    37   0.075
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    37   0.077
Suva_5.245 Chr5 complement(382909..384657) [1749 bp, 582 aa] {ON...    37   0.080
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    37   0.081
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               37   0.082
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    37   0.082
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    37   0.082
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    37   0.084
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    37   0.084
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    37   0.085
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    37   0.085
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    37   0.086
CAGL0L06578g Chr12 complement(741735..742333,742449..743709) [18...    37   0.087
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    37   0.088
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    37   0.089
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    37   0.092
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    37   0.095
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    37   0.097
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    37   0.098
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    37   0.098
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    37   0.098
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    37   0.10 
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    36   0.10 
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    37   0.11 
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    37   0.11 
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    37   0.11 
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    37   0.11 
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    37   0.11 
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    37   0.11 
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    37   0.11 
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    37   0.12 
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    37   0.12 
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    36   0.13 
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    37   0.13 
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    37   0.13 
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    36   0.13 
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    36   0.13 
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    36   0.13 
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    36   0.13 
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    36   0.13 
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    36   0.14 
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    36   0.14 
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    36   0.14 
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    36   0.14 
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    37   0.14 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    36   0.15 
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    37   0.15 
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    36   0.15 
ZYRO0F03256g Chr6 (274828..276807) [1980 bp, 659 aa] {ON} simila...    36   0.15 
Kpol_1050.56 s1050 (126134..127528,127531..127563,127565..128245...    36   0.16 
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    36   0.17 
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    36   0.17 
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    36   0.17 
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     36   0.17 
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    36   0.17 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    36   0.17 
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    36   0.17 
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    36   0.18 
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    36   0.18 
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    36   0.18 
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    36   0.18 
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    36   0.19 
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    36   0.19 
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    36   0.19 
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    36   0.19 
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    36   0.19 
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    35   0.19 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    36   0.19 
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    36   0.20 
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    36   0.20 
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    36   0.21 
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    36   0.21 
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    36   0.21 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    36   0.22 
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    36   0.22 
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    35   0.22 
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    36   0.23 
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    35   0.23 
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    35   0.23 
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    35   0.24 
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    35   0.24 
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    36   0.24 
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    35   0.24 
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    35   0.24 
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    36   0.24 
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    35   0.24 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    36   0.25 
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    35   0.26 
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    35   0.27 
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    35   0.27 
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    35   0.27 
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    35   0.27 
Skud_15.203 Chr15 complement(362659..365292) [2634 bp, 877 aa] {...    35   0.28 
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    35   0.29 
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    35   0.29 
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    35   0.30 
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    35   0.30 
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    35   0.31 
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    35   0.31 
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    35   0.32 
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    35   0.32 
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    35   0.33 
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    35   0.33 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    35   0.33 
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    35   0.34 
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    35   0.34 
KLTH0C01848g Chr3 complement(165526..166121,166518..167517) [159...    35   0.34 
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    35   0.34 
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    35   0.35 
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    35   0.35 
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    35   0.36 
Kwal_34.15917 s34 complement(113361..114713) [1353 bp, 450 aa] {...    35   0.36 
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    35   0.36 
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    35   0.36 
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    35   0.37 
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    35   0.37 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    35   0.38 
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    35   0.38 
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    35   0.38 
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    35   0.39 
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    35   0.39 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    35   0.39 
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    35   0.40 
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    35   0.41 
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    35   0.43 
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    35   0.43 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    35   0.44 
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    35   0.45 
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    35   0.45 
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    34   0.46 
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    35   0.46 
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    35   0.47 
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    35   0.47 
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    34   0.47 
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    35   0.48 
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    35   0.48 
Suva_8.91 Chr8 complement(165427..168063) [2637 bp, 878 aa] {ON}...    35   0.49 
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    35   0.49 
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    34   0.49 
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    35   0.49 
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    35   0.50 
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    35   0.51 
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    35   0.52 
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    34   0.54 
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    34   0.54 
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    34   0.55 
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    34   0.56 
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    34   0.56 
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    34   0.56 
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    34   0.58 
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    35   0.59 
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    34   0.61 
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    34   0.61 
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    34   0.61 
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    34   0.62 
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    34   0.63 
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    34   0.65 
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    34   0.65 
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    34   0.68 
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    34   0.68 
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    34   0.69 
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    34   0.71 
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    34   0.72 
TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908...    34   0.83 
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    33   0.83 
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    34   0.83 
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    33   0.84 
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    34   0.86 
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    33   0.86 
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    34   0.86 
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    34   0.90 
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    34   0.92 
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    33   0.96 
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    33   0.98 
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    33   0.99 
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    33   1.0  
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    34   1.0  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    33   1.0  
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    33   1.1  
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    33   1.1  
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    33   1.1  
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    33   1.2  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    33   1.2  
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    33   1.2  
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    33   1.2  
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    33   1.2  
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             33   1.2  
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    33   1.2  
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    33   1.2  
Suva_16.171 Chr16 complement(299070..300455) [1386 bp, 461 aa] {...    33   1.2  
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    33   1.2  
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    33   1.2  
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    33   1.3  
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    33   1.3  
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    33   1.3  
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    33   1.3  
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    33   1.3  
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    33   1.3  
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    33   1.4  
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    33   1.4  
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    33   1.4  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    33   1.4  
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    33   1.5  
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    33   1.5  
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    33   1.5  
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    33   1.5  
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    33   1.5  
Smik_15.217 Chr15 complement(368813..371440) [2628 bp, 875 aa] {...    33   1.5  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    33   1.5  
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    33   1.6  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    33   1.6  
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    33   1.7  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    33   1.7  
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    33   1.7  
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    33   1.7  
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    33   1.8  
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    33   1.8  
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    33   1.9  
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    33   1.9  
Ecym_5498 Chr5 (1016519..1019092) [2574 bp, 857 aa] {ON} similar...    33   2.1  
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    32   2.1  
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    33   2.1  
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    32   2.1  
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    33   2.1  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    33   2.1  
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    32   2.2  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    33   2.2  
ACR088W Chr3 (515561..518113) [2553 bp, 850 aa] {ON} Syntenic ho...    33   2.3  
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    32   2.3  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    32   2.4  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    32   2.4  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    32   2.5  
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    32   2.5  
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    32   2.5  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    32   2.5  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    32   2.6  
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    32   2.6  
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    32   2.6  
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    32   2.6  
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    32   2.7  
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    32   2.7  
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    32   2.7  
Suva_8.79 Chr8 (141412..142443) [1032 bp, 343 aa] {ON} YOR026W (...    32   2.8  
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    32   2.8  
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    32   2.9  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    32   2.9  
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    32   3.0  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    32   3.0  
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    32   3.0  
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    32   3.0  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    32   3.2  
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    32   3.3  
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    32   3.4  
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    32   3.5  
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    32   3.6  
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    32   3.6  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    32   3.7  
NDAI0B04880 Chr2 complement(1193217..1195928) [2712 bp, 903 aa] ...    32   3.9  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    32   3.9  
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    32   3.9  
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    32   4.0  
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    32   4.0  
Smik_5.269 Chr5 complement(416222..417940) [1719 bp, 572 aa] {ON...    32   4.1  
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    32   4.2  
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    32   4.3  
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    32   4.4  
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    32   4.4  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    32   4.4  
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    32   4.4  
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    32   4.5  
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    32   4.5  
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    31   4.6  
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    32   4.6  
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     32   4.6  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    31   4.8  
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    32   4.8  
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    32   4.8  
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    32   4.9  
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    32   4.9  
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    32   5.0  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    31   5.1  
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    31   5.1  
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    31   5.3  
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    31   5.3  
KLLA0E21847g Chr5 complement(1948687..1951230) [2544 bp, 847 aa]...    31   5.3  
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    31   5.4  
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    31   5.4  
SAKL0F13596g Chr6 (1082310..1085321) [3012 bp, 1003 aa] {ON} hig...    31   5.5  
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    31   5.9  
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    31   5.9  
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    31   6.0  
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    31   6.3  
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    31   6.3  
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    31   6.4  
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    31   6.4  
Kwal_56.24577 s56 complement(1061240..1062766) [1527 bp, 508 aa]...    31   6.4  
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    31   6.4  
YER124C Chr5 complement(407342..409063) [1722 bp, 573 aa] {ON}  ...    31   6.5  
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    31   6.5  
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    31   6.6  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    31   6.7  
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    31   6.8  
TBLA0G03390 Chr7 complement(900177..902099) [1923 bp, 640 aa] {O...    31   6.9  
CAGL0J10340g Chr10 complement(1010761..1011777) [1017 bp, 338 aa...    31   6.9  
KLTH0H11286g Chr8 complement(965578..967500) [1923 bp, 640 aa] {...    31   7.1  
NCAS0E03000 Chr5 (595862..598918) [3057 bp, 1018 aa] {ON} Anc_7....    31   7.3  
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    31   7.3  
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    31   7.5  
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    30   7.7  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    30   7.9  
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    31   8.0  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    31   8.1  
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    31   8.2  
NDAI0E00410 Chr5 (72769..74559) [1791 bp, 596 aa] {ON} Anc_8.817...    31   8.3  
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    30   8.4  
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    30   8.8  
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    31   8.9  
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    30   9.2  
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    30   9.2  
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    31   9.3  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    30   9.4  
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    30   9.4  
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    30   9.5  
KAFR0G01280 Chr7 (286915..288597) [1683 bp, 560 aa] {ON} Anc_3.9...    30   9.9  

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/419 (97%), Positives = 409/419 (97%)

Query: 1   MSVQLDPSALQKMAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTV 60
           MSVQLDPSALQKMAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTV
Sbjct: 1   MSVQLDPSALQKMAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTV 60

Query: 61  EWLPQKNLVAARTRQQLILGTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMV 120
           EWLPQKNLVAARTRQQLILGTHTSGEEQNYLKIGAVDLPVEVTENSKK          MV
Sbjct: 61  EWLPQKNLVAARTRQQLILGTHTSGEEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMV 120

Query: 121 LSNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTE 180
           LSNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTE
Sbjct: 121 LSNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTE 180

Query: 181 NGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEA 240
           NGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEA
Sbjct: 181 NGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEA 240

Query: 241 HIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIR 300
           HIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIR
Sbjct: 241 HIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIR 300

Query: 301 DVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPP 360
           DVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPP
Sbjct: 301 DVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPP 360

Query: 361 EVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419
           EVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD
Sbjct: 361 EVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  504 bits (1299), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 239/395 (60%), Positives = 306/395 (77%), Gaps = 11/395 (2%)

Query: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSG 85
           +P+++DEEY+LWKSNVP++YDFVSET LTWP+LT+EWLP      +  RQ++ILGTHTS 
Sbjct: 9   KPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSR---SSNRQEMILGTHTSD 65

Query: 86  EEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARYMPQD 145
           EEQNYLKI A+ LP EV  +++           ++ SNVKI+KKF H+ E+TRARYMPQD
Sbjct: 66  EEQNYLKIAAIYLPDEVVPDAEPKEEEE-----VLKSNVKIIKKFEHENEVTRARYMPQD 120

Query: 146 DNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIA 205
           DN+IATI+G G I++Y+R+      LLST ++H ENGYGL+FN NEK  LLSGSDDSNI 
Sbjct: 121 DNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV 180

Query: 206 LWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR-SSQIIH 264
           LWD++   K+ +P +TF D H+DI+ND KWH+ + +IFGSVSEDST++L D+R     + 
Sbjct: 181 LWDVTG--KSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVE 238

Query: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324
            +  KKPYNTLAFS  S+NLFAAAGTD++VYLYD R  S PL+ M GHEDAVT++EF P 
Sbjct: 239 KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ 298

Query: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINW 384
            DG+L S+GSDRRTI+WDL EIGAEQ  D+ +DG PEV+MIHAGH++SIND ++NPNI W
Sbjct: 299 EDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPW 358

Query: 385 LVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419
           L A+AEE+NIVQ+WK SS +PRIGG P VD  +L+
Sbjct: 359 LTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  493 bits (1269), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 230/411 (55%), Positives = 305/411 (74%), Gaps = 5/411 (1%)

Query: 10  LQKMAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLV 69
           ++KMA V    E+  N+ +++DEEYELW+SNVP++YDFVSETRLTWP+L++EWLPQ+   
Sbjct: 5   MEKMAAVQGE-EEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSA 63

Query: 70  AARTRQQLILGTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKK 129
            A  RQ+LI+GTHTSGEE NYLKI A+DLP ++  +++K             SN+KI+KK
Sbjct: 64  QAPNRQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETT-TKSNIKIIKK 122

Query: 130 FPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNA 189
           F H+ EITRARYMPQ+ N++ATING GK+F+YDRSK+    L+ST EYH ENGYGL+FN 
Sbjct: 123 FKHEEEITRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNC 182

Query: 190 NEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED 249
           N+   LLSGSDD  IALW+++N   N  P   +   H+DI+ND KW + + ++FGSVSED
Sbjct: 183 NDAGKLLSGSDDGTIALWNVNN--SNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED 240

Query: 250 STMKLFDKRSSQII-HNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYA 308
           ST++L D+R             P+NTLAFS  S  LFAAAGTD+ VYL+D RD+S PL++
Sbjct: 241 STLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300

Query: 309 MTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAG 368
           M GH+ AVT +EF P+ DGIL +SG DRR I+WD+ +IG EQ  D+ EDG PEVLMIHAG
Sbjct: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAG 360

Query: 369 HKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419
           H+++IND ++NPNI WL+AS+EE+NI+Q+WKCS  +PR+GG P V +S L+
Sbjct: 361 HRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  491 bits (1263), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 234/400 (58%), Positives = 294/400 (73%), Gaps = 12/400 (3%)

Query: 20  AEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL 79
           A+++  EP+TVD+EYELWK+NVP++YDFVSETRLTWP+LT +WLP        TRQ +IL
Sbjct: 3   AQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSE---EDTRQYMIL 59

Query: 80  GTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRA 139
           GTHTSGEE +YLK+ A+DLP EV                   SN+KIVKKF HDGEI RA
Sbjct: 60  GTHTSGEEVDYLKVAALDLPDEVVTGEANDDNRRTK------SNIKIVKKFEHDGEINRA 113

Query: 140 RYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGS 199
           RYMP+D NIIATINGEG + IYDRSK+  + L +TL+YH ENGYGL+FN N    L+SGS
Sbjct: 114 RYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGS 173

Query: 200 DDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS 259
           DD  IALWDI +  K+  P   +++ H+DI+ND  WH  + ++FGSVSEDST+KL DKRS
Sbjct: 174 DDFTIALWDIDSGSKS--PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS 231

Query: 260 -SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTA 318
            S++I+ I  K  +NTLAFS  S+NLFAAAG D  +YLYD R  + PL+ M GHEDA+T 
Sbjct: 232 TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITC 291

Query: 319 IEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAV 378
           ++F P  DGIL S G+DRR I+WDL EIGAEQ  DE +DG PE+LMIHAGH+++IND  +
Sbjct: 292 LQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTL 351

Query: 379 NPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418
           +P I WL AS EEDN+VQ+WKCS N+ R+GG PE+D  +L
Sbjct: 352 HPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  491 bits (1265), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 239/424 (56%), Positives = 310/424 (73%), Gaps = 10/424 (2%)

Query: 6   DPSALQKMAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ 65
           DPS L ++           N+ +T+DEEY+LWKSNVP++YDFVSET+LTWPTLTVEWLP 
Sbjct: 15  DPSMLAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPS 74

Query: 66  KNL-VAARTRQQLILGTHTSGEEQNYLKIGAVDLPVEVTENS-------KKXXXXXXXXX 117
            +       RQ+LILGTHTSGEE NYLKI A+DLP EV + S       ++         
Sbjct: 75  SHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQK 134

Query: 118 XMVLSNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEY 177
               SN+KIVKKF H+ EITRAR+MPQ+ +IIATING G +FIY++S +   AL+STL +
Sbjct: 135 QKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRF 194

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDIS-NFEKNIKPTITFEDAHTDIINDVKWH 236
           H ENGYGL+FN N+K  LLSGSDD  IALWDI  N     KP   ++  H DI+ND KW+
Sbjct: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWN 254

Query: 237 SSEAHIFGSVSEDSTMKLFDKR-SSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVY 295
              +++F SVSEDST++L D+R  + II++I T  P+NTLAFS  S  L AAAGTD+LVY
Sbjct: 255 EFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVY 314

Query: 296 LYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355
           LYD R++S PLY+M GHED++T +EF P+ DG+L SSG+DRR I+WD+ +IGAEQ  D+ 
Sbjct: 315 LYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDA 374

Query: 356 EDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDL 415
           EDG PEV+MIHAGH++++ND ++NPNI WL+ASAEE+NI+Q+WKCS  +P +GG PEV +
Sbjct: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSV 434

Query: 416 SILD 419
           SIL+
Sbjct: 435 SILE 438

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  484 bits (1246), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 296/401 (73%), Gaps = 11/401 (2%)

Query: 20  AEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL 79
           AE+Q ++P+++DEEYELW+SNVP++YDFVSET LTWPTLT+EWLP     +   RQ+LIL
Sbjct: 2   AEEQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGN---SHSNRQELIL 58

Query: 80  GTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRA 139
           GTHTS EE NYLKI A+DLP E+    +              SN+KI+KKF H+ E+TRA
Sbjct: 59  GTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDG-----FTKSNIKIIKKFKHEQEVTRA 113

Query: 140 RYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGS 199
           RYMPQD N+IATING G +F+YDRSK+G E LLS+L +H +NGYGL+FN  +K  LLSGS
Sbjct: 114 RYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGS 173

Query: 200 DDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR- 258
           DDS IALWDI+    + KP  T+E  H D +ND KWH    + FGSVSED T++L D+R 
Sbjct: 174 DDSKIALWDITT--NSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRV 231

Query: 259 SSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTA 318
              +   I T   +NT+AFS  S+NLFAAAGTD+L+YLYD R   N L+ M+GHE  VT 
Sbjct: 232 KDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTN 291

Query: 319 IEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAV 378
           +EF    DGI+ SSG DRR I+WDL EIGAEQ  D+ +DG PEV+MIHAGH++ +ND ++
Sbjct: 292 LEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSM 351

Query: 379 NPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419
           NPNI WL+ASAEE+NIVQ+WKCSS +PR+GG P+VD S+L+
Sbjct: 352 NPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  478 bits (1229), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 299/399 (74%), Gaps = 13/399 (3%)

Query: 22  QQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGT 81
           +Q  EP+TVD+EY+LWKSNVP+LYDFVSETRLTWP+LT++WLP        TRQ LILGT
Sbjct: 5   EQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDK---TSTRQHLILGT 61

Query: 82  HTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARY 141
            TSG E +YLKI A+DLP E+    K           +V SN+K+VKKF HDGEI RARY
Sbjct: 62  LTSGAETDYLKIAALDLPDEIIIGKKSDK--------VVKSNLKVVKKFAHDGEINRARY 113

Query: 142 MPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDD 201
           MPQ+ NIIAT+NGEG IFIYD S++   ALLSTL+YH +N YGLAFN N +  L+SGSDD
Sbjct: 114 MPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDD 173

Query: 202 SNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS- 260
           S IALWD +N +K  +P   +  +H+DI+ND +WH    ++FGSVSEDST++LFDKR+  
Sbjct: 174 STIALWDATN-DKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGG 232

Query: 261 QIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIE 320
           +    I++K  YN++AFS FS NLFAAAGT N +YLYDIR+    L++MTGHE+ VT++E
Sbjct: 233 KSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLE 292

Query: 321 FDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNP 380
           F  + DGIL S  SDRR I+WDL EIGAEQ  DE +DG PEV+MIHAG +++INDI+ +P
Sbjct: 293 FSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHP 352

Query: 381 NINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419
           +I WL AS EE+NIVQ+WKCSS +PRI G PEV +S L+
Sbjct: 353 SIPWLNASVEENNIVQVWKCSSKLPRISGTPEVSISDLE 391

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 228/419 (54%), Positives = 300/419 (71%), Gaps = 16/419 (3%)

Query: 6   DPSALQKMAEVAAAAEQQ----SNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVE 61
           DP  L   A++     QQ     N P+   EEY+LWKSNVPM+YDFVSETRL WP+LTV+
Sbjct: 5   DPKLLAAAAQLTGIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQ 64

Query: 62  WLPQK--NLVAARTRQQLILGTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXM 119
           WLP    N V   TRQ+LILGTHTS EEQNYLKI  VDLP EVT+ S             
Sbjct: 65  WLPHSAPNPV---TRQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSN----LTESDEEQ 117

Query: 120 VLSNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHT 179
           V SN+++ +KF HD E+TRARYMPQD NI+ATI+G G ++IYDRS     A + TL+YHT
Sbjct: 118 VRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI-TLQYHT 176

Query: 180 ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSE 239
           +NGYGLAFN   K  LLSGSDDSN+ALWD+++ ++N +P   +E+ H+DI+ND +WH+ +
Sbjct: 177 DNGYGLAFNPLIKGHLLSGSDDSNVALWDVTS-DRN-EPVQKWENIHSDIVNDCQWHNFQ 234

Query: 240 AHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDI 299
             +FG+VSEDS++++ D R S+ +  IN  KP+NTL+FS  S NL A  G ++ VYLYD 
Sbjct: 235 KSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDR 294

Query: 300 RDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGP 359
           R V  PL+ M+GH DAVT+++F   +DGI+ S+G+D+R I+WD+ +IGAEQ  ++ ED  
Sbjct: 295 RYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDAT 354

Query: 360 PEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418
            EV+MIHAGH++ IND A+NP+I WLVASAEE+NIVQ+WKCS  +PRI G P V + +L
Sbjct: 355 SEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  445 bits (1145), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 213/399 (53%), Positives = 291/399 (72%), Gaps = 10/399 (2%)

Query: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ--KNLVAARTRQQLILGTHT 83
           +P++VDEEY+LWKSNVP++YDFVSETRLTWP+LTV+WLP   + L     +Q+LI+GTHT
Sbjct: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHT 65

Query: 84  SGEEQNYLKIGAVDLPVEVTEN---SKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRAR 140
           SGEE+NYLK   ++LP E+  N    ++             SN++I  K+ H+ EITRAR
Sbjct: 66  SGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRAR 125

Query: 141 YMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD 200
           YMPQD NI+ATING+G +F+Y RS    E L STL++H +NGY L+F+   K  LLSGSD
Sbjct: 126 YMPQDPNIVATINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFSTLVKGRLLSGSD 181

Query: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS 260
           D  +ALW++ +     KP  T+ D H+DIIND KWH+    +FG+VSEDS +K+ D R++
Sbjct: 182 DHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRAN 241

Query: 261 QI-IHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAI 319
              I  +   +P+NTLAFS  SSNL AAAG D+ VYLYD+R++  PL+ M+GHEDAV  +
Sbjct: 242 NTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNL 301

Query: 320 EFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVN 379
           EF  + DG++ SSGSD R ++WDL++IGAEQT D+ EDG PE++M+HAGH++S+ND  +N
Sbjct: 302 EFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLN 361

Query: 380 PNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418
           P I WLVASAEE+NI+Q+WKCS ++P +GG P+V+  I+
Sbjct: 362 PQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  444 bits (1142), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/384 (55%), Positives = 280/384 (72%), Gaps = 20/384 (5%)

Query: 27  PMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGE 86
           P+TVD+EYELWKSNV ++YDFVSET+LTWP+L+++WLP  +      +Q++ILGTHTSG+
Sbjct: 13  PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGD 72

Query: 87  EQNYLKIGAVDLPVEVT-----ENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARY 141
           E NYLKI A+DLP EV      +NS +           V S +K+ KKF H+ E+ RARY
Sbjct: 73  ENNYLKIAAIDLPYEVVGLPDEDNSSEP----------VKSMIKVTKKFEHEDEVIRARY 122

Query: 142 MPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDD 201
           MP++D IIATING+GKIFIYDRSK+  E L  TL YH +NGYGLAFN   +  LLS SDD
Sbjct: 123 MPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDD 182

Query: 202 SNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS-S 260
           + +ALWDI++ ++ +   +     HTDI+ND KWH  + +IFG+VSED T+++ DKRS S
Sbjct: 183 TTVALWDINSTDRPVSIVMN----HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLS 238

Query: 261 QIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIE 320
                +  +KP N LAFS  S NL AAAGTD  VYLYD+R +S PL+ M GH+DAVT+IE
Sbjct: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298

Query: 321 FDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNP 380
           F  + DGIL SSGSDRR  +WDL +IGAEQ Q++ +DG PE++M+HAGH+++IND + NP
Sbjct: 299 FSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP 358

Query: 381 NINWLVASAEEDNIVQIWKCSSNI 404
            + WL+ASAEEDN+VQ+WK S  +
Sbjct: 359 QVPWLIASAEEDNVVQVWKISKKL 382

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  441 bits (1135), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 210/406 (51%), Positives = 292/406 (71%), Gaps = 10/406 (2%)

Query: 19  AAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ--KNLVAARTRQQ 76
           AA +   + ++VDEEY+LWKSNVP++YDFVSETRLTWP+L+V+WLP   +       RQ+
Sbjct: 25  AAMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQE 84

Query: 77  LILGTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMV---LSNVKIVKKFPHD 133
           LI+GTHTSGEE+NYLK   +++P E+  N              +    SN++I  K+ H+
Sbjct: 85  LIIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHE 144

Query: 134 GEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKY 193
            EITRARYMPQ+ + +AT+NG+G +F+Y RS      L STL++H +NGY L+FNA  + 
Sbjct: 145 EEITRARYMPQNPDFVATLNGQGTVFLYSRSG----GLQSTLKFHKDNGYALSFNALVEG 200

Query: 194 SLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMK 253
            LLSGSDD  +ALW++ +   +I P  T+ D H+DI+ND+KWH+    +FG+VSEDS +K
Sbjct: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260

Query: 254 LFDKRSSQI-IHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH 312
           + D R+  I I  +   +P+NTLAFS  SSNL AAAG D+ VYLYD+R++  PL+ M+GH
Sbjct: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGH 320

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTS 372
           EDAVT IEF  + DG++ SSGSD R I+WDL++IGAEQT D+ EDG PE++M+HAGH++S
Sbjct: 321 EDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSS 380

Query: 373 INDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418
           +ND  +N  I WLVAS+EE+NI+Q+WKCS N+P +GG P+V+  I+
Sbjct: 381 VNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  438 bits (1126), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 207/399 (51%), Positives = 290/399 (72%), Gaps = 10/399 (2%)

Query: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ--KNLVAARTRQQLILGTHT 83
           +P++VDEEY+LWKSNVP++YDFVSETRLTWP+LTV+WLP   +       +Q+LI+GTHT
Sbjct: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHT 65

Query: 84  SGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMV---LSNVKIVKKFPHDGEITRAR 140
           SGEE+NYLK   ++LP EV  N              +    SN++I  K+ H+ EITRAR
Sbjct: 66  SGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRAR 125

Query: 141 YMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD 200
           YMPQD N++ATING+G +F+Y RS    + L STL++H +NGY L+F+   K  LLSGSD
Sbjct: 126 YMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHLLSGSD 181

Query: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS- 259
           D ++ALWD+S    +  P  T++D H+DI+ND KWH+    +FG+VSEDS +K+ D R+ 
Sbjct: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAE 241

Query: 260 SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAI 319
           +  I      +P+NTLAFS  SSN+ AAAG D+ VYLYD+R++  PL+ M+GHEDAVT +
Sbjct: 242 NTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNL 301

Query: 320 EFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVN 379
           EF P+ DG++ SSGSD R I+WDL++IGAEQT D+ EDG PE++M+HAGH++++ND  +N
Sbjct: 302 EFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLN 361

Query: 380 PNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418
             + WL+AS EE+NI+Q+WKCS ++P +GG P+++  I+
Sbjct: 362 AQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  437 bits (1125), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 210/399 (52%), Positives = 287/399 (71%), Gaps = 10/399 (2%)

Query: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ--KNLVAARTRQQLILGTHT 83
           +P++VDEEY+LWKSNVP++YDFVSETRLTWP+LTV+WLP   +       +Q+LI+GTHT
Sbjct: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHT 65

Query: 84  SGEEQNYLKIGAVDLPVEVTEN---SKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRAR 140
           SGEE+NYLK   ++LP E+  N    ++             SN+KI  K+ H+ EITRAR
Sbjct: 66  SGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRAR 125

Query: 141 YMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD 200
           YMPQ+   +ATING+G +FIY RS    E L STL++H ENGY L+F+   +  LLSGSD
Sbjct: 126 YMPQNPGTVATINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSPLVEGLLLSGSD 181

Query: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR-S 259
           D  +ALWD++    + +P  T+ D H+DI+ND KWH+    +FG+VSEDS +K+ D R  
Sbjct: 182 DHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVE 241

Query: 260 SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAI 319
           +         +P+NTLAFS  SSNL AAAGTD+ VYLYD+R++  PL+ M+GHEDAVT +
Sbjct: 242 NTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNL 301

Query: 320 EFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVN 379
           EF P+ DG++ SSGSD R I+WDL++IGAEQT D+ EDG PE++M+HAGHK+++ND  +N
Sbjct: 302 EFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLN 361

Query: 380 PNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418
             I WLVAS EE+NI+Q+WKCS ++P +GG P+V + ++
Sbjct: 362 AQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  432 bits (1112), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 203/401 (50%), Positives = 285/401 (71%), Gaps = 9/401 (2%)

Query: 22  QQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGT 81
           ++ N+ ++++EEYELWK+NVP++YDFVSET+LTWP+LT++WLP     ++ T+Q++ILGT
Sbjct: 4   EEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGN---SSSTKQEMILGT 60

Query: 82  HTSGEEQNYLKIGAVDLPVEVTE---NSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITR 138
           HTSGE+ NYLKI +++LP ++     +              V S +KI KK  H+ EITR
Sbjct: 61  HTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEITR 120

Query: 139 ARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSG 198
           AR+MPQD N IATING GK+F++DRSK+  EAL+S   +H +NGYGL+FN   K  LLS 
Sbjct: 121 ARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSC 180

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR 258
           SDD  IALW++     +    +T    H DI+ND  WH    ++FGSVSED T+++ DKR
Sbjct: 181 SDDGTIALWNVMGTNTSPSKAVT---THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKR 237

Query: 259 SSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTA 318
           ++  +H +    P+NTL FS  S NLFAAAGTD+LVYLYD+R+ ++ L+ M+GHED+VT+
Sbjct: 238 TNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTS 297

Query: 319 IEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAV 378
           +EF P+ DGIL SSGSDRR ++WDL +IG+EQ Q++  DG PE++M+HAGHK+++ND + 
Sbjct: 298 LEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSF 357

Query: 379 NPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419
           N NI WL+AS EEDNIV +WK S  +   G   + D+  L+
Sbjct: 358 NWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  414 bits (1064), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 197/377 (52%), Positives = 269/377 (71%), Gaps = 12/377 (3%)

Query: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSG 85
           + +TV+EEYELW SNVP++Y+FVSET+LTWP+LT++WLP          Q LI GTHT+G
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSD---GQSPEQSLIFGTHTAG 96

Query: 86  EEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARYMPQD 145
           EE NYLK+  ++LP  +    +              S+  I  KFPH  E+ RARYMP +
Sbjct: 97  EEVNYLKVATINLPAGIAGLDQGDEEDEANDH----SSFAIANKFPHIEEVIRARYMPAN 152

Query: 146 DNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIA 205
            NIIATING+G I I+DR+    +A +STL +H ENGYGLAFN +    LLSGSDD+ +A
Sbjct: 153 SNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVA 212

Query: 206 LWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS-QIIH 264
           LWDI   +K  K  +T   +H DI+NDVKWH  E+++FG+VSED T+++ DKR   + + 
Sbjct: 213 LWDIEAAKKP-KSILT---SHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVK 268

Query: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324
            + T  P+NTL+FS  S NL AAAG D+ +YLYD+RD+S+PL+ M+GH+D+VT +EF P+
Sbjct: 269 KLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPH 328

Query: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINW 384
            DGI+ SSGSDRR I+WDL +IGAEQ+QD+ +DG PE++M+HAGH++ +N+ + NP I W
Sbjct: 329 TDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPW 388

Query: 385 LVASAEEDNIVQIWKCS 401
           L+AS EEDN++Q WK S
Sbjct: 389 LLASTEEDNVIQAWKVS 405

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  410 bits (1054), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/387 (51%), Positives = 268/387 (69%), Gaps = 14/387 (3%)

Query: 28  MTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGEE 87
           ++VDEEY+LWKSNVP++YDFVSET+L WP+LT++WLP  +       Q+LILGTHTSG E
Sbjct: 10  VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSND---RSNEQELILGTHTSGTE 66

Query: 88  QNYLKIGAVDLPVEVTEN---SKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARYMPQ 144
           QNYLKI +V LP EV  +   S               S +KIV+KF H  E+TRARY P 
Sbjct: 67  QNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPF 126

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204
           + N+IATI+G GK+F+YDRSK+   AL +   +H ENGYGL F+      LLS SDD +I
Sbjct: 127 NPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSI 186

Query: 205 ALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIH 264
           A+WD+ + +      +  + +H +I+N+ KWH     +FGSVS+DST+ + DKR  + + 
Sbjct: 187 AIWDVCSGKNT---PVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243

Query: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324
            I   +PYNTLAFS  SSNLFAAAGTD+ V LYD+R    P+++M+GH D+VT++EF P+
Sbjct: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303

Query: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINW 384
            DGIL S  SDRR ++WDL +IGAEQ Q++ +DG PE+LM+HAGHK+ +ND + +PNI W
Sbjct: 304 KDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPW 363

Query: 385 LVASAEEDNIVQIWKCSSN-----IPR 406
           L+AS EE+N+VQIWK S       IPR
Sbjct: 364 LMASVEEENVVQIWKASKKLTSPYIPR 390

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  406 bits (1044), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 204/404 (50%), Positives = 277/404 (68%), Gaps = 12/404 (2%)

Query: 22  QQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLP---QKNLVAART--RQQ 76
           ++  +P T++EEY+LW SNVPM+YDFVSETRLTWP+LTV+WLP   Q   V  +   RQ+
Sbjct: 5   EEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQE 64

Query: 77  LILGTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMV--LSNVKIVKKFPHDG 134
           L++GT T+  E NYLKI A+DLP  VT +SK           +    S +KIV+KF H+ 
Sbjct: 65  LLIGTLTTDNEPNYLKIAAIDLPENVT-SSKPSVSDDAKENELSHRQSKIKIVRKFKHEQ 123

Query: 135 EITRARYMPQDDNIIATINGEGKIFIYDRS-KNGVEALLSTLEYHTENGYGLAFNANEKY 193
           E+TRARYMPQ  NIIAT+NG G ++I+DR+ K      +++  YH ENGYGLAFN     
Sbjct: 124 EVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSG 183

Query: 194 SLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMK 253
            LLS SDD  +ALWD+++   N  P+ TF D HTDI+ND KWH  ++ +FG+VSED+T+ 
Sbjct: 184 QLLSASDDGTVALWDVTS-TANKSPSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241

Query: 254 LFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHE 313
           + D  S + I  ++    +NTLAFS  S NL AAAGTD+ VYLYD+R +  PL++M GHE
Sbjct: 242 IHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSI 373
           D+VT++EF P+ DG+L SSGSDRR I+WDL  IGAEQ  D+  DG PE+ M+H GH++ +
Sbjct: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPV 361

Query: 374 NDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSI 417
           N+ + N N+ WL+ S EE+N++QIWK ++ I R   +P  D  I
Sbjct: 362 NEFSHNSNVPWLMCSVEEENVLQIWKPANKIVR-PPQPPADFDI 404

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  399 bits (1026), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 209/412 (50%), Positives = 287/412 (69%), Gaps = 34/412 (8%)

Query: 22  QQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLV-AARTRQQLILG 80
           ++  EP+T D+EYELWKSNVP+LYDFVSET+L WP+LTVEWLP           Q+L+LG
Sbjct: 14  KEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLG 73

Query: 81  THTSGEEQNYLKIGAVDLPVEVT-----ENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGE 135
           THTSGEEQNYLKI  + LP ++      +NS K           V SN++I+KKF H+ E
Sbjct: 74  THTSGEEQNYLKIAEITLPDQIINEKTEDNSDKH----------VKSNIRIIKKFKHELE 123

Query: 136 ITRARYMPQDDNIIATINGEGKIFIYDRS--KNGVEALLSTLEYHTENGYGLAFNANEKY 193
           +TRA YMPQD  IIATING+G +FIYD S  +N    ++S L +H ENGYGLAFN  +K 
Sbjct: 124 VTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKG 183

Query: 194 SLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMK 253
            LLS SDD ++A W   N +K+I P +T ++  T IINDV+W+    ++FG V+E S + 
Sbjct: 184 KLLSSSDDGSVAYW---NIQKSI-PLLTLQE--TSIINDVRWNQFNQNLFGYVTESSCLN 237

Query: 254 LFDKRSS----QII--HNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLY 307
           L D R++    +I+  H+I T   +N +AFS  S  L AA+G D+L+YLYD R+++ PL+
Sbjct: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297

Query: 308 AMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGP-PEVLMIH 366
            M GHED+VT+++F   NDGI+ S GSD+R  VWDL++IG EQT DEIEDG  PE+LMIH
Sbjct: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIH 357

Query: 367 AGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418
           AGH++ IND +++ N+NWL AS EEDNIVQ+WK ++++     +P V+++++
Sbjct: 358 AGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLRE---DPLVNMNVI 406

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  395 bits (1014), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 199/386 (51%), Positives = 274/386 (70%), Gaps = 10/386 (2%)

Query: 23  QSNEP---MTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL 79
           QS EP   +++D+EY+LWKSNVP++YDFVSETRL WP+LT++WLP+       T Q+L++
Sbjct: 2   QSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPR---AEDSTEQELLV 58

Query: 80  GTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXX-XMVLSNVKIVKKFPHDGEITR 138
           GTHTS  EQNYLKI  ++LP E+  N               V S +KI+KKF H+ E+TR
Sbjct: 59  GTHTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTR 118

Query: 139 ARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSG 198
           ARY P D N+IATI+G G +F+YDR+K+   AL     YH ENGYGL F+      L+S 
Sbjct: 119 ARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISC 178

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR 258
           SDD +IA+WDI +      PT +    H+DI+N+ KWH S+ +I+GSVSEDS + + DKR
Sbjct: 179 SDDGSIAIWDIKS--GKTVPT-SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR 235

Query: 259 SSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTA 318
           S + +  +  K+P+NT+AFS  SSNLFAAAGTD +VYL+D R  +  L++M+GH++AVT+
Sbjct: 236 SEKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTS 295

Query: 319 IEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAV 378
           +EF  + DGIL S GSDRR ++WDL +IG EQ +++ +DG PE+LM+HAGHK++IND + 
Sbjct: 296 LEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSF 355

Query: 379 NPNINWLVASAEEDNIVQIWKCSSNI 404
           +PN+ WL+AS EE+NIVQIWK S  +
Sbjct: 356 SPNVPWLMASVEEENIVQIWKPSRKL 381

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  391 bits (1004), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 193/388 (49%), Positives = 275/388 (70%), Gaps = 13/388 (3%)

Query: 22  QQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGT 81
           Q+    +++DEEY+LWKSNVP++YDFVSET+LTWP+LTVEWLP  +  A  T+Q++I+GT
Sbjct: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPH-DPQAPLTQQEMIIGT 62

Query: 82  HTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARY 141
           HTS +E NY+KI +++LP EV +               V SNV+I KKF  + EITR+RY
Sbjct: 63  HTSDQEPNYVKIASIELPNEVID-------PHNVSDAPVKSNVRITKKFKLEKEITRSRY 115

Query: 142 MPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDD 201
           M QD NII+TI+G G + I+DR  N  ++ + T  YH +NGYGL+FN   K  LLS +DD
Sbjct: 116 MVQDPNIISTIDGNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADD 173

Query: 202 SNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED-STMKLFDKRSS 260
             IA++DI+   ++  P  T++     IIND+KWH  +A +FG+VSE+ +T+ ++D R+ 
Sbjct: 174 GYIAMYDINAESED--PVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTK 231

Query: 261 QIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIE 320
             + +I  ++P+N+LAFS  S NLF+AAGTD  VYLYD+R+    L++M+GHE  VT +E
Sbjct: 232 DKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLE 291

Query: 321 FDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNP 380
           F  + DGIL SS  DRR I+WDL EIG+EQ  ++ +D  PE++MIHAGH++S+ND ++N 
Sbjct: 292 FHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNS 351

Query: 381 NINWLVASAEEDNIVQIWKCSSNIPRIG 408
           +I WL+AS EE+NI+Q+WK SS +PRI 
Sbjct: 352 SIPWLIASTEEENIIQVWKSSSRLPRIS 379

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  151 bits (381), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 113/408 (27%), Positives = 187/408 (45%), Gaps = 47/408 (11%)

Query: 27  PMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGE 86
           P    + Y LWK N  +LYD+++     WP+L+ ++ P  +L  +    +L+  + TS +
Sbjct: 5   PEDRQQRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFP--DLDTSSDTHRLLFTSFTSSQ 62

Query: 87  --EQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLS--------NVKIVKKFPHDGEI 136
             +   + I ++     V  +S              LS         +++   FPH G+ 
Sbjct: 63  LPQDENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GDC 121

Query: 137 TRARYMPQDDNIIATINGEGKIFIYDRSKNG----------VEALLSTLEYHTENGYGLA 186
            RA Y+PQ+ ++I+T + +G ++I+DR+K G           EA L      +  G  +A
Sbjct: 122 NRATYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVA 181

Query: 187 FNANEKYSLLSGSDDSN--IALWDISNFEKN----IKPTITFEDAHTDIINDVKWHSSEA 240
            + N +   +  S  SN  + +WDI  FEK      +P+  F D  +   NDV W  S  
Sbjct: 182 LDWNRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHD 241

Query: 241 HIFGSVSEDSTMKLFDKRS----SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYL 296
            +     ED+ M LFD R+    +Q   + N     N   F+P    L A A  D LV L
Sbjct: 242 CLLSIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQL 301

Query: 297 YDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIE 356
           +DIR + NP+  +   E  ++A+E++P    +L + G          QE G  +  +   
Sbjct: 302 WDIRKLHNPIKTINC-ESPLSALEWNPQLPTVLATGG----------QEDGLVKLWNA-S 349

Query: 357 DGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
           +G  ++L  H GH   +NDIA +P+  WL+ S   DN   +WK +S +
Sbjct: 350 NG--QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  149 bits (375), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 111/425 (26%), Positives = 200/425 (47%), Gaps = 55/425 (12%)

Query: 18  AAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQL 77
           + A++QS  P  + + Y  WK N  +LYD+++     WP+LT ++ P  +L       ++
Sbjct: 5   STAQEQSTIPNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFP--DLDTTSDTHRI 62

Query: 78  ILGTHTSGE--EQNYLKIGAVD----LPVEVTENSKKXXXXXXXXXXMVLSNVKIVK--- 128
           ++ + TS +  E   + I  +     L      N             + L +  +V    
Sbjct: 63  LISSFTSSQLPEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLT 122

Query: 129 -KFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLST------------- 174
            KFP +G+  RARY+PQ+ ++IA  +  G ++I+DR+K+G   +  +             
Sbjct: 123 IKFP-NGDCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNN 181

Query: 175 ------LEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISN-FEKNI---KPTITFE- 223
                 L  +T     LA+N  ++ +L S      + +WDI   F  N    KP +  + 
Sbjct: 182 SETVEELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQF 241

Query: 224 DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKK---PYNTLAFSPF 280
           DA    +NDV W  S   +F +  E  T+ LFD+R  + +  I   +     N+  F+  
Sbjct: 242 DALG--VNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQ 299

Query: 281 SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG-SDRRTI 339
           ++ L A+A ++ LV ++DIR++         H  +++ IE++PN D I+ ++G +D    
Sbjct: 300 NNMLLASADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVK 359

Query: 340 VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWK 399
           +WD            + +   E+L +H GH   +NDI+ + + +WL+ S   DN +QIWK
Sbjct: 360 LWD------------VSNTDNELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWK 407

Query: 400 CSSNI 404
            + N+
Sbjct: 408 PAHNL 412

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  144 bits (364), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/432 (25%), Positives = 197/432 (45%), Gaps = 58/432 (13%)

Query: 13  MAEVAAA---AEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLV 69
           MAE  A    A   S  P    + Y  WK N  +LY++++     WP+LT +  P  +L 
Sbjct: 1   MAETVAPDDDAIASSAIPEDRQQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLA 60

Query: 70  AARTRQQLILGTHTSGE--EQNYLKIGAVD----LPVEVTENSKKXXXXXXXXXXMVLSN 123
               R  ++L + TS +  E   + +  +     +P     N             + L  
Sbjct: 61  GDEHR--ILLSSFTSSQLPEDEAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPP 118

Query: 124 VKIVK----KFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNG------------ 167
             IV+    KFP  G+  +ARY P + ++I++ +  G ++++DR+K+G            
Sbjct: 119 KNIVEDLRIKFPA-GDCNKARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDP 177

Query: 168 ---VEALLST-LEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFE 223
              +   LST LE        LA+N  ++  L +      + +WD++ ++K   PT+   
Sbjct: 178 DHQIHCQLSTSLEERQNEALNLAWNWQQQGLLATCYSGGEVCVWDLAKYDK-ASPTLI-- 234

Query: 224 DAHTDII------NDVKWHSSEAHIFGSVSEDSTMKLFD----KRSSQIIHNINTKKPYN 273
           D H+ ++      ND+ W  +   +     E + + + D    K+  Q   N +     N
Sbjct: 235 DPHSSLLADPQGSNDISWMVNHDSLLAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVN 294

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
              F+ +   L  +A +   + L+DIRD S+P+ ++  H  +V+A++++P++  IL ++G
Sbjct: 295 ACQFNYYKDLLLCSADSAGRINLWDIRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAG 353

Query: 334 SDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEED 392
            D   + +WDL      Q  D+      E+   H GH   +NDI+ +PN  W++ S   D
Sbjct: 354 QDDGLVKIWDL-----SQPVDQ------ELKFTHGGHMLGVNDISWDPNDPWMMCSVSND 402

Query: 393 NIVQIWKCSSNI 404
           N +Q+WK S N+
Sbjct: 403 NSIQLWKPSQNL 414

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  144 bits (364), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 115/422 (27%), Positives = 196/422 (46%), Gaps = 58/422 (13%)

Query: 21  EQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILG 80
           EQ S  P    + Y  WK N  +LY++++     WP+LT ++ P  N        +++L 
Sbjct: 12  EQSSAIPKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVN--TKNDSHRILLS 69

Query: 81  THTSG--EEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKI---------VKK 129
           + TS    E   L I  +     ++  S               SN+K+         V +
Sbjct: 70  SFTSSLVPEDESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIR 129

Query: 130 FPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLS-----TLEYHTE---- 180
           FP +G+  RARY+PQ+ ++IA  + +G ++I+DR+K+G  A+ S     T  Y  +    
Sbjct: 130 FP-NGDCNRARYLPQNPDLIAAASSDGSVYIFDRTKHGT-AMHSRQSGFTQSYQAKLAVN 187

Query: 181 ------NGYGLA----FNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDI- 229
                 NG   A    +N  ++  L+    D ++  WDI+ ++++  P I   + +  + 
Sbjct: 188 NNSQSLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRS-DPVIKAPEYNYKLD 246

Query: 230 ---INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINT---KKPYNTLAFSPFSSN 283
               ND  W      +F + SED+ + LFD R    I +I+T   K   N   F+P +S 
Sbjct: 247 ESGCNDAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSL 306

Query: 284 LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWD 342
           L A+  +   + L+DIR    P+  +  H  +++ IE++PN   +L S+G D   + +WD
Sbjct: 307 LLASGDSIGNICLWDIRKKETPINIL-DHGSSISTIEWNPNLSTVLASAGQDDGLVKLWD 365

Query: 343 LQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
                          G  + + IH GH   +NDI+ N +  WL+ S  +DN +QIWK + 
Sbjct: 366 A--------------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAH 411

Query: 403 NI 404
           N+
Sbjct: 412 NL 413

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  143 bits (361), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 110/421 (26%), Positives = 201/421 (47%), Gaps = 51/421 (12%)

Query: 16  VAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQ 75
           +  A    S+ P  + + Y  WK N  +LY++++     WP+LT +++P  ++  A  + 
Sbjct: 7   IETAPSFSSSIPEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDI--ASDKH 64

Query: 76  QLILGTHTSGE--EQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVK----- 128
           +++L + TS +  E   + I  +     +  +S             V + VK+ K     
Sbjct: 65  RILLSSFTSAQLPEDEAIYISEISTMKHIAWSSLNNFHMEEMEFK-VDNQVKLSKNLTET 123

Query: 129 ---KFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGV---EALLSTLEYHTE-- 180
              +FP +G+  RARYMPQ+ ++IA+ +  G ++I+DR+K+G    + L +T +Y  E  
Sbjct: 124 IKIQFP-EGDCNRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELK 182

Query: 181 --------NGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDI--- 229
                       LA+N      L +   D ++ +WDI+ + K  +P +T  D    +   
Sbjct: 183 EVESGCNYEASSLAWNYQRSGILAASYSDGDVKIWDITKYNK-AQPQLTVPDLRWQVDKE 241

Query: 230 -INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQII----HNINTKKPYNTLAFSPFSSNL 284
             N+V W    + I     E + + + D R+        H+ +T    N + F+  +  L
Sbjct: 242 GANEVSWMVHHSSILAVCGEGNGLTILDTRTPTTFSTKRHSCHTGG-INAVQFNYDNDFL 300

Query: 285 FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG-SDRRTIVWDL 343
             +A ++  + + DIR + +P+   + H DAV+ I+++P    ++ S+G +D    +WDL
Sbjct: 301 LCSADSEGTLNICDIRQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL 359

Query: 344 QEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSN 403
            +          ED P  ++ IH GH   +NDIA N +  W++ S   DN V IWK ++N
Sbjct: 360 AQ----------EDDP--LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAAN 407

Query: 404 I 404
           I
Sbjct: 408 I 408

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  140 bits (354), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 118/427 (27%), Positives = 197/427 (46%), Gaps = 59/427 (13%)

Query: 15  EVAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTR 74
           EV   + + S+E   + + Y  WK N  +LYD+++     WP+LT +++P  +L     +
Sbjct: 9   EVPQVSSEISDE---LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMP--DLEVPTDK 63

Query: 75  QQLILGTHTSGE--EQNYLKIGAVD----LPVEVTENSKKXXXXXXXXXXMVLSNVKIVK 128
            +L+L + TS +  E   + I  +     +P     N               L N  +V+
Sbjct: 64  HRLLLSSFTSSQLPEDEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVE 123

Query: 129 ----KFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGV---EALLSTLEYHTE- 180
               +FP  G+  RA YMPQ+ +II  I   G + I+DR+K+G    + L S   Y  + 
Sbjct: 124 TVRIQFP-SGDCNRACYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQL 182

Query: 181 ------------NGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT------F 222
                           LA+N  +   + S   +  I +WDI+ ++K+ +PTI+       
Sbjct: 183 NEPESLGDADSAEALSLAWNWQKAGIIASSYSNGLIKVWDITRYQKS-QPTISNPELRIL 241

Query: 223 EDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPY----NTLAFS 278
           +D      NDV W    + I  +  E +T+ L D R+           P+    N L F+
Sbjct: 242 QDKAG--TNDVSWMVHHSSILAACGESNTIGLLDTRAPDAFKPTKAS-PHTGGINALQFN 298

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG-SDRR 337
             +  L  AA ++  + L+D R  S PL ++  H D+V+A++++PN   I+ ++G  D  
Sbjct: 299 YANDMLLCAADSNGGIALWDCRAFSKPL-SVFNHGDSVSALQWNPNLPTIVATAGQGDGL 357

Query: 338 TIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQI 397
             +WD        T  E ED    +L +H GH   +NDIA N +  WL+ S   DN V +
Sbjct: 358 IKIWD--------TSREPED---SLLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHV 406

Query: 398 WKCSSNI 404
           WK ++N+
Sbjct: 407 WKPAANL 413

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  140 bits (354), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 115/430 (26%), Positives = 199/430 (46%), Gaps = 56/430 (13%)

Query: 13  MAEVAAAAEQQSNEPMTVDEE----YELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNL 68
           MAEV    E   + P T+ EE    Y  WK N  +LYD+++     WP+LT ++ P  +L
Sbjct: 10  MAEVITTEEHGLDLP-TIPEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFP--DL 66

Query: 69  VAARTRQQLILGTHTSGE--EQNYLKIGAVD----LPVEVTENSKKXXXXXXXXXXMVLS 122
                + +L+L + TS +  E   + +  V     LP     N               L 
Sbjct: 67  DTTNDQHRLLLSSFTSSQLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLP 126

Query: 123 NVKIVKK----FPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGV---------- 168
           +  ++K+    FP  G+   ARY+PQ+ ++IA  +  G I+++DR+K+G+          
Sbjct: 127 SKNLIKELNISFPM-GDCNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGS 185

Query: 169 ----EALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFED 224
               E   S+LE H E    LA+N   +  L +     ++ +WD+  + +N  P I   D
Sbjct: 186 MFELEFQSSSLEEHQE-VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNF-PVIDKAD 243

Query: 225 ----AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ-IIHNINTKKPY----NTL 275
               A     NDV W  + A I     E +++ + D R+ + ++ +    K +    N+ 
Sbjct: 244 YTHNADPRGCNDVSWMVNHASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSS 303

Query: 276 AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG-S 334
            F+  +  L  +  +   V L+DIRD+  PL ++  H  +++  +++PN   IL ++  S
Sbjct: 304 QFNYHNDMLLCSGDSTGRVNLWDIRDLETPLKSL-DHGSSISKTQWNPNLSTILATADQS 362

Query: 335 DRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNI 394
           D    +WD+ +   E           E+L +H GH   +NDI+ N +  WL+ S   DN 
Sbjct: 363 DGLVKLWDIAQEPGE-----------ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNS 411

Query: 395 VQIWKCSSNI 404
           VQ+W+ + N+
Sbjct: 412 VQLWRPARNL 421

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  138 bits (347), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 104/426 (24%), Positives = 194/426 (45%), Gaps = 56/426 (13%)

Query: 19  AAEQQSNEPM-TVDEE----YELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAART 73
           A  Q++  P+ T+ EE    Y  WK N  + YD+++     WP+LT +  P  +L  A  
Sbjct: 5   ATHQETVAPVSTIAEERQKRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDL--ATD 62

Query: 74  RQQLILGTHTSGE--EQNYLKIGAVD----LPVEVTENSKKXXXXXXXXXXMVLSNVKIV 127
             +++L + TS +  E   L +  +     +P     N             + L +  +V
Sbjct: 63  EHRILLSSFTSSQVPEDESLYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLV 122

Query: 128 K----KFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNG---------------V 168
           +    KFP  G+  +ARY P + ++I + +  G I+++DR+K+G               +
Sbjct: 123 EDLRIKFP-AGDCNKARYCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQI 181

Query: 169 EALLST-LEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHT 227
              LST LE H      LA+N   +  L +      + +WD+  ++KN  PT+    A +
Sbjct: 182 HCQLSTSLEEHKNEAVSLAWNWQRQGLLATSYSHGQVCVWDLEKYDKN-SPTLINPLAMS 240

Query: 228 DI----INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIH----NINTKKPYNTLAFSP 279
            +     N+V W      +    SED+ + + D R+ +       N +     NT  F+ 
Sbjct: 241 TVDPRGSNEVSWMVRHDSLLAYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNY 300

Query: 280 FSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
               L  +A +   + L+DIR+ + PL  +  H D+++ ++++P    +L + G D   +
Sbjct: 301 HRDMLLCSADSAGRINLWDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLV 359

Query: 340 -VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            +WDL +   +           E++  H GH   +NDI+ +P+  W++ S   DN +Q+W
Sbjct: 360 KIWDLSQPEGQ-----------ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVW 408

Query: 399 KCSSNI 404
           + S+++
Sbjct: 409 RPSNSL 414

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 62/132 (46%), Gaps = 6/132 (4%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           H   I   ++    D ++ + +  G+I ++D  +N  + L + L  H ++   L +N  E
Sbjct: 289 HSNGINTCQFNYHRDMLLCSADSAGRINLWD-IRNFTQPLKTLL--HNDSISVLQWNPRE 345

Query: 192 KYSLLSGSDDSN-IALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDS 250
              L +G  D   + +WD+S  E   +  I     H   +ND+ W   +  +  SV+ D+
Sbjct: 346 PTVLATGGQDGGLVKIWDLSQPEG--QELIFTHGGHMLGVNDISWDPHDTWMMCSVANDN 403

Query: 251 TMKLFDKRSSQI 262
           +++++   +S +
Sbjct: 404 SIQVWRPSNSLV 415

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  137 bits (344), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/444 (26%), Positives = 208/444 (46%), Gaps = 68/444 (15%)

Query: 13  MAEVAAAAEQQSNE-PMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAA 71
           M++ A  A ++++     + E Y  WK N  +LYD+++     WP+LT ++ P  +L   
Sbjct: 1   MSQRAGEATKEASYISADLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP--DLDTT 58

Query: 72  RTRQQLILGTHTSGE----EQNYLK----IGAVDLP----VEVTENSKKXXXXXXXXXXM 119
               +++L + TS +    E  Y+     +G +        ++ E   K           
Sbjct: 59  LNEHRILLSSFTSSQKPEDETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKH 118

Query: 120 VLSNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNG------------ 167
           ++ +++I   FP +GE  RARY+PQ+ +IIA  + +G I+I+DR+K+G            
Sbjct: 119 LVDDIRIF--FP-NGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHP 175

Query: 168 --------------VEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFE 213
                         VE + ++L    E    LA+N  ++  LLS   +  I +WDI  + 
Sbjct: 176 FEIKLLGSHGVIQDVETMDTSLVDINE-ATSLAWNLQQEALLLSSHSNGQIQVWDIKQYS 234

Query: 214 KN---IKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTK- 269
            +   I   +   D+    +NDV W  +   +F + +E + + L D R+ +     N K 
Sbjct: 235 HDNPIIDVPLMSIDSDGSSVNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKI 294

Query: 270 --KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVS-NPLYAMTGHEDAVTAIEFDPNND 326
                N+  F+  +S + A+A ++  + L+DIR+++ NP+  M  H  +V+ +E+ PN D
Sbjct: 295 HGGGVNSCKFNYKNSLILASADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFD 353

Query: 327 GILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLV 386
            +L ++G          QE G  +  D   +   E +  H GH   +NDI+ + +  WL+
Sbjct: 354 TVLATAG----------QEDGLVKLWDTTRE---ESIFTHGGHMFGVNDISWDVHDPWLM 400

Query: 387 ASAEEDNIVQIWKCSSNIPRIGGE 410
            S   DN V IWK + NI  +G E
Sbjct: 401 CSVANDNSVHIWKPAENI--VGSE 422

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  137 bits (344), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 110/429 (25%), Positives = 195/429 (45%), Gaps = 65/429 (15%)

Query: 21  EQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILG 80
            + S+ P+ + E Y  WK N  +LYD+++     WP+LT ++ P  +L       +++L 
Sbjct: 10  HEASSIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP--DLDTTSDEHRILLS 67

Query: 81  THTSGE----EQNYLK----IGAVDLP----VEVTENSKKXXXXXXXXXXMVLSNVKIVK 128
           + TS +    E  Y+     +G +        ++ E   K           +++++ I  
Sbjct: 68  SFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIF- 126

Query: 129 KFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNG--------------------- 167
            FP +GE  RARY+PQ+ +IIA  + +G I+I+DR+K+G                     
Sbjct: 127 -FP-NGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSH 184

Query: 168 -----VEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITF 222
                VEA + T          LA+N  ++  LLS   +  + +WDI  +     P I  
Sbjct: 185 GVIQDVEA-MDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHE-NPIIDL 242

Query: 223 E----DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKK---PYNTL 275
                ++    +NDV W  +   +F + +E + + L D R+ +     N +K     N+ 
Sbjct: 243 PLVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSC 302

Query: 276 AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSD 335
            F+  +S + A+A ++  + L+DIR+++    A   H  +V+ +E+ PN D +L ++G  
Sbjct: 303 RFNYKNSLILASADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAG-- 360

Query: 336 RRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIV 395
                   QE G  +  D       E +  H GH   +NDI+ + +  WL+ S   DN V
Sbjct: 361 --------QEDGLVKLWDT---SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSV 409

Query: 396 QIWKCSSNI 404
            IWK + N+
Sbjct: 410 HIWKPAGNL 418

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 68/134 (50%), Gaps = 8/134 (5%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HDG +   R+  ++  I+A+ +  G++ ++D  +N  ++ ++T+E+ T     L ++ N 
Sbjct: 295 HDGGVNSCRFNYKNSLILASADSNGRLNLWDI-RNMNKSPIATMEHGTSVST-LEWSPNF 352

Query: 192 KYSLLS-GSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDS 250
              L + G +D  + LWD S  E     TI     H   +ND+ W + +  +  SV+ D+
Sbjct: 353 DTVLATAGQEDGLVKLWDTSCEE-----TIFTHGGHMLGVNDISWDAHDPWLMCSVANDN 407

Query: 251 TMKLFDKRSSQIIH 264
           ++ ++    + + H
Sbjct: 408 SVHIWKPAGNLVGH 421

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  134 bits (337), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 194/417 (46%), Gaps = 67/417 (16%)

Query: 30  VDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGE--- 86
           + + Y  WK N  +LYD+++     WP+LT ++ P  ++  +    +L+L T TS +   
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFP--DIDKSNDTHRLLLSTFTSSQIPD 70

Query: 87  ----------EQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEI 136
                       N+L   +++   ++ E   K           +++++ I   FP +G+ 
Sbjct: 71  DESIYISHISTLNHLDWSSLN-NFDMDEMEFKPDNRIKFPSKNLITDISIT--FP-EGDC 126

Query: 137 TRARYMPQDDNIIATINGEGKIFIYDRSKNG-----------------VEALLS-----T 174
            +ARYMPQ+ +II   +  G I+I+DR+K G                  EA L+      
Sbjct: 127 NKARYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFV 186

Query: 175 LEYHTEN----GYGLAFNANEKYSLLSGSDDSNIALWDISN--FEKNIKPTITFEDAHTD 228
           +E  T+N       +A+N  ++  LLS   + NI LWD       KN +   T  D + D
Sbjct: 187 IEDGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFD 246

Query: 229 II--NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNI---NTKKPYNTLAFSPFSSN 283
            +  N+V W +    IF +  E++ M +FD R   I+++I   N     N+  F+  ++ 
Sbjct: 247 DLGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAM 306

Query: 284 LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS-DRRTIVWD 342
           L A+  ++ ++ L+DIR ++ P+  +  H  +++ IE+ P  + ++ S G  D    +WD
Sbjct: 307 LLASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD 365

Query: 343 LQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWK 399
           +                 E + IH GH   IND++ + +  WL+ S   DN +QIWK
Sbjct: 366 ISN-------------EEEPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWK 409

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  132 bits (333), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 109/430 (25%), Positives = 197/430 (45%), Gaps = 65/430 (15%)

Query: 20  AEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL 79
           A + SN P  + E Y  WK N  +LY++++     WP+LT ++ P  +L       +++L
Sbjct: 9   ANEASNIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFP--DLDTTLDEHRILL 66

Query: 80  GTHTSGE----EQNYLK----IGAVDLP----VEVTENSKKXXXXXXXXXXMVLSNVKIV 127
            + TS +    E  Y+     +G +        ++ E   K           +++++ I 
Sbjct: 67  SSFTSSQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIF 126

Query: 128 KKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYH--------- 178
             FP +GE  RARY+PQ+ +IIA  + +G I+I+DR+K+G   +  +   H         
Sbjct: 127 --FP-NGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGS 183

Query: 179 ----------------TENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITF 222
                                 +A+N  ++  LLS   +  + +WDI  +     P I  
Sbjct: 184 HGVIQDVETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHE-NPIIDL 242

Query: 223 E----DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKK---PYNTL 275
                ++    +NDV W  +   +F + +E +T+ L D R+ +     N +      N+ 
Sbjct: 243 PLVSINSDGSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSC 302

Query: 276 AFSPFSSNLFAAAGTDNLVYLYDIRDVSN-PLYAMTGHEDAVTAIEFDPNNDGILYSSGS 334
            F+  +S + A+A ++  + L+DIR++++ PL  M  H  +V+ +E+ PN D +L ++G 
Sbjct: 303 KFNYRNSLILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAG- 360

Query: 335 DRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNI 394
                    QE G  +  D   +   E +  H GH   +NDI+ + +  WL+ S   DN 
Sbjct: 361 ---------QEDGLVKLWDTSRE---ENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNS 408

Query: 395 VQIWKCSSNI 404
           V IWK + N+
Sbjct: 409 VHIWKPAVNL 418

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  132 bits (331), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 98/406 (24%), Positives = 188/406 (46%), Gaps = 43/406 (10%)

Query: 30  VDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGE--- 86
           V + Y  WK N  +LYD+++     WP+L+ ++ P + L     +Q+++L + TS +   
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLT--NDKQRILLSSFTSQQLPQ 77

Query: 87  ----------EQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEI 136
                       N++K  +++   ++ E   K           +   V+I   +P DG+ 
Sbjct: 78  DESIYIGSISTMNHMKWSSIN-NFDMDEMEFKLDNSLKLNDKTLEEEVRIT--YP-DGDC 133

Query: 137 TRARYMPQDDNIIATINGEGKIFIYDRSKNGVE-ALLSTLEYHTEN--------GYGLAF 187
            R RYMPQ+ +II T +  G ++I+DR+K+G + +     E    N           LA+
Sbjct: 134 NRCRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAW 193

Query: 188 NANEKYSLLSGSDDSNIALWDISNFEKN-----IKPTITFEDAHTDIINDVKWHSSEAHI 242
           N   + +L +   +  + +WD++ F+K+     I    +  DA+   +NDV W  +   I
Sbjct: 194 NYQLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANG--VNDVSWMVNHTSI 251

Query: 243 FGSVSEDSTMKLFDKRSS---QIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDI 299
             S  E + + L D R       +H        N + F+  +  +     +   + ++DI
Sbjct: 252 LASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDI 311

Query: 300 RDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDG 358
           RD   P+     G +D ++AI+++P    IL +  +D+++ +  + +   EQ     E+ 
Sbjct: 312 RDFKEPIKEWEHGDQDPISAIQWNPQIPQILAT--ADQQSGLVKIWDASGEQEDSNAENN 369

Query: 359 PPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
              +L +H GH   +NDI+ + +  W + S   DN + IWK ++N+
Sbjct: 370 M--LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  131 bits (329), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 196/419 (46%), Gaps = 63/419 (15%)

Query: 27  PMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGE 86
           P  V   Y  WK N  +LYD+++     WP+LT ++ P  +L  +  + +L+L + TS +
Sbjct: 18  PEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFP--DLDTSSDQHRLLLSSFTSSQ 75

Query: 87  ----EQNYL-KIGAVDL-------PVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDG 134
               E  Y+ KI  +           ++ E   K           + + V I  +FP +G
Sbjct: 76  LPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSI--RFP-NG 132

Query: 135 EITRARYMPQDDNIIATINGEGKIFIYDRSKNG-----------VEALLSTLEYHTEN-- 181
           +  R+RY+PQ+ ++IA  + +G ++I++++K+G            +A L +  +  +N  
Sbjct: 133 DCNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLD 192

Query: 182 ----GYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NI---KP--TITFEDAHTDIIN 231
                  L++N +++  L          +WD+  F + NI   +P  T+TF+   ++  N
Sbjct: 193 NFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFD---SNGCN 249

Query: 232 DVKWHSSEAHIFGSVSEDSTMKLFDKRSS-----QIIHNINTKKPYNTLAFSPFSSNLFA 286
           D+ W      +F +  E + + LFD R +       I N   +   NT  F+P +S L A
Sbjct: 250 DLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVA 309

Query: 287 AAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS-DRRTIVWDLQE 345
           +A T   + L+DIR +     +   H  +++ IE++PN   +  S+G  D    +WD   
Sbjct: 310 SADTCGRINLWDIRKLDQEPISTMQHGSSISTIEWNPNIGVVFASAGQEDGLVKLWD-AS 368

Query: 346 IGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
           +G E             + +H GH   +NDI+ + +  WL+AS   DN +QIW+ + NI
Sbjct: 369 VGKE-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPAKNI 414

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  130 bits (328), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 104/427 (24%), Positives = 197/427 (46%), Gaps = 64/427 (14%)

Query: 19  AAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLI 78
           A  + S+ P  + E Y  WK N  +LY +++     WP+LT ++ P  +L       +++
Sbjct: 5   APIEPSSIPDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFP--DLDTTTDTHRIL 62

Query: 79  LGTHTSGE-------------EQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNVK 125
           L T TS +               N+L   +++   ++ E   K           +  NV 
Sbjct: 63  LSTFTSSQLPEDESLYIANLSTSNHLNWSSLN-NFDMDEMEFKPDNSTKFPSKNL--NVD 119

Query: 126 IVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNG----------VEALLSTL 175
           I   FP +G+  RARY+PQ+ +++A  +  G I+I++R+K+G           EA L + 
Sbjct: 120 ISIPFP-NGDCNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYST 178

Query: 176 EYHTEN------GYGLAFNANEKYSLLSGSDDSNIALWDISNFE------KNIKPTITFE 223
           +   EN         +A+N  +  +L S     +I +WDI+ +       +  + TI F+
Sbjct: 179 DKMDENFTNSNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFD 238

Query: 224 DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ----IIHNINTKKP-YNTLAFS 278
               +  N+V W  +   IF + SE + + LFD R+ +    +  NI T     N+  F+
Sbjct: 239 ---PEGCNEVTWMVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFN 295

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRT 338
            ++  L A+A +   + ++DIR +         H  +++ +E++PN + IL ++G D   
Sbjct: 296 YYNDMLLASADSTGKINMWDIRKLDKEPIKSFNHNSSISTLEWNPNLETILVTAGQDDGL 355

Query: 339 I-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQI 397
           + +WD                  + + +H GH   +ND++ + +  WL++S   DN + +
Sbjct: 356 VKIWDTAN--------------GQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHV 401

Query: 398 WKCSSNI 404
           WK ++N+
Sbjct: 402 WKPATNL 408

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  130 bits (327), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 192/435 (44%), Gaps = 68/435 (15%)

Query: 15  EVAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTR 74
           E A  A   SN P+ + E Y  WK N  +LYD+++     WP+LT ++ P  +L      
Sbjct: 7   ETAGGA---SNIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP--DLDTTLDE 61

Query: 75  QQLILGTHTSGE----EQNYLK----IGAVDLP----VEVTENSKKXXXXXXXXXXMVLS 122
            +++L + TS +    E  Y+     +G +        ++ E   K           +++
Sbjct: 62  HRILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVN 121

Query: 123 NVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYH---- 178
           ++ I   FP +G+  RARY+PQ+ +IIA  + +G I+I+DR+K+G   +  +   H    
Sbjct: 122 DISIF--FP-NGDCNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEA 178

Query: 179 ---------------------TENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKN-- 215
                                      LA+N  ++  LLS   +  + +WDI  +     
Sbjct: 179 KLFGSHGVIQDVEAMDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENP 238

Query: 216 --IKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ---IIHNINTKK 270
               P ++ E +    +NDV W  +   +F + +E + + L D R+ +     +  N   
Sbjct: 239 LIDSPLVSIE-SDASGVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTG 297

Query: 271 PYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILY 330
             N+  F+  +S + A+A ++  + L+DIR ++        H  +++ +E++PN   +L 
Sbjct: 298 GVNSCKFNYRNSLVLASADSNGRLNLWDIRKMNESPITTMEHGASISTLEWNPNFSTVLA 357

Query: 331 SSG-SDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASA 389
           ++G  D    +WD                  E +  H GH   +ND++ + +  WL+ S 
Sbjct: 358 TAGQQDGLVKLWDTAR--------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSV 403

Query: 390 EEDNIVQIWKCSSNI 404
             DN V IWK + N+
Sbjct: 404 ANDNSVHIWKPAENL 418

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  130 bits (327), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 106/427 (24%), Positives = 189/427 (44%), Gaps = 66/427 (15%)

Query: 33  EYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSG---EEQN 89
            Y  WK N  +LYD+++     WP+LT ++ P  ++ A     +++L ++TS    E++N
Sbjct: 18  RYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFP--DVDANTDTHRILLSSYTSCQLPEDEN 75

Query: 90  YLKIGAVDLP---------VEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRAR 140
                   L           ++ E   K           + +NV I   FP  G+  RAR
Sbjct: 76  VYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSIT--FPR-GDCNRAR 132

Query: 141 YMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYG---------------- 184
           YMPQ+ ++IA  +  G +++++R+K+G   +        E  YG                
Sbjct: 133 YMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEARR 192

Query: 185 ---------LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFE------DAHTDI 229
                    LA+N + + +L        + +WD+  F  N+  T   E      +  +  
Sbjct: 193 TPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRF--NVDNTTISETEWECSNFDSRG 250

Query: 230 INDVKWHSSEAHIFGSVSEDS-TMKLFDKRSSQIIHNINTK---KPYNTLAFSPFSSNLF 285
           +NDV W S    I  +  E S ++ LFD R+   +  I  +   +  N   F+  ++ L 
Sbjct: 251 VNDVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLL 310

Query: 286 AAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG-SDRRTIVWDLQ 344
           A+  +     L+D+R +S        H  +V+ +E++P++  +L ++G SD    +WD  
Sbjct: 311 ASTDSTGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWD-- 368

Query: 345 EIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
                 T  EIED   + + +H+GH   +NDIA + +  WL+ S   DN V +WK ++N+
Sbjct: 369 ------TSLEIED---KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANL 419

Query: 405 PRIGGEP 411
            +    P
Sbjct: 420 VQRCTSP 426

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  127 bits (320), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 107/431 (24%), Positives = 186/431 (43%), Gaps = 60/431 (13%)

Query: 13  MAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWL--------P 64
           M+ +      QS+ P  + + Y  WK N  +LYD+++     WP+LT ++          
Sbjct: 1   MSAIEEEHVPQSSIPEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDT 60

Query: 65  QKNLVAARTRQQL------ILGTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXX 118
            + L++A T  QL       +   ++ +   +  I   D+     E   K          
Sbjct: 61  HRILLSAFTSSQLPEDEAIYIAKLSTLKHLEWASINNFDM----DEMEFKPENNIKLPSK 116

Query: 119 MVLSNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNG----------- 167
            + +++ I  +FP DG+   ARY+PQ+ ++IA  +  G I+I+DR+K+G           
Sbjct: 117 NLTNDISI--RFP-DGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLK 173

Query: 168 -VEALLSTLEYHTEN------GYGLAFNANEKYSLLSGSDDSNIALWDI---SNFEKNIK 217
             EA L       EN         +++N   +  L S      I LWD+   SN +  + 
Sbjct: 174 PYEAALYCPPKGIENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMD 233

Query: 218 PTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTK---KPYNT 274
             +   D     +NDV WH S   I  +  E + + LFD R    I   N K      N+
Sbjct: 234 TPLLNVDFDALGVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINS 293

Query: 275 LAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS 334
             F+    +L  +  ++  + L+D+R +         H  +++ +E++PN + I+ S+G 
Sbjct: 294 CKFNSHCDSLLISGDSEGRINLWDLRKLDGEPIKTLHHGSSISTLEWNPNLETIVASAGQ 353

Query: 335 DRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDN 393
           D   + +WD+                 E++  H GH   +NDI+ N +  WL+ S   DN
Sbjct: 354 DDGLVKLWDVST--------------DELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDN 399

Query: 394 IVQIWKCSSNI 404
            VQ+WK + N+
Sbjct: 400 SVQVWKPAHNL 410

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  124 bits (312), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 102/411 (24%), Positives = 184/411 (44%), Gaps = 55/411 (13%)

Query: 30  VDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSG--EE 87
           + E Y  WK N  +LYD+++     WP+L+ ++    N        +++L + TSG   E
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVN--TKNDSHRILLSSFTSGLMPE 80

Query: 88  QNYLKIGAVD----LPVEVTENSKKXXXXXXXXXXMVLS----NVKIVKKFPHDGEITRA 139
           Q  + I ++     +P     N             + L     + +    FP +G+  RA
Sbjct: 81  QESINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFP-NGDCNRA 139

Query: 140 RYMPQDDNIIATINGEGKIFIYDRSKNGV------------------EALLSTLEYHTEN 181
           RY+PQ+ +IIA  + +G ++I++R+K G                   E  + +++ +   
Sbjct: 140 RYLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNE 199

Query: 182 GYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAH----TDIINDVKWHS 237
              + +N   +  L +   D  I  WD+  F  N   TIT         T+  NDV W  
Sbjct: 200 ALSIDWNVQREGLLAASYSDGEIKTWDLKKF-SNANTTITTPTVSIMMDTNGANDVTWMP 258

Query: 238 SEAHIFGSVSEDSTMKLFDKRSSQIIHNINT---KKPYNTLAFSPFSSNLFAAAGTDNLV 294
               +  +  E + + ++D R S+    I++   +   N   F+  ++ + A+A T   V
Sbjct: 259 LHDSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGNV 318

Query: 295 YLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQD 353
           +++DIR  SN +     H  +++ IE++PN D IL ++G D   + +WD+ +        
Sbjct: 319 HIWDIRK-SNEIVKTIPHGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD-------- 369

Query: 354 EIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
                  E++  H GH   +NDI+ N +  WL+ S   DN VQIW+ + N+
Sbjct: 370 ------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  117 bits (292), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 96/408 (23%), Positives = 177/408 (43%), Gaps = 53/408 (12%)

Query: 32  EEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGE--EQN 89
           + Y  WK N  +LYD+++     WP+LT E+ P  +L       +L+L + TS +  E  
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFP--DLDTTTDSHRLLLSSFTSSQLPEDE 74

Query: 90  YLKIGAVDL----------PVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRA 139
            + I  +              ++ E   K           +  ++ I  + P  G+  RA
Sbjct: 75  SIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISI--RIP-SGDSNRA 131

Query: 140 RYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLA------------- 186
           RY+PQ+ ++I+  + +G I+I+DR+K+      ST     E    +A             
Sbjct: 132 RYLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVV 191

Query: 187 ---FNANEKYSLLSGSDDSNIALWDISNFEKN----IKPTITFEDAHTDIINDVKWHSSE 239
              +N  ++  L S      + +WDIS +  +      P  + +D      ND+ W  S 
Sbjct: 192 SLDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSH 251

Query: 240 AHIFGSVSEDSTMKLFDKRSSQIIHNINT---KKPYNTLAFSPFSSNLFAAAGTDNLVYL 296
             +  +  E +T+ ++D RS   +  I         N+  F+  +  L A+A +   V++
Sbjct: 252 DSLLAACGESNTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVHM 311

Query: 297 YDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIE 356
           +DIR +         H  +++ ++++PN   I+  +G          QE G  +  D   
Sbjct: 312 WDIRKLDQDPIQSVSHGSSISTVKWNPNVATIIAVAG----------QEDGLVKLWDA-S 360

Query: 357 DGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
           +G  +++  H GH   +NDIA N +  WL+ S   DN + +W+ SS++
Sbjct: 361 NG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/400 (20%), Positives = 160/400 (40%), Gaps = 42/400 (10%)

Query: 42  PMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL---GTHTSGEEQNYLKIGAVDL 98
           P +Y+ +    L WP LT++ +P       R   Q IL    T  S ++ N L +  +  
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 99  PVEVTENSKKXXXXXXXXXXMVLSNVKIVK--KFPHDGEITRARYMP----QDDNIIATI 152
             +                    +   I++    P      R R  P    Q + + +T+
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTSTM 238

Query: 153 NGEGKIFIYDRS--------------KNGVEALLSTLEYHTENGYGLAFNANEKYSLLSG 198
           +  G++FIYD +              K     L +   +    GYGL ++   K   L  
Sbjct: 239 SENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALLT 298

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR 258
            D S +      +  K +     F   +   I D++W  +E+ +F +   D  ++++D R
Sbjct: 299 GDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR 358

Query: 259 SSQ---IIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSN------PLYAM 309
           S +   +I  + +    N ++++     L A+        ++D+R  S       P+   
Sbjct: 359 SKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSEKALPVAQY 418

Query: 310 TGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGPPEV 362
             H+ A+T+I F+P ++ I+  +  D    +WDL      +EI  ++ +  E+E  PP++
Sbjct: 419 DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKELEQIPPQL 478

Query: 363 LMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           L +H   +  + D+  +  I   + S   D +  +WK  S
Sbjct: 479 LFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 515

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 85/400 (21%), Positives = 168/400 (42%), Gaps = 43/400 (10%)

Query: 42  PMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL---GTHTSGEEQNYLKIGAVDL 98
           P +Y+ +    + WP LT++ +P       R   Q IL    T +S +++N L + A+  
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 99  PVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARYMP----QDDNIIATING 154
             +                   +  V   +  P      R +  P      + + AT++ 
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSE 233

Query: 155 EGKIFIYDRS--------------KNGVEALLSTLEYHTENGYGLAFNANEKY-SLLSGS 199
            G ++IYD +              K+    + +   +    GYGL ++   K  +LLSG 
Sbjct: 234 NGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 293

Query: 200 DDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS 259
               I L    +  + +    +F  ++ + I D++W  +E+ +F + + D  ++++D RS
Sbjct: 294 CSGQIYLTQ-RHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTRS 352

Query: 260 SQIIHNINTKKPYNTLAFSPFSSNL--FAAAGTDNLVY-LYDIR-------DVSNPLYAM 309
            +    I+ K     +    +S  +    A+G DN  + ++D+R       D   P+   
Sbjct: 353 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQY 412

Query: 310 TGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGPPEV 362
             H+ A+T+I F+P ++ I+     D    +WDL      +EI  +  +  E++D PP++
Sbjct: 413 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQDIPPQL 472

Query: 363 LMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           L +H   +  + D+  +  I   + S   D +  +WK  S
Sbjct: 473 LFVH--WQREVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 509

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 83/401 (20%), Positives = 164/401 (40%), Gaps = 46/401 (11%)

Query: 42  PMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL---GTHTSGEEQNYLKIGAVDL 98
           P +Y+ +    + WP LT++ +P       R   Q IL    T +S + +N L + A+  
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALS- 172

Query: 99  PVEVTENSKKXXXXXXXXXXMVLSNVKIVKK--FPHDGEITRARYMP----QDDNIIATI 152
              +T+   K                 +++    P      R +  P      + + AT+
Sbjct: 173 --NLTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVLTATM 230

Query: 153 NGEGKIFIYDR--------------SKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSG 198
           +  G ++IYD               SK+    + +   +    GYGL ++   K   L  
Sbjct: 231 SENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALLS 290

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR 258
            D S    +   +  + +     F  ++   I D++W  +E+ +F +   D  ++++D R
Sbjct: 291 GDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR 350

Query: 259 SSQIIHNINTKKPYNTLAFSPFSSNL--FAAAGTDNLVY-LYDIR-------DVSNPLYA 308
           S +    I+ K     +    +S  +    A+G DN  + ++D+R       D   P+  
Sbjct: 351 SKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQ 410

Query: 309 MTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGPPE 361
              H+ A+T+I F+P ++ I+     D    +WDL      +EI  +  +  E+++ PP+
Sbjct: 411 YDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEIPPQ 470

Query: 362 VLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +L +H   +  + D+  +  I   + S   D +  +WK  S
Sbjct: 471 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 508

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 108/226 (47%), Gaps = 21/226 (9%)

Query: 144 QDDNIIATI--NGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDD 201
            D+ IIA    NG  ++F Y+      EA     + H        FNA +   L +G   
Sbjct: 72  HDNKIIAGALDNGSVELFSYNADSLKSEA---KFQRHKTTAKVARFNAKQFNVLATGGTK 128

Query: 202 SNIALWDISNFEKNIK--PTITFEDAHTDI--INDVKWHSSEAHIFGSVSEDSTMKLFD- 256
             I +WD++   +N      +T  ++ T +  I  + W+ S AH+F S    S   ++D 
Sbjct: 129 GEIFIWDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDL 188

Query: 257 KRSSQIIH------NINTKKPYNTLAFSPFSSNLFAAA-GTDN--LVYLYDIRDVSNPLY 307
           K   ++IH      N   K P + + + P +S   A A G+DN   + ++D+R+ + PL 
Sbjct: 189 KAKKEVIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQ 248

Query: 308 AMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
            ++ GH   V ++++   ++ +L SSG D   ++W+ QE G E TQ
Sbjct: 249 VLSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWNPQE-GQELTQ 293

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 85/403 (21%), Positives = 170/403 (42%), Gaps = 46/403 (11%)

Query: 42  PMLYDFVSETRLTWPTLTVEWLPQKNLVAARTR--QQLILGTHTSG---EEQNYLKIGAV 96
           P +Y+ +    + WP +T++ +P  NL + R    Q L++ T T     +E   + +   
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPD-NLGSERRNYPQSLLMATATQASRKKENELMVLSLS 170

Query: 97  DLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKK--FPHDGEITRARYMP----QDDNIIA 150
           +L   + ++ ++              +  I++    P      R +  P    +++ + A
Sbjct: 171 NLVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAA 230

Query: 151 TINGEGKIFIYD-------------RSKNGVEALLSTLEYHTE-NGYGLAFNANEKYSLL 196
           T++  G+++I+D             +     +  + T++ H    GY L ++   K   L
Sbjct: 231 TMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGAL 290

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
              D S    +   +  K I     F  A+   I D++W  +E+ +F S   D  ++++D
Sbjct: 291 LTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIRIWD 350

Query: 257 KRSSQIIHNINTKKPYNTLAFSPFSSNL--FAAAGTDNLVY-LYDIRDVS-------NPL 306
            RS +    I+ K     +    +S  L    A+G DN  + ++D+R  S        P+
Sbjct: 351 TRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQPV 410

Query: 307 YAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGP 359
                H+ A+T+I F+P ++ I+     D    +WDL      +EI  +  +  E++  P
Sbjct: 411 AQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQQIP 470

Query: 360 PEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           P++L +H   +  + D+  +  I   + S   D +  IWK  S
Sbjct: 471 PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 510

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 106/209 (50%), Gaps = 21/209 (10%)

Query: 153 NGEGKIFIYDRSKNGVEAL--LSTLEYHTENGYGLAFNANEKYSLLSGSD-DSNIALWDI 209
           NG  ++F +D     +++L  LS    H  +   L FN  +   L+SGSD +  I +WD+
Sbjct: 83  NGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDL 142

Query: 210 SNFEKN-IKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINT 268
           +N +K  + P +      T+ I  + W+ S +H+F   S  S + +FD ++ + + ++N 
Sbjct: 143 NNLDKTPLTPGMPM--TPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKKEVIHLNY 200

Query: 269 KKPYNTLA--FS-----PFSSNLFAAAGTDN------LVYLYDIRDVSNPLYAMT--GHE 313
             P N +   FS     P +S   A A  +N       ++++D+R+   PL  ++  GH 
Sbjct: 201 TNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQILSKDGHS 260

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWD 342
           + + ++++   ++ +L SSG D   ++W+
Sbjct: 261 NGILSLDWCSTDENLLLSSGRDNSVMLWN 289

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 76/148 (51%), Gaps = 9/148 (6%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSN-IALWDISNFEKNIKPT 219
           Y    N V++L S +E+H +N   +A       +L + S +S+ I +WD+ N    ++  
Sbjct: 200 YTNPVNNVKSLFSVVEWHPKNSTRIA-----TATLNNDSTESDSIFIWDLRNSHTPLQ-- 252

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYN-TLAFS 278
           I  +D H++ I  + W S++ ++  S   D+++ L++  + + +    +++ +     F+
Sbjct: 253 ILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLWNPENGESLTKYPSRRNWCFKTKFA 312

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
           P   ++FA A  D  + +  ++D+ N L
Sbjct: 313 PAFPDVFATASFDGKIEVQTLQDLVNNL 340

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 118/268 (44%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T   Y    D +++  + +G I I+  + N V+ L      HTE    +AF+ N+
Sbjct: 122 HDSAVTTMEYSHAGDWMVSG-DSDGTIKIWQPNFNMVKELDRA---HTECIRDVAFSGND 177

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++           H D+     WH  E  +  S S+D+ 
Sbjct: 178 S-KFVTCSDDNILKIWNFSNGQQER----VLSGHHWDV-KSCDWHP-EMGLIASASKDNL 230

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D R  Q I  I   K       F P   NL AA   D    ++DIR     L  + 
Sbjct: 231 VKLWDPRVGQCISTILKFKHTVLKTRFQPTGGNLLAAISKDKSCRVFDIRHSLKELMVVR 290

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T + ++P N+ +L  +  D           G+ +  D ++D    V  I   H 
Sbjct: 291 DEVDYMTLL-WNPINESMLTVACYD-----------GSLKDFDVVQDLKKPVHTIPYAHD 338

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  ++ NP +  ++ASA +D  ++ W
Sbjct: 339 KCITSLSYNP-VGHILASASKDRTIRFW 365

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 100/216 (46%), Gaps = 20/216 (9%)

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENG--YGLAFNANEKYSLLSGSDDS 202
           DD IIA     G +  +D      +AL S  + H   G    L FNA +   L+SG    
Sbjct: 73  DDKIIAGALENGVVEFFDP-----KALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQG 127

Query: 203 NIALWDISNF-EKNIKP-TITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD-KRS 259
            I +WD +     +  P +    +   D ++ + W+ S AH+F S S      ++D K  
Sbjct: 128 EIFVWDSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAK 187

Query: 260 SQIIH------NINTKKPYNTLAFSPFSSNLFAAAG---TDNLVYLYDIRDVSNPLYAMT 310
            Q++H          K P   + + P SS + A A    T+ LV  +D+R+   PL  ++
Sbjct: 188 KQVLHLNHSSSTTGIKVPLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLS 247

Query: 311 -GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQE 345
            GH   V ++++   ++ +L SSG D  +++W+ QE
Sbjct: 248 QGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQE 283

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 68/150 (45%), Gaps = 13/150 (8%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIAL-WDISNFEKNIKPT 219
           +  S  G++  L+ +++H  +   +A          S SD   + L WD+ N    +K  
Sbjct: 195 HSSSTTGIKVPLTVVDWHPTSSTIIA--------TASSSDTEPLVLTWDLRNAHVPLK-- 244

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLA-FS 278
                 H+  +  + W   + ++  S   D+T  L++ +   I+     +  +   + F+
Sbjct: 245 -VLSQGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQEGSILTQFAPRGNWVFKSKFA 303

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPLYA 308
           P + +LFA+A  D+ + +  ++++SN L A
Sbjct: 304 PEAPDLFASASFDSKIVVQTLQNLSNTLDA 333

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 284 LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           + A A  + +V  +D + + + +  +  H+  V  ++F+   + +L S G+     VWD 
Sbjct: 76  IIAGALENGVVEFFDPKALKS-VAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDS 134

Query: 344 QEIGA 348
            +IG+
Sbjct: 135 NKIGS 139

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 120/268 (44%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T  +Y    D +I+  + +G I I+  + + V+ + +    HTE+   +AF++N+
Sbjct: 134 HDSAVTTMKYSHDSDWMISG-DADGMIKIWQPNFSMVKEIDAA---HTESIRDMAFSSND 189

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN     K        H D+     WH  E  +  S S+D+ 
Sbjct: 190 S-KFVTCSDDNILKIWNFSNG----KEERVLSGHHWDV-KSCDWHP-EMGLIASASKDNL 242

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS   I +I   K       F P   NL  A   D    ++DIR     L  + 
Sbjct: 243 VKLWDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAISKDKSCRVFDIRYSMKELMCVR 302

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T +E+ P N+ +   +  D           G+ +  D ++D    VL I   H 
Sbjct: 303 DETDYMT-LEWHPINESMFTLACYD-----------GSLKHFDLLQDLNEPVLTIPYAHD 350

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  ++ NP +  + A+A +D  ++ W
Sbjct: 351 KCITSLSYNP-VGHIFATAAKDRTIRFW 377

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 104/201 (51%), Gaps = 25/201 (12%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            ++GS+D+ + +WD+++    +K T+T    H   + D+       ++F SVSED T+K 
Sbjct: 155 FVTGSNDTTMKVWDLAS--GKLKVTLT---GHVMTVRDIAVSDRHPYLF-SVSEDKTVKC 208

Query: 255 FDKRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHE 313
           +D   +QII + +       T++  P + +L A AG D++V L+DIR    P+  + GH+
Sbjct: 209 WDLEKNQIIRDYHGHLSGVRTVSIHP-TLDLIATAGRDSVVKLWDIR-TRVPVITLVGHK 266

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSI 373
             +  +E  P +  I+ SS +D    +WD            I  G    ++ H  HK S+
Sbjct: 267 GPINQVECAPVDPQIV-SSSTDATVRLWD------------IVAGKAMKVLTH--HKRSV 311

Query: 374 NDIAVNPNINWLVASAEEDNI 394
             IA++PN  + +ASA  D+I
Sbjct: 312 RAIALHPN-EFSMASACTDDI 331

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 60/133 (45%), Gaps = 19/133 (14%)

Query: 276 AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPL-YAMTGHEDAVTAIEFDPNNDGILYSSGS 334
           A  P  +  F     D  + ++D+   S  L   +TGH   V  I    +    L+S   
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDL--ASGKLKVTLTGHVMTVRDIAV-SDRHPYLFSVSE 202

Query: 335 DRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNI 394
           D+    WDL++               +++  + GH + +  ++++P ++ L+A+A  D++
Sbjct: 203 DKTVKCWDLEK--------------NQIIRDYHGHLSGVRTVSIHPTLD-LIATAGRDSV 247

Query: 395 VQIWKCSSNIPRI 407
           V++W   + +P I
Sbjct: 248 VKLWDIRTRVPVI 260

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 86/401 (21%), Positives = 167/401 (41%), Gaps = 45/401 (11%)

Query: 42  PMLYDFVSETRLTWPTLTVEWLPQKNLVAARTR--QQLILGTHTSGEEQNYLKIGAVDLP 99
           P +Y+ +    L WP L+++ +P K L + R    Q L+L T T   ++   ++  + + 
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDK-LGSERRNYPQSLLLTTATQASKKKDNELLLLKMS 184

Query: 100 VEVTENSKKXXXXXXXXXXMVLSNVKIVKK--FPHDGEITRARYMP----QDDNIIATIN 153
                  K                  IV+    P      R +  P      + + AT++
Sbjct: 185 QLAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPEKLTATMS 244

Query: 154 GEGKIFIYDRS--------------KNGVEALLSTLEYHTENGYGLAFNA-NEKYSLLSG 198
             G+++I+D                K   + + +   +    GY L ++  N+  SLL+G
Sbjct: 245 ENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSLLTG 304

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR 258
                + L    +  K I     F   +   I D+++  +EA +F S   D  ++++D R
Sbjct: 305 DCSGRVYLTQ-RHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTR 363

Query: 259 SSQIIHNINTKKPYNTLAFSPFSSNL--FAAAGTDNLVY-LYDIRDVS-------NPLYA 308
           S +    I+ K     +    ++  +    A+G DN  + ++D+R  S       +P+  
Sbjct: 364 SKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTSPVAQ 423

Query: 309 MTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGPPE 361
              H+ A+T+I F+P +D I+  +  D    +WDL      +EI  +  +  E+++ PP+
Sbjct: 424 YNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRELQEIPPQ 483

Query: 362 VLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +L +H   +  + D+  +  I   + S   D +  IWK  S
Sbjct: 484 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 521

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 121/268 (45%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T  +Y    D +I+  + +G I I+  + + V+ + +    HTE+   +AF++N+
Sbjct: 136 HDSAVTTMKYSHDGDWMISG-DADGMIKIWQPNFSMVKEIDAA---HTESIRDMAFSSND 191

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++           H D+     WH  E  +  S S+D+ 
Sbjct: 192 S-KFVTCSDDNILKIWNFSNGKQER----VLSGHHWDV-KSCDWHP-EMGLIASASKDNL 244

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS   I +I   K       F P   NL  A   D    ++DIR     L  + 
Sbjct: 245 VKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVR 304

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T +E+ P N+ +   +  D           G+ +  D ++D    +L I   H 
Sbjct: 305 DETDYMT-LEWHPINESMFTLACYD-----------GSLKHFDLLQDLNEPILTIPYAHD 352

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  ++ NP +  + A+A +D  ++ W
Sbjct: 353 KCITSLSYNP-VGHIFATAAKDRTIRFW 379

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 120/268 (44%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T  +Y    D +I+  + +G I I+  + + V+ + +    HTE+   +AF++N+
Sbjct: 134 HDSAVTTMKYSHDGDWMISG-DADGMIKIWQPNFSMVKEIDAA---HTESIRDMAFSSND 189

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++           H   +    WH  E  +  S S+D+ 
Sbjct: 190 S-KFVTCSDDNILKIWNFSNGKQE-----RILSGHHWDVKSCDWHP-EMGLIASASKDNL 242

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS   I +I   K       F P   NL  A   D    ++DIR     L  + 
Sbjct: 243 VKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMRELMCVR 302

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T +E+ P N+ +   +  D           G+ +  D ++D    +L I   H 
Sbjct: 303 DETDYMT-LEWHPINESMFTLACYD-----------GSLKHFDLLQDLNEPILTIPYAHD 350

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  ++ NP +  + A+A +D  ++ W
Sbjct: 351 KCITSLSYNP-VGHIFATAAKDRTIRFW 377

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 80/399 (20%), Positives = 162/399 (40%), Gaps = 41/399 (10%)

Query: 42  PMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL---GTHTSGEEQNYLKIGAVDL 98
           P +Y+ +    + WP LT++ +P       R   Q IL    T +S +++N L + A+  
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 99  PVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARYMP----QDDNIIATING 154
             +                   +  V   +  P      R +  P      + + AT++ 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSE 234

Query: 155 EGKIFIYDRS--------------KNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD 200
            G ++IY+ +              K+    + +   +    GYGL ++   K   L   D
Sbjct: 235 NGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 294

Query: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS 260
            S    +   +  + +     F  ++   I D++W  +E+ +F +   D  ++++D RS 
Sbjct: 295 CSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSK 354

Query: 261 QIIHNINTKKPYNTLAFSPFSSNL--FAAAGTDNLVY-LYDIR-------DVSNPLYAMT 310
           +    I+ K     +    +S  +    A+G DN  + ++D+R       D   P+    
Sbjct: 355 KHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVAQYD 414

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGPPEVL 363
            H+ A+T+I F+P ++ I+     D    +WDL      +EI  +  +  E+++ PP++L
Sbjct: 415 FHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQEIPPQLL 474

Query: 364 MIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
            +H   +  + D+  +  I   + S   D +  +WK  S
Sbjct: 475 FVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 510

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 84/401 (20%), Positives = 164/401 (40%), Gaps = 44/401 (10%)

Query: 42  PMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL---GTHTSGEEQNYLKIGAVD- 97
           P +Y+ +    L WP +T++ +P K     R   Q IL    T  S +++N L + ++  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 98  ----LPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARYMPQDDNII-ATI 152
               L     +  +            ++ N  I K       +  + +   D  ++ AT+
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENI-KLNDTTNRLKVSPFASTDKEVLTATM 238

Query: 153 NGEGKIFIYDRS--------------KNGVEALLSTLEYHTENGYGLAFNANEKYSLLSG 198
           +  G+++I+D +              K     + +   +    GY L ++   K   L  
Sbjct: 239 SENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGALLT 298

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR 258
            D S    +   +  K I     F   +   + D++W  +E+ +F S   D  ++++D R
Sbjct: 299 GDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTR 358

Query: 259 SSQIIHNINTKKP---YNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVS-------NPLYA 308
           S +    ++ K      N +++S     L A+   + L  ++D+R  S        P+  
Sbjct: 359 SKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNINDVQPVAQ 418

Query: 309 MTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGPPE 361
              H+ A+T+I F+P +D I+  +  D    +WDL      +EI  +  +  E+E  PP+
Sbjct: 419 YDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKELEKIPPQ 478

Query: 362 VLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +L +H   +  + D+  +  I   + S   D +  IWK  S
Sbjct: 479 LLFVH--WQKDVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 516

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 92/436 (21%), Positives = 182/436 (41%), Gaps = 54/436 (12%)

Query: 12  KMAEVAAAAEQQ-----SNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQK 66
           + AE++A   QQ      + P+  DE  E      P +Y+ +    L WP L+++ +P +
Sbjct: 96  QAAELSAQESQQLYLPHMSRPLGPDEVLEA----DPTVYEMLHNVNLPWPCLSLDIVPDR 151

Query: 67  NLVAARTR--QQLILGTHTSGEEQNYLKIGAVDLPVEVTENSKKXXXXXXXXXXMVLSNV 124
            L + R    Q L+L T T   ++   ++  + +        K+                
Sbjct: 152 -LGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQLTKTLVKEDEDDDEEDDDEDEDQD 210

Query: 125 KIVKK--FPHDGEITRARYMP----QDDNIIATINGEGKIFIYDRS-------------- 164
            IV+    P      R +  P      + + A+++  G+++I+D                
Sbjct: 211 PIVENENIPLRDTTNRLKVSPFASESPEKLTASMSENGEVYIFDLGPQVKGFETPGYQIP 270

Query: 165 KNGVEALLSTLEYHTENGYGLAFNA-NEKYSLLSGSDDSNIALWDISNFEKNIKPTITFE 223
           K   + + +   +    GY L ++  N+  SLL+G     + L    +  K I     F 
Sbjct: 271 KTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTGDCSGRVYLTQ-RHTSKWITDKTAFS 329

Query: 224 DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSN 283
             +   I D+++  +EA +F +   D  ++++D RS +    I+ K     +    ++  
Sbjct: 330 AGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEK 389

Query: 284 L--FAAAGTDNLVY-LYDIRDVS-------NPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
           +    A+G DN  + ++D+R  S       +P+   + H+ A+T+I F+P +D I+  + 
Sbjct: 390 IGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVAS 449

Query: 334 SDRRTIVWDL------QEIGAEQTQ-DEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLV 386
            D    +WDL      +EI  +  +  E++  PP++L +H   +  + D+  +  I   +
Sbjct: 450 EDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCL 507

Query: 387 ASAEEDNIVQIWKCSS 402
            S   D +  IWK  S
Sbjct: 508 VSTGTDGL-NIWKTIS 522

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 121/268 (45%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T  +Y    D +I+  + +G I I+  + + V+ + +    HTE+   +AF++N+
Sbjct: 134 HDSAVTTMKYSHDSDWMISG-DADGMIKIWQPNFSMVKEIDAA---HTESIRDMAFSSND 189

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++           H D+     WH  E  +  S S+D+ 
Sbjct: 190 S-KFVTCSDDNILKIWNFSNGKQER----VLSGHHWDV-KSCDWHP-EMGLIASASKDNL 242

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS   I +I   K       F P   NL  A   D    ++DIR     L  + 
Sbjct: 243 VKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVR 302

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T +E+ P N+ +   +  D           G+ +  D +++    +L I   H 
Sbjct: 303 DETDYMT-LEWHPINESMFTLACYD-----------GSLKHFDLLQNLNEPILTIPYAHD 350

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  ++ NP +  + A+A +D  ++ W
Sbjct: 351 KCITSLSYNP-VGHIFATAAKDRTIRFW 377

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 119/268 (44%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T   Y    D +I+  + +G I I+  + N V+ L      HTE    +AF+ N+
Sbjct: 127 HDTSVTAMEYSHAGDWMISG-DADGTIKIWQPNFNMVKELDKA---HTECIRDIAFSKND 182

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++      T    H D+     WH  E  +  S S+D+ 
Sbjct: 183 S-KFVTCSDDNILKIWNFSNGKQER----TLSGHHWDV-KSCDWHP-EMGLIVSASKDNL 235

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS Q +  + N K       F P   NL AA   D    ++DIR     L  + 
Sbjct: 236 IKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISKDKSCRVFDIRYHMKELTVIR 295

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T + + P N+ +   +  D           GA +  D +++      +I   H 
Sbjct: 296 DEVDYMTLL-WHPTNESMFTIASYD-----------GAIKHFDILQNLEEPQQVIPYAHD 343

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  ++ NP +  ++ASA +D  ++ W
Sbjct: 344 KCITSLSYNP-VGHILASAAKDRTIRFW 370

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 117/268 (43%), Gaps = 21/268 (7%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  ++   Y    D +I+  + +G I I+  + N V+ L    E HT+   G++F+  +
Sbjct: 124 HDSAVSVMTYSHAGDWLISG-DSDGTIKIWQPNFNMVKVLD---EAHTQCIRGISFSGTD 179

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++      T    H D+     WH +   +  S S+D+ 
Sbjct: 180 S-KFVTCSDDNILKIWNFSNGQQES----TLTGHHWDV-RSCDWHPTMG-LIASGSKDNL 232

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS Q I  I   K    +  F P   N+ A    D    ++DIR     L A+ 
Sbjct: 233 IKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFDIRQNMKEL-AVY 291

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
             E    ++ + P N+ I      D     +DL +   + +     + P         H 
Sbjct: 292 RDESDYMSLTWHPINESIFTVGCYDGSMKHFDLMQEPQDSSSGCFHNIP-------YAHD 344

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  +A NP +  ++ASA +D  ++ W
Sbjct: 345 KCITSLAYNP-VGHILASASKDRTIRFW 371

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 122/270 (45%), Gaps = 29/270 (10%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  ++  +Y    D  + + + +G I I+  + N V+   +    HTE    ++F+ N+
Sbjct: 131 HDSAVSCIQYSHAGD-WMCSGDADGGIKIWQPNFNMVKEFENA---HTECIRDISFSNND 186

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN +  ++ T++    H   I    WH  E  +  S S+D+ 
Sbjct: 187 S-KFVTCSDDNVLKIWNFSNGQ--VERTLS---GHHWDIKSCDWHP-EMGLIVSASKDNL 239

Query: 252 MKLFDKRSSQIIHN-INTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS Q I   I  K       F P   NL AA   D    ++DIR     L  + 
Sbjct: 240 VKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIRHSMKELMCVR 299

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIED--GPPEVLMIHAG 368
              D +T + ++P N+ +      D           GA +  D ++D  GP  V  I   
Sbjct: 300 DEVDYMT-LTWNPINESMFTVGNYD-----------GAMKYFDLLQDLEGPSHV--IPYA 345

Query: 369 HKTSINDIAVNPNINWLVASAEEDNIVQIW 398
           H   +  +A NP  N ++ASA +D  ++ W
Sbjct: 346 HDKCVTSMAYNPAGN-ILASASKDRTIRFW 374

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 108/223 (48%), Gaps = 17/223 (7%)

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204
           DD IIA     G + ++  + + +++  +  + H      + FN+ +   L SG     I
Sbjct: 73  DDKIIAGALDSGVVELFSSTGDSLKSE-ARFQQHQGAAKTVKFNSKQNNVLASGGSKGEI 131

Query: 205 ALWDISNFEKNIK--PTITFEDAHTDI--INDVKWHSSEAHIFGSVSEDSTMKLFD-KRS 259
            +WD++   KN +    +T   A T I  +  + W+ S AH+F S    S   ++D K  
Sbjct: 132 YIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLKAK 191

Query: 260 SQIIH------NINTKKPYNTLAFSPFSSNLFA-AAGTDN--LVYLYDIRDVSNPLYAMT 310
            ++IH      +   K   + + + P +S   A A G+D   L+ ++D+R+ + PL  ++
Sbjct: 192 KEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQVLS 251

Query: 311 -GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
            GH   + ++++   ++ +L SSG D   ++W+  E G E TQ
Sbjct: 252 KGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN-PESGQELTQ 293

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 90/444 (20%), Positives = 181/444 (40%), Gaps = 64/444 (14%)

Query: 11  QKMAEVAAAAEQQSNE---------PMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVE 61
           Q++ E    AEQ+ +E         P+  DE  E      P +Y+ +    + WP +T++
Sbjct: 91  QELVEKDQNAEQEQSEQLWLPHLSKPLGPDEVLEA----DPTVYEMLHTVNVPWPCMTLD 146

Query: 62  WLPQKNLVAARTR--QQLILGTHTSGEEQNYLKIGAVDLP------VEVTENSKKXXXXX 113
            +P   L + R    Q L++ T T   ++N  ++  + +       V+  E+  +     
Sbjct: 147 VIPD-TLGSGRRNYPQSLLMATATQASKKNQNELMVLKMSQLAKTLVKEDEDENEGEDED 205

Query: 114 XXXXXMVLSNVKIVKKFPHDGEITRARYMP----QDDNIIATINGEGKIFIYDRS----- 164
                 V+ N  I  K        R +  P      + + +T++  G+++I+D +     
Sbjct: 206 EDGTDPVIENENISLK----DTTNRLKVSPFANAAQEVLCSTMSENGEVYIFDLASQVKA 261

Query: 165 ---------KNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKN 215
                    K     + +   + +  GY   ++   K   +   D S        +  K 
Sbjct: 262 FETPGYQIPKQAKRPIHTVRNHGSVEGYANDWSPIIKTGAMLSGDCSGQVFLTQRHTSKW 321

Query: 216 IKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKP---Y 272
           I     F  A+   I D++W  +E+ +F S   D  ++++D RS +    I+ K      
Sbjct: 322 ITDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDV 381

Query: 273 NTLAFSPFSSNLFAAAGTDNLVYLYDIRD-------VSNPLYAMTGHEDAVTAIEFDPNN 325
           N +++S     L A+   D    ++D+R         ++P+     H+ A+T+I F+P +
Sbjct: 382 NVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNASTASPVAQYQFHKGAITSISFNPLD 441

Query: 326 DGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGPPEVLMIHAGHKTSINDIAV 378
           + I+  +  D    +WDL      +EI  +  +  E++  PP++L +H   +  + D+  
Sbjct: 442 ESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKW 499

Query: 379 NPNINWLVASAEEDNIVQIWKCSS 402
           +  I   + S   D +  +WK  S
Sbjct: 500 HKQIPGCLVSTGTDGL-NVWKTIS 522

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 117/268 (43%), Gaps = 21/268 (7%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +   +Y    D +I+  + +G I I+  + N V+ L    E HT+   G++F+  +
Sbjct: 124 HDSAVAVMKYSHAGDWLISG-DSDGTIKIWQPNFNMVKVLD---EAHTQCIRGISFSGTD 179

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++      T    H D+     WH +   +  S S+D+ 
Sbjct: 180 S-KFVTCSDDNILKIWNFSNGQQES----TLSGHHWDV-RSCDWHPTMG-LIASGSKDNL 232

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D R+ Q I  I   K    +  F P   N+ A    D    ++DIR     L A+ 
Sbjct: 233 VKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKEL-AVY 291

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
             E    ++ + P N+ +      D     +DL +   + +     + P         H 
Sbjct: 292 RDESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIP-------YAHD 344

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  +A NP +  ++ASA +D  ++ W
Sbjct: 345 KCITSLAYNP-VGHILASASKDRTIRFW 371

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 119/268 (44%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T  +Y    D +I+  + +G I I+  + N V+ L      HTE    +AF+ N+
Sbjct: 123 HDTSVTTMKYSHAGDWMISG-DADGTIKIWQPNFNMVKELD---RIHTEGIRDVAFSNND 178

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++           H D+     WH  E  +  S S+D+ 
Sbjct: 179 S-KFVTCSDDNILKIWNFSNGQQER----VLSGHHWDV-RSCDWHP-ELGLIVSGSKDNL 231

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS Q +  +   K       F P   NL AA   D    ++D+R   N L  + 
Sbjct: 232 VKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNELMCVR 291

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +  +E+   N+ +      D           G+ +  D  +D    + +I   H+
Sbjct: 292 DEVDFM-ELEWSTINESMFTVGCYD-----------GSLKHFDLGQDTEKPIHIIPFAHE 339

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I+ IA NP +  ++A+A +D  ++ W
Sbjct: 340 KCISAIAYNP-VGHILATAAKDRTIRFW 366

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 96/223 (43%), Gaps = 26/223 (11%)

Query: 187 FNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSV 246
           +N  +   L+S S D+   +WD+ +    IK  +    AH   + DV++ +    +F S 
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDLQS-ANYIKTQLI---AHDSEVFDVRFLTQSTQLFASC 273

Query: 247 SEDSTMKLFDKRS---SQIIHNINTKK-----PYNT-------LAFSPFSSNLFAAAGTD 291
             D ++++FD R    S II+           P  T       L  SPF  N+ A    D
Sbjct: 274 GGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAID 333

Query: 292 N-LVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ-EIGAE 349
           +  V + D+R   +PL  +  H   +  I++ P    +L S+  D + + WDL   + +E
Sbjct: 334 SSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSE 393

Query: 350 QTQDEIEDGPPEVL-----MIHAGHKTSINDIAVNPNINWLVA 387
            T+D   D  P+       M +A     +N+I   P  +W  A
Sbjct: 394 STKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

Query: 136 ITRARYMPQDDNIIATIN-GEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYS 194
           + R    P D N+IAT      K+ I D    G   L  TLE HT     + ++   +  
Sbjct: 314 LLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLL--TLEAHTAPINQIKWHPTRRNV 371

Query: 195 LLSGSDDSNIALWDI 209
           LLS SDD  +  WD+
Sbjct: 372 LLSASDDCQVLYWDL 386

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 308 AMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
            + G    +T+  ++P +  +L SS  D   IVWDLQ     +TQ
Sbjct: 205 GVLGELPPITSFHWNPTDPNLLISSSIDTTCIVWDLQSANYIKTQ 249

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 105/239 (43%), Gaps = 29/239 (12%)

Query: 174 TLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKN---------IKPTITFED 224
           T     +N   L F+ N K +  SG  DS I +W +  +  +         I  T     
Sbjct: 513 TFHNTQKNMTSLEFSNNYKLAA-SGFQDSYIKIWSLDGYPLSENDEMPNNPISSTCKTFI 571

Query: 225 AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ-IIHNINTKKPYNTLAFSPFSSN 283
            H+  +    + + + ++  S SED T++L+  +  + ++     +KP   + FSP  +N
Sbjct: 572 GHSGTVYSTSFSAGDEYLL-SASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNN 630

Query: 284 LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           LFA A  D    L+   D   PL  M GH + V  + F  N   I ++  SD+   +WD+
Sbjct: 631 LFATASNDQTARLWSC-DRVYPLRVMAGHLNDVDCVSFHSNGRYI-FTGSSDKTVRMWDI 688

Query: 344 QEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
                  T D +         +  GH +++  ++V+P+  W +++  +D I+ IW   S
Sbjct: 689 N------TGDSVR--------LFMGHNSTVTSLSVSPDGKW-ISTGSDDGIITIWDIGS 732

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 102/242 (42%), Gaps = 59/242 (24%)

Query: 166 NGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           N + +   T   H+   Y  +F+A ++Y LLS S+D  + LW +    ++ KP ++++  
Sbjct: 561 NPISSTCKTFIGHSGTVYSTSFSAGDEY-LLSASEDKTVRLWSV----QDDKPLVSYK-G 614

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPY-NTLAFSPFSSN- 283
           H   + DV++  S  ++F + S D T +L+   S   ++ +     + N +    F SN 
Sbjct: 615 HEKPVWDVEFSPSCNNLFATASNDQTARLW---SCDRVYPLRVMAGHLNDVDCVSFHSNG 671

Query: 284 --LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN--------NDGI----- 328
             +F  + +D  V ++DI +  + +    GH   VT++   P+        +DGI     
Sbjct: 672 RYIFTGS-SDKTVRMWDI-NTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWD 729

Query: 329 -----------------------------LYSSGSDRRTIVWDLQEIGAEQ--TQDEIED 357
                                        L S G+D+   VWDL +   E   T +E+  
Sbjct: 730 IGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDLNKGTFEPSLTPEEVYQ 789

Query: 358 GP 359
           GP
Sbjct: 790 GP 791

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 15/104 (14%)

Query: 302 VSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPE 361
           +S+      GH   V +  F    D  L S+  D+   +W +Q+           D P  
Sbjct: 563 ISSTCKTFIGHSGTVYSTSFSAG-DEYLLSASEDKTVRLWSVQD-----------DKP-- 608

Query: 362 VLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
            L+ + GH+  + D+  +P+ N L A+A  D   ++W C    P
Sbjct: 609 -LVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYP 651

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/398 (19%), Positives = 157/398 (39%), Gaps = 40/398 (10%)

Query: 42  PMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLIL---GTHTSGEEQNYLKIGAVDL 98
           P +Y+ +    L WP +T++ +P       R   Q IL    T  + ++ N L +  +  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 99  PVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARYMP----QDDNIIATING 154
             +      +               +   +  P      R R  P      + + AT++ 
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRLRVSPFASSGQEVLTATMSE 239

Query: 155 EGKIFIYDRS--------------KNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD 200
            G+++I+D +              K     + +   +    GY L ++   +   L   D
Sbjct: 240 NGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGALLTGD 299

Query: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS 260
            S    +   +  K +     F  ++   I D++W  +EA +F +   D  ++++D RS 
Sbjct: 300 CSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTRSK 359

Query: 261 QIIHNINTKKPYNTLAFSPFSSNL--FAAAGTDNLVY-LYDIRDVS------NPLYAMTG 311
           +    I+TK     +    ++  +    A+G DN  + ++D+R  S       P+     
Sbjct: 360 KHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENAQPVAQYDF 419

Query: 312 HEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGPPEVLM 364
           H+ A+T+I F P ++ I+  +  D    +WDL      +EI  +  +  E+   PP++L 
Sbjct: 420 HKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKELAQIPPQLLF 479

Query: 365 IHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +H   +  + D+  +  I   + S   D +  IWK  S
Sbjct: 480 VH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWKTIS 514

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 117/268 (43%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +    Y    D +I+  + +G I I+  + N V+ +      HTE    +AF+ N+
Sbjct: 123 HDTSVMAMTYSHAGDWMISG-DADGTIKIWQPNFNMVKEIDGA---HTEGIRDIAFSKND 178

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ +DD+ + +W+ SN ++           H D+     WH  E  +  S S+D+ 
Sbjct: 179 S-KFVTCADDNVLKIWNFSNGQQER----VLSGHHWDV-KSCDWHP-EMGLIVSASKDNL 231

Query: 252 MKLFDKRSSQIIHN-INTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           ++L+D RS Q I + +N K       F P   NL  A   D    ++DIR     L    
Sbjct: 232 IRLWDPRSGQCISSLLNFKHTVLKTRFQPTKGNLLTAISKDKSCRVFDIRHSMRELMVYR 291

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T +E+ P N+ +   +  D           G+ +  D ++D      ++   H 
Sbjct: 292 DEVDYMT-LEWHPTNETMFTVASYD-----------GSLKHFDILQDLEKPTHVVPYAHD 339

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  ++ NP +  ++ASA +D  ++ W
Sbjct: 340 KCITSLSYNP-VGHILASAAKDRTIRFW 366

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 89/179 (49%), Gaps = 13/179 (7%)

Query: 162 DRSKNGVEALLSTLEYHTENGY-GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTI 220
           D  ++  + L+ T  +H +  + G+  + ++ Y + +G++   I LWD S      +PT 
Sbjct: 157 DEEQSSTDGLIKT--FHGDYAFLGIDHHRSKPYFVTAGAE---INLWDSSR----SRPTA 207

Query: 221 TFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPF 280
                  D ++ VK++ +E  IF S   D+++ L+D R++        +   N L ++P 
Sbjct: 208 NLSWG-ADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFTQRMRTNALCWNPM 266

Query: 281 SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
            +  F  A  D+  Y YD+R++S  L+    H  AV  ++F P  D I+  +GS  +TI
Sbjct: 267 EAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 323

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 64/160 (40%), Gaps = 38/160 (23%)

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
           L+ N NE Y +LS  DD  + LW ++        T  F  +  D                
Sbjct: 123 LSANKNENY-MLSCGDDKTVKLWSVN--------TEDFSSSKNDE--------------E 159

Query: 245 SVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSN 304
             S D  +K F    + +  + +  KPY            F  AG +  + L+D    S 
Sbjct: 160 QSSTDGLIKTFHGDYAFLGIDHHRSKPY------------FVTAGAE--INLWD-SSRSR 204

Query: 305 PLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
           P   ++   D V+ ++F+ N   I  S+GSD   +++DL+
Sbjct: 205 PTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLR 244

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 106/215 (49%), Gaps = 16/215 (7%)

Query: 144 QDDNIIATINGEGKIFIYDRSK-NGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202
            ++ IIA     G + +Y  ++ N   + ++    H+ +   + FNA +   L SG ++ 
Sbjct: 72  HNNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 203 NIALWDISNFEK---NIKPTITFED-AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD-K 257
            I +WD++   +   N  P    +  +  D +N + W+ S AH+F S    +   ++D K
Sbjct: 132 EIFIWDMNKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 258 RSSQIIH------NINTKKPYNTLAFSPFSSNLFA-AAGTDN--LVYLYDIRDVSNPLYA 308
              ++IH      N   K+  + + + P +S   A A G+DN   + ++D+R+ + PL  
Sbjct: 192 AKKEVIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQT 251

Query: 309 MT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWD 342
           +  GH+  + ++++   ++ +L SSG D   ++W+
Sbjct: 252 LNQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 74/162 (45%), Gaps = 20/162 (12%)

Query: 247 SEDSTMKLFD---KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVS 303
           S DS+++L+      S + I ++     +N L +S  ++ + A A  +  + LY   +V+
Sbjct: 37  SSDSSLELWSLLASDSEKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYSTNEVN 95

Query: 304 NPLYAM---TGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPP 360
           + + +M   + H  +V  ++F+   D +L S G++    +WD+         ++  + P 
Sbjct: 96  DAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDM---------NKCTESPA 146

Query: 361 EVLMIHAGHKTS----INDIAVNPNINWLVASAEEDNIVQIW 398
               +  G   S    +N +A N ++  + ASA   N   IW
Sbjct: 147 NYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIW 188

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 90/199 (45%), Gaps = 32/199 (16%)

Query: 195 LLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTM 252
           L+S S D+   +WD+  SN+ +      T   AH   + DVK+ +    +F S   D ++
Sbjct: 238 LISSSIDTTCIVWDLQSSNYVR------TQLIAHDSEVFDVKFLAHSTQLFASCGGDGSV 291

Query: 253 KLFDKRS---SQIIHNINT------------KKPYNTLAFSPFSS--NLFAAAGTDNL-V 294
           ++FD RS   S II+  N+            K P   L   P  S  N+ A    D+  +
Sbjct: 292 RVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALDSKSI 351

Query: 295 YLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQE------IGA 348
            + D+R+  +P+  + GH  AV  I++ P    +L S G D + + WDL E      + A
Sbjct: 352 LILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNEWLSPTSLSA 411

Query: 349 EQTQDEIEDGPPEVLMIHA 367
            + +    DGP     I+A
Sbjct: 412 NENKVNANDGPISGQQINA 430

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 67/151 (44%), Gaps = 22/151 (14%)

Query: 122 SNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL-STLEYHT- 179
           SN    +   HD E+   +++     + A+  G+G + ++D     + +L  ST+ Y + 
Sbjct: 255 SNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFD-----LRSLAHSTIIYESN 309

Query: 180 --ENGY-GLAFNANEKYSLL----SGSDDSNIALWD-------ISNFEKNIKPTITFEDA 225
             +NG   L  N     +LL    S SD + +A +        I +      P +T E  
Sbjct: 310 SDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVLTLE-G 368

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           H+  +N +KWH  ++++  S  +D  +  +D
Sbjct: 369 HSAAVNQIKWHPKKSNVLLSCGDDCQVLYWD 399

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 136 ITRARYMPQDDNIIATINGEGK-IFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYS 194
           + R +  P D N++AT   + K I I D    G   L  TLE H+     + ++  +   
Sbjct: 328 LLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVL--TLEGHSAAVNQIKWHPKKSNV 385

Query: 195 LLSGSDDSNIALWDI 209
           LLS  DD  +  WD+
Sbjct: 386 LLSCGDDCQVLYWDL 400

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/77 (19%), Positives = 36/77 (46%)

Query: 271 PYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILY 330
           P  +  ++P  +NL  ++  D    ++D++  +     +  H+  V  ++F  ++  +  
Sbjct: 224 PVTSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEVFDVKFLAHSTQLFA 283

Query: 331 SSGSDRRTIVWDLQEIG 347
           S G D    V+DL+ + 
Sbjct: 284 SCGGDGSVRVFDLRSLA 300

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
           G    VT+  ++P +  +L SS  D   IVWDLQ     +TQ
Sbjct: 220 GQFPPVTSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQ 261

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 120/274 (43%), Gaps = 25/274 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T   Y    D +I+  + +G I I+  + N V+ L    + HTE    +AF+ N+
Sbjct: 120 HDSSVTTMEYSHDGDWMISG-DSDGIIKIWQANFNMVKELD---DAHTECIRDVAFSGND 175

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               +S SDD+ + +W+ SN     K        H D+     WH  E  +  S S+D+ 
Sbjct: 176 S-KFVSCSDDNILKIWNFSNG----KLERVLSGHHWDV-KSCDWHP-EMGLIISASKDNL 228

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS   +  I   K     + F P   N+ AA   D    ++DIR     L  + 
Sbjct: 229 IKLWDPRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFDIRHSMKELLCVR 288

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T + ++P N+ +      D           G+ +  D ++D      +I   H 
Sbjct: 289 DEVDYMTLL-WNPINESMFTVGNYD-----------GSIKHFDLLQDLTKPTHVIPYAHD 336

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
             +  ++ NP  N ++ASA +D  V+ W  +S I
Sbjct: 337 KCVTSLSYNPMGN-ILASASKDRTVRFWTRASPI 369

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 115/268 (42%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T   Y    D +I+  + +G I I+  + N V+ L      HTE    +AF+ N+
Sbjct: 122 HDTAVTTMEYSRAGDWMISG-DTDGTIKIWQPNFNMVKELDRA---HTECIRDIAFSHND 177

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++           H D+     WH  +  +  S S+D+ 
Sbjct: 178 S-KFVTCSDDNILKIWNFSNGQQER----VLSGHHWDV-KSCDWHP-QMGLIASASKDNL 230

Query: 252 MKLFDKRSSQIIHN-INTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS Q +   +  K       F P   NL AA   D    ++D+R     L    
Sbjct: 231 VKLWDPRSGQCVSTLLKFKHTVLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKELMVTR 290

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T + + P N+ +   +  D           G+ +  D ++D       I   H 
Sbjct: 291 DEVDYMTLL-WHPINETMFTVACYD-----------GSLKNFDILQDTEGPTHTIPYAHD 338

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  ++ NP +  ++ASA +D  ++ W
Sbjct: 339 KCITSLSYNP-VGHILASASKDRTIRFW 365

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 101/207 (48%), Gaps = 33/207 (15%)

Query: 170 ALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDI 229
           +L+ +  + +EN + L    + K+ LL+G  +  I L D S   K+++     E A    
Sbjct: 5   SLVESNSFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWST-GKSVQKIKASETA---- 58

Query: 230 INDVKWHSSE---AHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSS---- 282
           IND+K   S+    H+  S S D+ +K+FD R++  I  I  +      A SPF S    
Sbjct: 59  INDMKVIGSDFSAGHLVSSASIDA-VKVFDIRTNDRIAQIQNE------ANSPFISLDSR 111

Query: 283 -NLFAAA----GTDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDR 336
             L A      G D  VY+YDIR    PL ++   H D VT I+F P++  IL S  +D 
Sbjct: 112 HGLLACGTELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDG 171

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVL 363
            T ++DL+       QDE ED   +V+
Sbjct: 172 YTNIYDLK-------QDEEEDALHQVI 191

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 99/201 (49%), Gaps = 25/201 (12%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            ++GS+D+ + +WD++     ++ T+     H   + D+       ++F SVSED T+K 
Sbjct: 155 FITGSNDTTMKVWDLAT--GKLRTTLA---GHVMTVRDIAISDRHPYLF-SVSEDKTVKC 208

Query: 255 FDKRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHE 313
           +D   +QII +         T++  P + +L A AG D+++ L+DIR    P+  + GH+
Sbjct: 209 WDLEKNQIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDIR-TRVPVITLVGHK 266

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSI 373
             +  ++  P +  I+ SS +D    +WD            +  G    ++ H  HK S+
Sbjct: 267 GPINQVQCTPVDPQIV-SSSTDATVRLWD------------VVAGKAMKVLTH--HKRSV 311

Query: 374 NDIAVNPNINWLVASAEEDNI 394
              A++P   + VASA  D+I
Sbjct: 312 RATALHPK-EFSVASACTDDI 331

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/132 (18%), Positives = 58/132 (43%), Gaps = 17/132 (12%)

Query: 276 AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSD 335
           A  P ++  F     D  + ++D+         + GH   V  I    +    L+S   D
Sbjct: 146 AIDPVNNEWFITGSNDTTMKVWDLA-TGKLRTTLAGHVMTVRDIAIS-DRHPYLFSVSED 203

Query: 336 RRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIV 395
           +    WDL++               +++  + GH + +  ++++P ++ L+A+A  D+++
Sbjct: 204 KTVKCWDLEK--------------NQIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVI 248

Query: 396 QIWKCSSNIPRI 407
           ++W   + +P I
Sbjct: 249 KLWDIRTRVPVI 260

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 101/209 (48%), Gaps = 37/209 (17%)

Query: 170 ALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIAL--WDISNFEKNIKPTITFEDAHT 227
           +L+ +  + +EN + L    + KY LL+G  +  I L  W+     + IK + T      
Sbjct: 5   SLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETS----- 58

Query: 228 DIINDVKWHSSE---AHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSS-- 282
             IND+K   S+    H+  S S D+ +K+FD R++  +  I+ +      A SPF S  
Sbjct: 59  --INDLKVIDSDFAAGHLVSSASIDA-VKVFDIRTNACVAKIHNE------ANSPFISLD 109

Query: 283 ---NLFAAA----GTDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGS 334
               L A      G D  VY+YDIR    PL ++   H D VT I+F P++  +L S  +
Sbjct: 110 SRHGLLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGST 169

Query: 335 DRRTIVWDLQEIGAEQTQDEIEDGPPEVL 363
           D  T ++DL+       QDE ED   +V+
Sbjct: 170 DGYTNIYDLK-------QDEEEDALHQVI 191

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 95/207 (45%), Gaps = 29/207 (14%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFED--AHTDIINDVKWHSSEAHIFGSVSEDSTM 252
           LLSG  D+ + LWD++        + +FE+   H   ++ VK H S   +  S S D T 
Sbjct: 230 LLSGGGDNLVKLWDMT--------SNSFEELRGHAGRVSRVKVHPS-GRLAASASFDLTW 280

Query: 253 KLFD-KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTG 311
            L+D +R  ++       K   T+AF      L A+AG D +  ++D+R    P+  + G
Sbjct: 281 ILWDLERKVELQLQEGHSKAVYTIAFQS-DGALLASAGLDAVCAIWDLRS-GEPIMKLEG 338

Query: 312 HEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKT 371
           H  A++ +++ PN    L ++G+D    VWD++ +G E             L+    H+ 
Sbjct: 339 HAGAISGVDWSPNGY-QLATAGADGTVRVWDIRNVGTESA-----------LL---AHQV 383

Query: 372 SINDIAVNPNINWLVASAEEDNIVQIW 398
           +  D+    N    + S   D +V I+
Sbjct: 384 AALDVKFKKNNGTFLVSCGHDRLVNIF 410

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 90/207 (43%), Gaps = 15/207 (7%)

Query: 131 PHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNAN 190
            H+G+I    + P D N + +  G+  + ++D + N  E     L  H      +  + +
Sbjct: 213 AHEGKIGGLDWHP-DGNHLLSGGGDNLVKLWDMTSNSFE----ELRGHAGRVSRVKVHPS 267

Query: 191 EKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDS 250
            + +  S S D    LWD+       K  +  ++ H+  +  + + S  A +  S   D+
Sbjct: 268 GRLAA-SASFDLTWILWDLER-----KVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDA 320

Query: 251 TMKLFDKRSSQIIHNINTKK-PYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAM 309
              ++D RS + I  +       + + +SP    L A AG D  V ++DIR+V     A+
Sbjct: 321 VCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQL-ATAGADGTVRVWDIRNVGTE-SAL 378

Query: 310 TGHEDAVTAIEFDPNNDGILYSSGSDR 336
             H+ A   ++F  NN   L S G DR
Sbjct: 379 LAHQVAALDVKFKKNNGTFLVSCGHDR 405

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 101/204 (49%), Gaps = 26/204 (12%)

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           +GS+D+ + +WD+++    +K T+     H   + DV       ++F S SED  +K +D
Sbjct: 133 TGSNDTTVKIWDLAS--GKLKLTLA---GHVMTVRDVAISQRHPYLF-SASEDKMVKCWD 186

Query: 257 KRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDA 315
              +QII + +      +T+   P + +L A+AG D +V L+DIR     +  + GH+  
Sbjct: 187 LEKNQIIRDYHGHLSGVHTVDIHP-TLDLIASAGRDGVVKLWDIRS-RTAVMTLIGHKSP 244

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSIND 375
           +T +   P N  ++ SS +D    +WD            +  G    ++ H  HK S+ D
Sbjct: 245 ITKVHCLPVNPQVV-SSSTDATVRLWD------------VTAGKSYKILTH--HKRSVRD 289

Query: 376 IAVNPNINWLVASAEEDNIVQIWK 399
            +++P+   +V++  +D  ++ WK
Sbjct: 290 FSLHPSEFSMVSACTDD--IRSWK 311

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/266 (20%), Positives = 106/266 (39%), Gaps = 43/266 (16%)

Query: 145 DDNIIATINGEGKIFIYDRSK-NGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSN 203
           D + + +ING      Y R + N     L+ +  H +  +       EKY  ++G     
Sbjct: 3   DVDTLESING-----FYSRVRWNNQFKQLTIVPKHLQTVFDGRKTVLEKYQDIAGR---- 53

Query: 204 IALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS--- 260
                 SN     K  +  E+ H ++++ V    S +H      E    +L  +R +   
Sbjct: 54  ------SNGIDESKSLVKSENDHQNMLSQVFGQDSASHSVLQRQE----QLLSQRPAWHA 103

Query: 261 --QIIHNINTKKPY-NTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVT 317
             ++I  IN    +   L   P  +  FA    D  V ++D+      L  + GH   V 
Sbjct: 104 PWKLIRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDLASGKLKL-TLAGHVMTVR 162

Query: 318 AIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIA 377
            +     +   L+S+  D+    WDL++               +++  + GH + ++ + 
Sbjct: 163 DVAISQRHP-YLFSASEDKMVKCWDLEK--------------NQIIRDYHGHLSGVHTVD 207

Query: 378 VNPNINWLVASAEEDNIVQIWKCSSN 403
           ++P ++ L+ASA  D +V++W   S 
Sbjct: 208 IHPTLD-LIASAGRDGVVKLWDIRSR 232

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 113/268 (42%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  IT  +Y    D +I+  + +G I I+  + N V+ L      HTE    +AF+AN+
Sbjct: 123 HDSSITTMQYSHMGDWLISG-DADGGIKIWQPNFNMVKELDGA---HTECIRDVAFSAND 178

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               +S SDD+ + +W+ +N ++    T      H   +    WH +   +  S S+D+ 
Sbjct: 179 S-KFVSCSDDNILKIWNFTNGQQERVLT-----GHHWDVKSCDWHPTMG-LIASASKDNL 231

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D R+   +  I   K       F P   NL      D    ++DIR     L    
Sbjct: 232 VKLWDPRTGNCVSTILKFKHTVLKTRFQPGGGNLLLGISKDKSCRVFDIRQNMTELMVFR 291

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T + + P N         D           G+ +  D ++D    V +I   H 
Sbjct: 292 DDVDYMTLL-WHPINHSTFTVGNYD-----------GSIKHFDVLQDITKPVHVIPFAHD 339

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             +  ++ NP  N ++ASA +D  ++ W
Sbjct: 340 KCVTSLSYNPAGN-ILASASKDRTIRFW 366

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 104/243 (42%), Gaps = 29/243 (11%)

Query: 171 LLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTD 228
           L  TLE H  NG+   LA +A +   LLS S D  +  W ++  +K     +     H  
Sbjct: 9   LRGTLEGH--NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNH 66

Query: 229 IINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPFSSNLFAA 287
           I+ D    +  A+   S S D T++L+D  + Q     +  K    ++A    +S + + 
Sbjct: 67  IVQDCSLTADGAYAL-SASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAIDRKASMIISG 125

Query: 288 AGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDG-----ILYSSGSDRRTIVWD 342
           +  D  V ++ IR     L  M GH D V+ +   P  D       + S+G D+    W+
Sbjct: 126 S-RDRTVKVWTIR--GQCLATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWN 182

Query: 343 LQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           + +   E   D I            GH   +N I  +P+ + LVASA +D  + +W  + 
Sbjct: 183 VNQFQIE--ADFI------------GHNNYVNTITASPDGS-LVASAGKDGEIMLWNLAD 227

Query: 403 NIP 405
            +P
Sbjct: 228 KVP 230

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 86/401 (21%), Positives = 161/401 (40%), Gaps = 45/401 (11%)

Query: 42  PMLYDFVSETRLTWPTLTVEWLPQKNLVAARTR--QQLILGTHTSGEEQN-----YLKIG 94
           P +Y+ +    L WP +T++ +P  NL + R    Q +++ T T   ++       LK+ 
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPD-NLGSERRNYPQSILMTTATQASKKKDNELLVLKLS 183

Query: 95  --AVDLPVEVTENSKKXXXXXXXXXXMVLSNVKIVKKFPHDGEITRARYMPQDDNIIATI 152
             A  L  +  + ++            ++ N  I K       +  + +  +   ++A  
Sbjct: 184 QLAKTLAKDEDDGAEDDEDDEDEDADPIIENENI-KLRDTTNRMQVSPFAAESQEVLAAT 242

Query: 153 ---NGEGKIF-------IYDRSKNGVEALLSTLEYHTEN-----GYGLAFNANEKYSLLS 197
              NGE  IF        +      V       +Y  +N     GYGL ++   K   L 
Sbjct: 243 MSENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGALL 302

Query: 198 GSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDK 257
             D S           K I     F   +   I D+KW  SE  +F +   D  ++++D 
Sbjct: 303 TGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVRIWDI 362

Query: 258 RSSQIIHNINTK---KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSN------PLYA 308
           RS +    ++ K      N ++++   S L A    +    ++D+R  SN      P+  
Sbjct: 363 RSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVSPVAQ 422

Query: 309 MTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------QEIGAEQTQ-DEIEDGPPE 361
              H+ A+T+I F+P ++ I+  +  D    +WDL      +EI  +  +  E++  PP+
Sbjct: 423 YDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVKELQQIPPQ 482

Query: 362 VLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +L +H   +  + D+  +  I   + S   D +  +WK  S
Sbjct: 483 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWKTIS 520

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 92/200 (46%), Gaps = 17/200 (8%)

Query: 159 FIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKP 218
           F   R +  V    + +  HT     + FNA +    +SG     I +WD +        
Sbjct: 87  FFCARERRSV----ARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYS 142

Query: 219 TITFEDAHTDI--INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLA 276
                 A T I  +  + W+ S AH+F S        ++D ++ + + +++   P++ L 
Sbjct: 143 PFGPGTAMTPIDEVQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPHSGLK 202

Query: 277 -------FSPFSSNLFA-AAGTDN--LVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNN 325
                  + P +S   A A G DN  ++ ++D+R+ + PL  M+ GH   + ++++  ++
Sbjct: 203 NQLAVVEWHPSNSTRVATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLDWCKHD 262

Query: 326 DGILYSSGSDRRTIVWDLQE 345
           + ++ SSG D   I+W+ +E
Sbjct: 263 EKLMLSSGRDNTCILWNPEE 282

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 68/148 (45%), Gaps = 13/148 (8%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIAL-WDISNFEKNIKPT 219
           Y    +G++  L+ +E+H  N        + + +  +G+D+  + L WD+ N      P 
Sbjct: 194 YTSPHSGLKNQLAVVEWHPSN--------STRVATATGNDNEPVILVWDLRNANM---PL 242

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYN-TLAFS 278
                 H+  I  + W   +  +  S   D+T  L++   +Q +    T+  +     F+
Sbjct: 243 QVMSQGHSKGILSLDWCKHDEKLMLSSGRDNTCILWNPEEAQKLTQYPTRGNWCFKTKFA 302

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
           P + +LFA+A  DN + +  +++++N L
Sbjct: 303 PEAPDLFASASFDNKIQVQTLQNLANKL 330

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 99/201 (49%), Gaps = 25/201 (12%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            ++GS+D+ + +WD++     +K T+     H   + DV       ++F SVSED T+K 
Sbjct: 155 FITGSNDTTMKVWDLAT--GKLKTTLA---GHVMTVRDVAVSDRHPYLF-SVSEDKTVKC 208

Query: 255 FDKRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHE 313
           +D   +QII +         T++  P + +L A AG D+++ L+D+R    P+  + GH+
Sbjct: 209 WDLEKNQIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDMR-TRIPVITLVGHK 266

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSI 373
             +  ++  P +  ++ SS +D    +WD            +  G    ++ H  HK S+
Sbjct: 267 GPINQVQCTPVDPQVV-SSSTDATVRLWD------------VVAGKTMKVLTH--HKRSV 311

Query: 374 NDIAVNPNINWLVASAEEDNI 394
              A++P   + VASA  D+I
Sbjct: 312 RATALHPK-EFSVASACTDDI 331

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/135 (18%), Positives = 58/135 (42%), Gaps = 17/135 (12%)

Query: 273 NTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSS 332
             +A  P  +  F     D  + ++D+         + GH   V  +    +    L+S 
Sbjct: 143 RCVAIDPVDNEWFITGSNDTTMKVWDLA-TGKLKTTLAGHVMTVRDVAVS-DRHPYLFSV 200

Query: 333 GSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEED 392
             D+    WDL++               +++  + GH + +  ++++P ++ L+A+A  D
Sbjct: 201 SEDKTVKCWDLEK--------------NQIIRDYYGHLSGVRTVSIHPTLD-LIATAGRD 245

Query: 393 NIVQIWKCSSNIPRI 407
           +++++W   + IP I
Sbjct: 246 SVIKLWDMRTRIPVI 260

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 81/168 (48%), Gaps = 20/168 (11%)

Query: 195 LLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTM 252
           L+S S D+   +WD+  SN+ K      T   AH   + DV++ +    +F S   D ++
Sbjct: 248 LISSSIDTTCIVWDLQSSNYVK------TQLIAHDSEVYDVRFLTQSTQLFASCGGDGSV 301

Query: 253 KLFDKRS---SQIIHN--INTKKPYNT------LAFSPFSSNLFAAAGTD-NLVYLYDIR 300
           ++FD RS   S II+   ++   P  +      L  SP   N+ A    D N + + D+R
Sbjct: 302 RVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMR 361

Query: 301 DVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGA 348
           +  +PL  + GH  +V  I++ P    +L S G D + + WDL +  A
Sbjct: 362 NPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTA 409

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 80/181 (44%), Gaps = 12/181 (6%)

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN--INTKKPYNTLAFSPFSSNLFAA 287
           I    W+  + ++  S S D+T  ++D +SS  +    I        + F   S+ LFA+
Sbjct: 235 ITSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTQSTQLFAS 294

Query: 288 AGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIG 347
            G D  V ++D+R ++   ++   +E  V+ +  D +   +L    S     V  +    
Sbjct: 295 CGGDGSVRVFDLRSLA---HSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNV--MATFA 349

Query: 348 AEQTQDEIED--GPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW---KCSS 402
           A+  +  I D   P   LMI  GH  S+N I  +P    ++ S  +D  V  W   KC++
Sbjct: 350 ADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTA 409

Query: 403 N 403
           +
Sbjct: 410 S 410

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 136 ITRARYMPQDDNIIATINGEG-KIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYS 194
           + R    P D N++AT   +  KI I D      E+ L  LE H+ +   + ++  ++  
Sbjct: 332 LLRLEPSPHDPNVMATFAADSNKILILD--MRNPESPLMILEGHSASVNQIKWHPIKRNV 389

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFED 224
           LLSG DD  +  WD++    +  P  T +D
Sbjct: 390 LLSGGDDCQVLYWDLNKCTASSDPVATTKD 419

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 63/143 (44%), Gaps = 12/143 (8%)

Query: 122 SNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYD-----RSKNGVEALLSTLE 176
           SN    +   HD E+   R++ Q   + A+  G+G + ++D      S    E  +S L 
Sbjct: 265 SNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLN 324

Query: 177 YHTENGYGLAF--NANEKYSLLSGSDDSN-IALWDISNFEKNIKPTITFEDAHTDIINDV 233
             T     L    + ++   + + + DSN I + D+ N E    P +  E  H+  +N +
Sbjct: 325 PDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMRNPE---SPLMILE-GHSASVNQI 380

Query: 234 KWHSSEAHIFGSVSEDSTMKLFD 256
           KWH  + ++  S  +D  +  +D
Sbjct: 381 KWHPIKRNVLLSGGDDCQVLYWD 403

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/77 (19%), Positives = 34/77 (44%)

Query: 271 PYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILY 330
           P  +  ++P  +NL  ++  D    ++D++  +     +  H+  V  + F   +  +  
Sbjct: 234 PITSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTQSTQLFA 293

Query: 331 SSGSDRRTIVWDLQEIG 347
           S G D    V+DL+ + 
Sbjct: 294 SCGGDGSVRVFDLRSLA 310

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 308 AMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
           ++ G    +T+  ++P +  +L SS  D   IVWDLQ     +TQ
Sbjct: 227 SVLGELPPITSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQ 271

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 96/198 (48%), Gaps = 29/198 (14%)

Query: 177 YHTENGYGLAFNANEKYSLLSGSDDSNIAL--WDISNFEKNIKPTITFEDAHTDIINDVK 234
           + +EN + L    + K+ LL+G  +  I L  W      +NIK + T        IND+K
Sbjct: 12  FGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASET-------AINDLK 63

Query: 235 WHSSE---AHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT- 290
              S+    H+  S S D+ +K+FD R++  I  I  +   N+   S  S +   A GT 
Sbjct: 64  VIDSDFSAGHLVSSASIDA-VKVFDIRTNSCIATIQNES--NSPFLSLDSRHGLLACGTE 120

Query: 291 ----DNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQE 345
               D  V++YDIR    PL ++   H D VT I+F P++  IL S  +D  T ++DL+ 
Sbjct: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLK- 179

Query: 346 IGAEQTQDEIEDGPPEVL 363
                 QDE ED   +V+
Sbjct: 180 ------QDEEEDALHQVI 191

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 116/243 (47%), Gaps = 27/243 (11%)

Query: 157 KIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNI 216
           K+F Y+  KN + ++  TL+ H      +  +   KY L S S D+   LWDI       
Sbjct: 256 KVFGYE--KNDLTSI-DTLKGHQGRVSDVKLHPLGKY-LGSSSFDNTWRLWDIEK----- 306

Query: 217 KPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTL 275
           K  I  ++ H+  I  + +H+ +  +  +   DS   ++D RS + I N I   KP  +L
Sbjct: 307 KKEILLQEGHSKEIFSLAFHT-DGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSL 365

Query: 276 AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSD 335
            ++P    L   +G D  + ++D+R+  +   ++  H++ VT+++++ NN G ++S+G D
Sbjct: 366 DWAPNGYQLATGSG-DGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYD 424

Query: 336 RRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIV 395
           +   + D +   +  T +              GH   I  +  +P I+ L+ S+  D  V
Sbjct: 425 KLIKIHDSKTYESVATLE--------------GHTEKILTLDTSP-ISNLIVSSGWDRTV 469

Query: 396 QIW 398
           +IW
Sbjct: 470 KIW 472

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 93/209 (44%), Gaps = 30/209 (14%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           L SGS D  I++ D  N E+       F+ AH   I  ++W + EA++F +  ED  +K+
Sbjct: 203 LASGSWDGAISIVDNMNLERKTH----FQAAHVGKIGGIEWSNDEAYLF-TGGEDCLVKV 257

Query: 255 FDKRSSQIIHNINTKKPY----NTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           F    + +  +I+T K +    + +   P    L  ++  DN   L+DI +    +    
Sbjct: 258 FGYEKNDLT-SIDTLKGHQGRVSDVKLHPLGKYL-GSSSFDNTWRLWDI-EKKKEILLQE 314

Query: 311 GHEDAVTAIEFDPNNDGIL-YSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGH 369
           GH   + ++ F  + DG L  ++G D   ++WDL+                + +M   GH
Sbjct: 315 GHSKEIFSLAF--HTDGSLTATAGFDSIGMIWDLR--------------SGKNIMNLIGH 358

Query: 370 KTSINDIAVNPNINWLVASAEEDNIVQIW 398
              I  +   PN  + +A+   D  ++IW
Sbjct: 359 AKPIYSLDWAPN-GYQLATGSGDGTIKIW 386

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 105/209 (50%), Gaps = 26/209 (12%)

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           +GS+D++I +WD+++    +K T++    H   + D+       ++F S SED T+K +D
Sbjct: 140 TGSNDTSIKVWDLAS--GKLKLTLS---GHIMTVRDLAISERHPYMF-SASEDKTIKCWD 193

Query: 257 KRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDA 315
              + +I N +      +T++  P + +L  +AG D++V L+D+R    P+  + GH+  
Sbjct: 194 LEKNMVIRNYHGHLSGVHTVSLHP-TLDLVVSAGRDSVVKLWDMR-TRVPVMNLIGHKSP 251

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSIND 375
           +  +   P +  I+ S  +D    +WD            I  G    ++ H  HK S+ D
Sbjct: 252 INKVRCLPVDPQII-SCSTDANIRLWD------------ITAGKSAKILTH--HKRSVRD 296

Query: 376 IAVNPNINWLVASAEEDNIVQIWKCSSNI 404
            A++P+  + +ASA  D+I + WK    I
Sbjct: 297 FALHPS-EFSMASACTDDI-RSWKLPEGI 323

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 17/100 (17%)

Query: 306 LYAMTGHEDAVTAIEFDPNNDGILYSSGS-DRRTIVWDLQEIGAEQTQDEIEDGPPEVLM 364
           +  + GH   V  +E DP  D   Y++GS D    VWDL                 ++ +
Sbjct: 115 IRVINGHIGWVRCVEVDPV-DNAWYATGSNDTSIKVWDL--------------ASGKLKL 159

Query: 365 IHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
             +GH  ++ D+A++    ++  SA ED  ++ W    N+
Sbjct: 160 TLSGHIMTVRDLAISERHPYMF-SASEDKTIKCWDLEKNM 198

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 103/204 (50%), Gaps = 26/204 (12%)

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           +GS+D+ I +WD++  +  +K T++    H   + D+       ++F S SED  +K +D
Sbjct: 147 TGSNDTTIKIWDLATGK--LKLTLS---GHIMTVKDICISKRHPYMF-SASEDKLVKCWD 200

Query: 257 KRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDA 315
              +++I + +      +T+   P + NL A AG D++V L+DIR    P+  M GH+  
Sbjct: 201 LEKNRVIRDYHGHLSGVHTVDIHP-TLNLIATAGRDSVVRLWDIR-TKLPVMTMAGHKSP 258

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSIND 375
           +  ++  P +  ++ S  +D    +WD   I A +T           L +   HK S+ D
Sbjct: 259 INRVKCLPVDPQVV-SCSADATVRLWD---ITAGKT-----------LKVLTHHKRSVRD 303

Query: 376 IAVNPNINWLVASAEEDNIVQIWK 399
           I ++P   + ++SA  D+I + WK
Sbjct: 304 IGIHPG-EFSISSACTDDI-RSWK 325

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 61/132 (46%), Gaps = 17/132 (12%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
           T+A  P  +  FA    D  + ++D+      L  ++GH   V  I     +   ++S+ 
Sbjct: 134 TVAVDPIDNEWFATGSNDTTIKIWDLATGKLKL-TLSGHIMTVKDICISKRHP-YMFSAS 191

Query: 334 SDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDN 393
            D+    WDL++                V+  + GH + ++ + ++P +N L+A+A  D+
Sbjct: 192 EDKLVKCWDLEK--------------NRVIRDYHGHLSGVHTVDIHPTLN-LIATAGRDS 236

Query: 394 IVQIWKCSSNIP 405
           +V++W   + +P
Sbjct: 237 VVRLWDIRTKLP 248

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 106/230 (46%), Gaps = 22/230 (9%)

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
           + F+ + K+ L +G++D  I +WDI+  +K I   +  +    DI +   + S +  + G
Sbjct: 442 VCFSPDGKF-LATGAEDRLIRIWDIA--QKKI--VMVLQGHEQDIYSLDYFPSGDKLVSG 496

Query: 245 SVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIR---- 300
           S   D T++++D R+ Q    ++ +    T+A S       AA   D  V ++D      
Sbjct: 497 S--GDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFL 554

Query: 301 ----DVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS-DRRTIVWDLQEIGAEQTQDEI 355
               D  N L   TGH+D+V ++ F  +  G++  SGS DR   +W+L   G   T  E 
Sbjct: 555 VERLDSENEL--GTGHKDSVYSVVFTRDGHGVV--SGSLDRSVKLWNLSS-GQNNTNAET 609

Query: 356 EDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
           +  P    + + GHK  +  +A   N  +++ S  +D  V  W   S  P
Sbjct: 610 KPAPGTCEVTYTGHKDFVLSVATTRNDEYIL-SGSKDRGVLFWDTKSGNP 658

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 91/195 (46%), Gaps = 27/195 (13%)

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204
           D+ +I + NG  K F      +G  A L  +++H  N            + ++G   + I
Sbjct: 157 DEEVIKSGNGLIKTF------HGEHAFLG-IDHHRSNS-----------NFVTGG--AEI 196

Query: 205 ALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIH 264
            LWD +      +P IT      D ++ VK++ +E  IF S   D+++ L+D R++    
Sbjct: 197 NLWDSTR----SRP-ITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQ 251

Query: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324
               K   N L ++P  +  F  A  D+  Y YD+R++S  L+    H  AV  ++F P 
Sbjct: 252 KFVQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPT 311

Query: 325 NDGILYSSGSDRRTI 339
            D I+  +GS  +TI
Sbjct: 312 GDEIV--TGSYDKTI 324

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 25/42 (59%)

Query: 303 SNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
           S P+  ++   D V+ ++F+ N   I  S+GSD   +++DL+
Sbjct: 204 SRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLR 245

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 98/201 (48%), Gaps = 25/201 (12%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            ++GS+D+ + +WD++     +K T+     H   + D+       ++F SVSED T+K 
Sbjct: 155 FVTGSNDTTMKVWDLAT--GKLKTTLA---GHVMTVRDIAVSDRHPYLF-SVSEDKTVKC 208

Query: 255 FDKRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHE 313
           +D   + II +         T++  P + +L A AG D++V L+DIR    P+  + GH+
Sbjct: 209 WDLEKNHIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVVKLWDIR-TRMPVITLVGHK 266

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSI 373
             +  ++  P +  I+ SS +D    +WD            I  G    ++ H  HK S+
Sbjct: 267 GPINQVQCTPVDPQIV-SSSTDATVRLWD------------IVAGKAMKVLTH--HKRSV 311

Query: 374 NDIAVNPNINWLVASAEEDNI 394
              A++P   + +ASA  D+I
Sbjct: 312 RATALHPK-EFSLASACTDDI 331

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/132 (19%), Positives = 56/132 (42%), Gaps = 17/132 (12%)

Query: 276 AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSD 335
           A  P  +  F     D  + ++D+         + GH   V  I    +    L+S   D
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLA-TGKLKTTLAGHVMTVRDIAVS-DRHPYLFSVSED 203

Query: 336 RRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIV 395
           +    WDL++                ++  + GH + +  ++++P ++ L+A+A  D++V
Sbjct: 204 KTVKCWDLEK--------------NHIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVV 248

Query: 396 QIWKCSSNIPRI 407
           ++W   + +P I
Sbjct: 249 KLWDIRTRMPVI 260

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 115/269 (42%), Gaps = 25/269 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T   Y    D +I+  + +G I I+  + N V+ L    + H E    ++F+  +
Sbjct: 122 HDSAVTTMEYSHAGDWLISG-DSDGIIKIWQPNFNMVKVLD---QAHMECVRDVSFSGTD 177

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++           H D+     WH +   I  S S+D+ 
Sbjct: 178 S-KFVTCSDDNILKIWNFSNGQQER----VLSGHHWDV-KSCDWHPTMGLIV-SGSKDNL 230

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS Q I  I   K       F P   NL A    D    ++DIR     L +  
Sbjct: 231 IKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFR 290

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWD-LQEIGAEQTQDEIEDGPPEVLMIHAGH 369
              D + ++ + P N+ I      D     +D LQ+ G+  +  +I             H
Sbjct: 291 DESDYM-SLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHDIP----------YAH 339

Query: 370 KTSINDIAVNPNINWLVASAEEDNIVQIW 398
              I  ++ NP +  ++ASA +D  ++ W
Sbjct: 340 DKCITSLSYNP-VGHILASASKDRTIRFW 367

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 84/174 (48%), Gaps = 11/174 (6%)

Query: 166 NGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           N  E ++ T  +H E+ +    +  +K + ++G   + I LWD      N    I+    
Sbjct: 160 NTDEGIIKT--FHGEHAFQSLDHHRQKSNFVTGG--AQIELWDT-----NRSKPISNLSW 210

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLF 285
             D IN V+++ +E  I  S   D+++ L+D R++     I      N++ ++P  +  F
Sbjct: 211 GADNINHVRFNQNEVDILASTGSDNSVVLYDLRTNSPTQKIVQTMRTNSICWNPVEAFNF 270

Query: 286 AAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
             A  D+  Y YD+R++S  L+    H  AV  ++F P  D ++  +GS  +TI
Sbjct: 271 VIANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSPTGDEVV--TGSYDKTI 322

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 82/203 (40%), Gaps = 45/203 (22%)

Query: 147 NIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLA-----FNANEKYSLLSGSDD 201
           N +AT +G+G I  ++ S       LS+ + H     GL       +   +  +LS  DD
Sbjct: 81  NKLATASGDGVIKYWNMS---TREELSSFKAHYGMVTGLCVTPSYLSPQRENFMLSCGDD 137

Query: 202 SNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ 261
             + LW +++            D  +++ +D + ++ E                      
Sbjct: 138 KTVKLWSVNS------------DDFSNVKDDTRLNTDEG--------------------- 164

Query: 262 IIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF 321
           II   + +  + +L      SN F   G    + L+D  + S P+  ++   D +  + F
Sbjct: 165 IIKTFHGEHAFQSLDHHRQKSN-FVTGGAQ--IELWDT-NRSKPISNLSWGADNINHVRF 220

Query: 322 DPNNDGILYSSGSDRRTIVWDLQ 344
           + N   IL S+GSD   +++DL+
Sbjct: 221 NQNEVDILASTGSDNSVVLYDLR 243

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 103/211 (48%), Gaps = 14/211 (6%)

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204
           D+  IA     G I ++  S + + ++ + L  HT +   L FN+ ++  L+SGS+   I
Sbjct: 73  DNKTIAGALDNGIIELFYLSNDQLTSV-AKLTTHTSSVKTLKFNSKQENVLVSGSNKGEI 131

Query: 205 ALWDISNFEKNIKPTITFEDAHTDI--INDVKWHSSEAHIFGSVSEDSTMKLFD-KRSSQ 261
            +WD +  ++     +T   A T +  I  + W+ S AH+F S        ++D K   +
Sbjct: 132 FVWDTNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAKKE 191

Query: 262 IIHNINT------KKPYNTLAFSPFSSNLFA-AAGTDN--LVYLYDIRDVSNPLYAM-TG 311
           +IH   T      K   + + + P +S   A A G DN   + ++D+R+ + PL  +  G
Sbjct: 192 VIHLSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQG 251

Query: 312 HEDAVTAIEFDPNNDGILYSSGSDRRTIVWD 342
           H   + ++++   ++ ++ SSG D   ++W+
Sbjct: 252 HSKGIISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 68/148 (45%), Gaps = 13/148 (8%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD-DSNIALWDISNFEKNIKPT 219
           Y     G+++ LS +E+H  N   +A          +G+D D +I +WD+ N      P 
Sbjct: 197 YTSPATGLKSQLSVVEWHPNNSTRVA--------TATGNDNDPSILVWDLRNANT---PL 245

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYN-TLAFS 278
              +  H+  I  + W   +  +  S   D+T+ L++  S + +    T+  +     F+
Sbjct: 246 QVLDQGHSKGIISLDWCHEDESLMLSSGRDNTVLLWNPESGEKLSQFPTRSNWCFKTKFA 305

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
           P   ++FA+A  DN + +  ++++ N L
Sbjct: 306 PAMPDIFASASFDNKIEVQTLQNLVNTL 333

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 65/137 (47%), Gaps = 8/137 (5%)

Query: 219 TITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIH---NINTKKPYNTL 275
           T TF  +H D I  +   ++   I  + S DS ++L+   S+  +    +I+T   +N L
Sbjct: 10  TATFAWSH-DKIPRLITGTASGTIDANFSSDSVLELWSLLSTDTVKPVASISTDTKFNDL 68

Query: 276 AFSPFSSNLFAAAGTDNLVYLYDI-RDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS 334
            +S + +   A A  + ++ L+ +  D    +  +T H  +V  ++F+   + +L S  +
Sbjct: 69  DWS-YDNKTIAGALDNGIIELFYLSNDQLTSVAKLTTHTSSVKTLKFNSKQENVLVSGSN 127

Query: 335 DRRTIVWDLQEIGAEQT 351
                VWD  +  A+QT
Sbjct: 128 KGEIFVWDTNK--AKQT 142

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 107/242 (44%), Gaps = 28/242 (11%)

Query: 164 SKNGVEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT 221
           S N V  L  TLE H  NG+   LA +A +   LLSGS D  +  W ++  ++     + 
Sbjct: 2   SSNEVLVLRGTLEGH--NGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVR 59

Query: 222 FEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPF 280
               H+ I+ D       A+   S S D T++L+D  + +     +  K    ++A    
Sbjct: 60  SFKGHSHIVQDCTLTQDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRK 118

Query: 281 SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP---NNDGI-LYSSGSDR 336
           +S + + +  D  + ++ I+     L  + GH D V+ +   P   N+D + + S+G+D+
Sbjct: 119 ASMIISGS-RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDK 175

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQ 396
               W+L +   E                  GH  ++N +  +P+   L+ASA +D  + 
Sbjct: 176 MVKAWNLNQFQIEAD--------------FVGHNGNVNAVTASPDGT-LIASAGKDGEIM 220

Query: 397 IW 398
           +W
Sbjct: 221 LW 222

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 107/242 (44%), Gaps = 28/242 (11%)

Query: 164 SKNGVEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT 221
           S N V  L  TLE H  NG+   LA +A +   LLSGS D  +  W ++  ++     + 
Sbjct: 2   SSNEVLVLRGTLEGH--NGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVR 59

Query: 222 FEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPF 280
               H+ I+ D       A+   S S D T++L+D  + +     +  K    ++A    
Sbjct: 60  SFKGHSHIVQDCTLTQDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRK 118

Query: 281 SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP---NNDGI-LYSSGSDR 336
           +S + + +  D  + ++ I+     L  + GH D V+ +   P   N+D + + S+G+D+
Sbjct: 119 ASMIISGS-RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDK 175

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQ 396
               W+L +   E                  GH  ++N +  +P+   L+ASA +D  + 
Sbjct: 176 MVKAWNLNQFQIEAD--------------FVGHNGNVNTVTASPDGT-LIASAGKDGEIM 220

Query: 397 IW 398
           +W
Sbjct: 221 LW 222

>KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {ON}
           Anc_5.429 YDR364C
          Length = 439

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 108/245 (44%), Gaps = 18/245 (7%)

Query: 130 FPHDGEITRARYMPQDDNI-IATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFN 188
           +  DG+++R   +P D +I +       K ++  R K            H+     + F 
Sbjct: 103 YGEDGDLSRLLEVPSDLDIDLKKKPLSFKCYLPKRIKYKFSG-------HSSGTTCMKFI 155

Query: 189 ANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSE 248
            N  +  LSG +D+ + +WD  +  K+++        HT  I  + + + +AH F + S 
Sbjct: 156 PNTGHLFLSGGNDNIVKIWDFYHDRKSLRDY----RGHTKAIKSMSF-NDDAHNFITSSF 210

Query: 249 DSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYA 308
           D T+KL+D  + Q+   +  K   N + F P +++ F     D+ +  YD R+ S     
Sbjct: 211 DQTVKLWDTETGQVKKRLKFKSTPNCVEFRPANNHEFIVGLADSKIAHYDTRESSKHGLV 270

Query: 309 MT--GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ-EIGAEQTQDEIEDGPPEVLMI 365
            T   H  ++ ++ F P+    + SS  D+   +W+ Q  I  +Q  D  +   P  + I
Sbjct: 271 QTYDHHLGSILSLRFFPDGSKFI-SSSEDKTVRIWENQINIPIKQISDTTQYSMP-FIGI 328

Query: 366 HAGHK 370
           H  HK
Sbjct: 329 HPEHK 333

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 66/163 (40%), Gaps = 33/163 (20%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
            + F P + +LF + G DN+V ++D       L    GH  A+ ++ F+ +    + SS 
Sbjct: 151 CMKFIPNTGHLFLSGGNDNIVKIWDFYHDRKSLRDYRGHTKAIKSMSFNDDAHNFITSS- 209

Query: 334 SDRRTIVWDLQ------EIGAEQTQDEIEDGPPE-------------------------V 362
            D+   +WD +       +  + T + +E  P                           +
Sbjct: 210 FDQTVKLWDTETGQVKKRLKFKSTPNCVEFRPANNHEFIVGLADSKIAHYDTRESSKHGL 269

Query: 363 LMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
           +  +  H  SI  +   P+ +  ++S+E D  V+IW+   NIP
Sbjct: 270 VQTYDHHLGSILSLRFFPDGSKFISSSE-DKTVRIWENQINIP 311

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 38/92 (41%), Gaps = 14/92 (15%)

Query: 307 YAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIH 366
           Y  +GH    T ++F PN   +  S G+D    +WD                  + L  +
Sbjct: 140 YKFSGHSSGTTCMKFIPNTGHLFLSGGNDNIVKIWDFYH-------------DRKSLRDY 186

Query: 367 AGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            GH  +I  ++ N + +  + S+  D  V++W
Sbjct: 187 RGHTKAIKSMSFNDDAHNFITSS-FDQTVKLW 217

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 80/170 (47%), Gaps = 25/170 (14%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++S S D+   +WD+ +    +K  +    AH   + DV++ +    +F S   D ++++
Sbjct: 259 IISSSIDTTCIVWDLQS-SHYVKTQLI---AHDSEVFDVRFLTKSTQLFASCGGDGSVRV 314

Query: 255 FDKRS---SQIIH----------NINTKKPYNT-------LAFSPFSSNLFAA-AGTDNL 293
           FD RS   S II+          N +T  P +        L  SP+  N+ A  A   N 
Sbjct: 315 FDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNK 374

Query: 294 VYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           + + D+R+  +P+  + GH  +V  I++ P    +L S G D + + WDL
Sbjct: 375 IIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 63/151 (41%), Gaps = 31/151 (20%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL-STLEYHTENGYGLAFNAN 190
           HD E+   R++ +   + A+  G+G + ++D     + +L  ST+ Y          NA+
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFD-----LRSLAHSTIIYEPPASSAPGLNAD 340

Query: 191 EKYSLLSGSD----------DSN-----------IALWDISNFEKNIKPTITFEDAHTDI 229
                  GSD          D N           I + D+ N E    P +  E  H+  
Sbjct: 341 TTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPE---SPILNLE-GHSSS 396

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSS 260
           +N++KWH ++ ++  S  +D  +  +D  +S
Sbjct: 397 VNEIKWHPTKRNVLLSCGDDCQVLYWDLNNS 427

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 104/234 (44%), Gaps = 37/234 (15%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++S S D+   +WD+ +    +K  +    AH   + DV++ +    +F S   D ++++
Sbjct: 259 IISSSIDTTCIVWDLQS-SHYVKTQLI---AHDSEVFDVRFLTKSTQLFASCGGDGSVRV 314

Query: 255 FDKRS---SQIIH----------NINTKKPYNT-------LAFSPFSSNLFAAAGTD-NL 293
           FD RS   S II+             T  P +        L  SP+  N+ A    D N 
Sbjct: 315 FDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNK 374

Query: 294 VYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ----EIGAE 349
           + + D+R+  +P+  + GH  +V  I++ P    +L S G D + + WDL     EI A 
Sbjct: 375 IIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSSFMEINAA 434

Query: 350 QTQD------EIEDGPPEVLMIHAGHKTSIND--IAVNPNINWLVASAEEDNIV 395
            ++        +ED   +  M   G  + +N+  +++N N   +  + E  N++
Sbjct: 435 GSKSPSIHGTSLEDPDGDTEMTDGGAGSGLNEDPLSLNNNSKQVCKTLETPNMM 488

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 85/199 (42%), Gaps = 34/199 (17%)

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN--INTKKPYNTLAFSPFSSNLFAA 287
           I    W++ + ++  S S D+T  ++D +SS  +    I        + F   S+ LFA+
Sbjct: 246 ITSFDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFAS 305

Query: 288 AGTDNLVYLYDIRDVSN-------PLYAMTG-----------HEDAVTAIEFDPNNDGIL 329
            G D  V ++D+R +++       P  +++G             DA+  +E  P +  +L
Sbjct: 306 CGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVL 365

Query: 330 YSSGSD-RRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVAS 388
            +  +D  + I+ D++              P   ++   GH +S+N I  +P    ++ S
Sbjct: 366 ATFAADSNKIIILDMRN-------------PESPILNLQGHGSSVNGIKWHPTKRNVLLS 412

Query: 389 AEEDNIVQIWKCSSNIPRI 407
             +D  V  W  +S+   I
Sbjct: 413 CGDDCQVLYWDLNSSFMEI 431

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 67/158 (42%), Gaps = 22/158 (13%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYD-------------RSKNGVEALLSTLEYH 178
           HD E+   R++ +   + A+  G+G + ++D              S +   A   T+   
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPS 345

Query: 179 TENGYGLAFNANEKYS---LLSGSDDSN-IALWDISNFEKNIKPTITFEDAHTDIINDVK 234
           ++    L       Y    L + + DSN I + D+ N E    P +  +  H   +N +K
Sbjct: 346 SKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPE---SPILNLQ-GHGSSVNGIK 401

Query: 235 WHSSEAHIFGSVSEDSTMKLFDKRSSQI-IHNINTKKP 271
           WH ++ ++  S  +D  +  +D  SS + I+   +K P
Sbjct: 402 WHPTKRNVLLSCGDDCQVLYWDLNSSFMEINAAGSKSP 439

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 88/187 (47%), Gaps = 13/187 (6%)

Query: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDI-- 229
           ++ ++ HT     L FNA +   L+SG     I +WD +              A T I  
Sbjct: 97  VAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQGYSPFGPGVAMTPIEE 156

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFD-KRSSQIIHNINT------KKPYNTLAFSPFSS 282
           +  + W+ + AH+F S        ++D K   ++IH   T      K   + + + P +S
Sbjct: 157 VQSLAWNQTLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPTSGLKNQLSVVEWHPSNS 216

Query: 283 NLFAAA-GTDN--LVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRT 338
              A A G DN  ++ ++D+R+ + PL  ++ GH   + ++++   +D ++ SSG D   
Sbjct: 217 TKVATATGNDNEPVILVWDLRNSNAPLKVLSQGHSKGILSLDWCQQDDKLMISSGRDNTC 276

Query: 339 IVWDLQE 345
           I+W+ +E
Sbjct: 277 ILWNPEE 283

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 69/148 (46%), Gaps = 13/148 (8%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIAL-WDISNFEKNIKPT 219
           Y    +G++  LS +E+H  N        + K +  +G+D+  + L WD+ N    +K  
Sbjct: 195 YTSPTSGLKNQLSVVEWHPSN--------STKVATATGNDNEPVILVWDLRNSNAPLK-- 244

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYN-TLAFS 278
                 H+  I  + W   +  +  S   D+T  L++   +Q +    T+  +     F+
Sbjct: 245 -VLSQGHSKGILSLDWCQQDDKLMISSGRDNTCILWNPEEAQKLTQFPTRGNWCFKTKFA 303

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
           P + +LFA+A  DN V +  +++++N L
Sbjct: 304 PEAPDLFASASFDNKVQVQTLQNLANKL 331

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 64/153 (41%), Gaps = 11/153 (7%)

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR 258
           S  S + LW + + +      +   DA     ND++W S +  I     ++  ++ F   
Sbjct: 37  SSASTLELWSVLSRDARTPQGMIVADAK---FNDLEW-SKDGSILAGALDNGVVEFFKPE 92

Query: 259 SSQIIHNINT-KKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVT 317
             + +  +        TL F+   SN+  + G+   +Y++D   ++   Y+  G   A+T
Sbjct: 93  ELRSVAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQGYSPFGPGVAMT 152

Query: 318 AIE------FDPNNDGILYSSGSDRRTIVWDLQ 344
            IE      ++     +  S+GS     +WDL+
Sbjct: 153 PIEEVQSLAWNQTLAHVFASAGSSGFASIWDLK 185

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 82/179 (45%), Gaps = 19/179 (10%)

Query: 225 AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ-IIHNINTKKPYNTLAFSPFSSN 283
            H+D +  V +      +  S S D T +L+   + + ++     +KP   + FSP  +N
Sbjct: 758 GHSDAVYSVNFSPCNRFLL-SGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNN 816

Query: 284 LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           LFA A +DN   ++    V  P+  + GH   V  + F PN    +++  SD+ + +WDL
Sbjct: 817 LFATASSDNTARVWSCDRVY-PVRILAGHLSDVDCVSFHPNGQ-YVFTGSSDKTSRMWDL 874

Query: 344 QEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
                            + + +  GH +++   AV+P+  WL ++A ED  + +W   S
Sbjct: 875 SS--------------GDSVRLFIGHSSAVTATAVSPDGRWL-STANEDGTITVWDIGS 918

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 111/251 (44%), Gaps = 34/251 (13%)

Query: 168 VEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHT 227
           + ++  TL  H++  Y + F+   ++ LLSGS D    LW    +    K  ++++  H 
Sbjct: 749 INSIFKTLVGHSDAVYSVNFSPCNRF-LLSGSGDKTARLWSTDTY----KGLVSYK-GHE 802

Query: 228 DIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPY----NTLAFSPFSSN 283
             I DV +  +  ++F + S D+T +++   S   ++ +     +    + ++F P    
Sbjct: 803 KPIWDVNFSPTGNNLFATASSDNTARVW---SCDRVYPVRILAGHLSDVDCVSFHPNGQY 859

Query: 284 LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWD 342
           +F  + +D    ++D+    + +    GH  AVTA    P  DG   S+ ++  TI VWD
Sbjct: 860 VFTGS-SDKTSRMWDLSS-GDSVRLFIGHSSAVTATAVSP--DGRWLSTANEDGTITVWD 915

Query: 343 LQEIGAEQTQDEIEDGPPEVLMIHAGH-KTSINDIAVNPNINWLVASAEEDNIVQIWKCS 401
           +              G  + L    GH K SI  ++ N   N LV+S   DN V++W   
Sbjct: 916 I--------------GSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSG-ADNSVRVWDIK 960

Query: 402 SNIPRIGGEPE 412
            N      EPE
Sbjct: 961 KNTHEPSLEPE 971

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 65/152 (42%), Gaps = 30/152 (19%)

Query: 267 NTKKPYNTLAFSPFSSNLFAAAG-TDNLVYLYDIRDVS-----------NPLY-AMTGHE 313
           NT+K  ++L FS  S    AA G  D+ + ++ +   S           N ++  + GH 
Sbjct: 703 NTEKNMSSLDFS--SDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHS 760

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSI 373
           DAV ++ F P N  +L  SG D+   +W                     L+ + GH+  I
Sbjct: 761 DAVYSVNFSPCNRFLLSGSG-DKTARLWSTDTYKG--------------LVSYKGHEKPI 805

Query: 374 NDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
            D+  +P  N L A+A  DN  ++W C    P
Sbjct: 806 WDVNFSPTGNNLFATASSDNTARVWSCDRVYP 837

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 107/248 (43%), Gaps = 25/248 (10%)

Query: 164 SKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFE 223
           + N V  L  TLE H      LA +A +   L+S S D  +  W ++  ++ +   +   
Sbjct: 2   ASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSF 61

Query: 224 DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPFSS 282
             H+ I+ DV      A+   S S D T++L++  + +     +  K    ++A    +S
Sbjct: 62  KGHSHIVQDVTLTPDGAYAL-SASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKAS 120

Query: 283 NLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDG-----ILYSSGSDRR 337
            + + +  D  + ++ I+     L  + GH D V+ +   PN+        + S+G+D+ 
Sbjct: 121 MIISGS-RDKSIKVWTIK--GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKM 177

Query: 338 TIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQI 397
              W+L +   E                  GH  ++N I  +P+ + L+ASA +D  + +
Sbjct: 178 VKAWNLNQFQIEAD--------------FVGHNGNVNTITASPDGS-LIASAGKDGEIML 222

Query: 398 WKCSSNIP 405
           W  +  +P
Sbjct: 223 WNLADKVP 230

>CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} highly
           similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195w SEC31 component of the COPII coat of ER-golgi
           vesicles
          Length = 1281

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 105/213 (49%), Gaps = 22/213 (10%)

Query: 153 NGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNF 212
           NG  +I+ ++ SK  ++    + + H+     + FN+ +   LLSG +   I +WD++  
Sbjct: 83  NGAVEIYEFNSSKQELKKQ-GSFKNHSTVVRTVKFNSKQNNVLLSGGNSQEIFIWDLNKL 141

Query: 213 ---EKNIKP-TITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD-KRSSQIIH--- 264
              + N +P T     +  D I+ + W+ S AH+F S S  S   ++D K   ++IH   
Sbjct: 142 LDSKANYQPLTPGVSMSPIDEIHSLSWNKSLAHVFASASNSSFASIWDLKAKKEVIHLSY 201

Query: 265 ---NINTKKPYNTLAFSPFSSNLFAAAGTDN---LVYLYDIRDVSNPLYAMT-------G 311
              N   K  ++ + + P +S   A A +++   L+ ++D+R+ + PL  ++       G
Sbjct: 202 TSQNTGLKSDFSAVEWHPLNSTRVATATSNDNEPLILVWDLRNSNTPLQTLSAANNQGHG 261

Query: 312 HEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
           H   + ++++   ++ +L SS  D   ++W+ Q
Sbjct: 262 HSKGILSLDWCQQDENLLLSSARDSSVMLWNPQ 294

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 64/136 (47%), Gaps = 13/136 (9%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTI 220
           Y     G+++  S +E+H  N   +A       +  S  ++  I +WD+ N    ++ T+
Sbjct: 201 YTSQNTGLKSDFSAVEWHPLNSTRVA-------TATSNDNEPLILVWDLRNSNTPLQ-TL 252

Query: 221 TFED----AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLA 276
           +  +     H+  I  + W   + ++  S + DS++ L++ +S + +   NT   +   +
Sbjct: 253 SAANNQGHGHSKGILSLDWCQQDENLLLSSARDSSVMLWNPQSGEALTEYNTTGNWCFKS 312

Query: 277 -FSPFSSNLFAAAGTD 291
            F+P + +LFA A  D
Sbjct: 313 KFAPQAPDLFAFATLD 328

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 80/174 (45%), Gaps = 11/174 (6%)

Query: 166 NGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           NG  ALL T  ++ E+ +    +  EK   ++G   + I LWD      N    +T    
Sbjct: 167 NGSGALLKT--FYGEHAFQGIDHHREKPLFVTGG--AKIELWD-----NNRSTPLTNLSW 217

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLF 285
             D I  +K++ SE  I  S   D+++ L+D R++     I      N + ++P     F
Sbjct: 218 GADNITSLKFNQSETDIVASAGSDNSVVLYDLRTNSPTQKIVQSMRTNAICWNPMEPFNF 277

Query: 286 AAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
             A  D+  Y YD+R++S  L     H  AV  ++F P  D I+  +GS  +TI
Sbjct: 278 VVANEDHNAYYYDMRNMSRSLNVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 329

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 84/194 (43%), Gaps = 36/194 (18%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN------ 231
           H +  Y +A N +    L + S D  I  W++S  E+     ++F+  H  ++       
Sbjct: 66  HRDGVYVVAKNYHNLNKLATASGDGVIKYWNMSTREE----YVSFK-GHYGLVTGLCVTP 120

Query: 232 ---DVKWHSSEAHIFGSVSEDSTMKLFD---------KRSSQIIHNINT-----KKPYNT 274
               V   S++ H+  S  +D T+KL+          K   ++I   N      K  Y  
Sbjct: 121 EGLSVGGLSNQNHML-SCGDDKTIKLWSINNDDFANIKSDEELITKTNGSGALLKTFYGE 179

Query: 275 LAFSPFSSN----LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILY 330
            AF     +    LF   G    + L+D  + S PL  ++   D +T+++F+ +   I+ 
Sbjct: 180 HAFQGIDHHREKPLFVTGGAK--IELWD-NNRSTPLTNLSWGADNITSLKFNQSETDIVA 236

Query: 331 SSGSDRRTIVWDLQ 344
           S+GSD   +++DL+
Sbjct: 237 SAGSDNSVVLYDLR 250

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 27/158 (17%), Positives = 73/158 (46%), Gaps = 11/158 (6%)

Query: 136 ITRARYMPQDDNIIATINGEGKIFIYD-RSKNGVEALLSTLEYHTENGYGLAFNANEKYS 194
           IT  ++   + +I+A+   +  + +YD R+ +  + ++ ++  +      + +N  E ++
Sbjct: 222 ITSLKFNQSETDIVASAGSDNSVVLYDLRTNSPTQKIVQSMRTN-----AICWNPMEPFN 276

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            +  ++D N   +D+ N  +++     F+D H   + DV +  +   I  + S D T+++
Sbjct: 277 FVVANEDHNAYYYDMRNMSRSLN---VFKD-HVSAVMDVDFSPTGDEIV-TGSYDKTIRI 331

Query: 255 FDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDN 292
           F           +TK+  + +       + +  +G+D+
Sbjct: 332 FKTNQGHSREIYHTKRMQHVMQVKYSMDSKYLISGSDD 369

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 105/254 (41%), Gaps = 56/254 (22%)

Query: 136 ITRARYMPQDDNIIATINGEGKIFI---------------YDRSKNG--VEALLSTLEYH 178
           +TR +++P+    +AT +   +I+                Y +  NG    A L +L   
Sbjct: 111 VTRCQWLPKGGGKLATCSDSLRIWSVGDSLQEQLNLSLCKYSKQSNGSTASAALGSLPPV 170

Query: 179 TENGYGLAFNANEKYSLLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWH 236
           T       +N+ +   ++S S D+   +WD+  SN+ K      T   AH   + DVK+ 
Sbjct: 171 TS----FDWNSVDTNLIISSSIDTTCTVWDLQSSNYVK------TQLIAHDSEVYDVKFL 220

Query: 237 SSEAHIFGSVSEDSTMKLFDKRS---SQIIH---------NINTKKPYNT---------- 274
           ++   +F S   D ++++FD R    S II+          + +    N           
Sbjct: 221 TNSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHT 280

Query: 275 ----LAFSPFSSNLFAAAGTD-NLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGIL 329
               L  SPF  N+ A    D N V + D+R   +P+  + GH  AV  + + P    +L
Sbjct: 281 ALLRLEPSPFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVL 340

Query: 330 YSSGSDRRTIVWDL 343
            + G D + + WD+
Sbjct: 341 LTCGDDCQVLYWDI 354

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 76/185 (41%), Gaps = 18/185 (9%)

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN--INTKKPYNTLAFSPFSSNLFAA 287
           +    W+S + ++  S S D+T  ++D +SS  +    I        + F   S+ LFA+
Sbjct: 170 VTSFDWNSVDTNLIISSSIDTTCTVWDLQSSNYVKTQLIAHDSEVYDVKFLTNSTQLFAS 229

Query: 288 AGTDNLVYLYDIRDVSN------PLYAMT-GHEDAVTAIEFDPNNDGI-------LYSSG 333
            G D  V ++D+R +++      PL  +T G   +        N DG        L  S 
Sbjct: 230 CGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLRLEPSP 289

Query: 334 SDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDN 393
            D   +    Q+  A    D    G P  ++   GH +++N +  +P    ++ +  +D 
Sbjct: 290 FDPNVVATFTQDSNAVLILDMRYPGSP--ILTLEGHSSAVNQMRWHPTQRNVLLTCGDDC 347

Query: 394 IVQIW 398
            V  W
Sbjct: 348 QVLYW 352

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/160 (18%), Positives = 62/160 (38%), Gaps = 25/160 (15%)

Query: 122 SNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL--------- 172
           SN    +   HD E+   +++     + A+  G+G + ++D        ++         
Sbjct: 200 SNYVKTQLIAHDSEVYDVKFLTNSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTS 259

Query: 173 STLEYHTENGYGLAFNANEKYSLL-------------SGSDDSNIALWDISNFEKNIKPT 219
            T++   E   G   +     +LL             + + DSN  L  I +      P 
Sbjct: 260 GTVKSSGEGNVGGNEDGTNHTALLRLEPSPFDPNVVATFTQDSNAVL--ILDMRYPGSPI 317

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS 259
           +T E  H+  +N ++WH ++ ++  +  +D  +  +D  S
Sbjct: 318 LTLE-GHSSAVNQMRWHPTQRNVLLTCGDDCQVLYWDINS 356

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 118/271 (43%), Gaps = 22/271 (8%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T  +Y    D +I+  + +G I I+  + N V+ L      HTE    ++F+ ++
Sbjct: 120 HDSAVTVMQYSHAGDWLISG-DADGTIKIWQPNFNMVKVLDRA---HTECMRDISFSYSD 175

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
           +   ++ SDD+ + +W+ SN ++           H D+     WH     I  S S+D+ 
Sbjct: 176 Q-KFVTCSDDNVLKIWNFSNGQQER----VLSGHHWDV-KSCDWHPKMGLIV-SGSKDNL 228

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D R+ + +  I   K       F P   NL A    D  + +YD+R     L  + 
Sbjct: 229 IKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIR 288

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D ++ + + P N+ I      +     +DL    +  T        P    I   H+
Sbjct: 289 DDMDYMS-LSWHPINETIFSVGCYNGAIKHFDLLHDNSNST--------PACHTIPYAHE 339

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIWKCS 401
            S+  +A +P +  ++ASA +D  ++ W  S
Sbjct: 340 KSVTSLAYSP-VGHILASAAKDRTIRFWARS 369

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 98/204 (48%), Gaps = 26/204 (12%)

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           +GS+DS I +WD++     +K T+     H   + D+   +   ++F S S+D  +K +D
Sbjct: 131 TGSNDSTIRVWDLAT--GKLKVTL---QGHIMTVRDICISARHPYMF-SASQDKLVKCWD 184

Query: 257 KRSSQIIHNIN-TKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDA 315
              + ++ + + T    +++   P S +L  +AG D++V ++DIR  S  L  + GH   
Sbjct: 185 LERNTVVRDFHGTLSGVHSVDLHP-SLDLIVSAGRDSVVRVWDIRSRSCVL-TLAGHRGP 242

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSIND 375
           +  +   P +  I+ S  +D    +WDL              G P   + H  HK ++ D
Sbjct: 243 INKVRCLPVDPQIV-SCSTDATVKLWDLVA------------GKPMKTLTH--HKRNVRD 287

Query: 376 IAVNPNINWLVASAEEDNIVQIWK 399
           +A NP   +  ASA  D+I + WK
Sbjct: 288 LAFNPT-EFSFASACTDDI-RSWK 309

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 104/224 (46%), Gaps = 28/224 (12%)

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISN-------FEKNIKPTITFEDAHTDIINDVKWHS 237
           LA N N+K S L+G+++  ++LW++ N           +  T T   +H   IND+KW+S
Sbjct: 55  LALN-NDKTSFLAGNNNGTVSLWNLDNTLSTSHILNNKLARTSTKPHSHLFGINDMKWYS 113

Query: 238 SEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLV-YL 296
            +  +F +   D  +KL+D      + ++     +N+  F   ++N F     D+    L
Sbjct: 114 IDDGMFFTCGNDKFVKLWDTNKFINVQDL----EFNSNLFQMDTANQFILVTLDDYYPRL 169

Query: 297 YDIRDVSNPLYAMTGHEDAVT-AIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355
            D+R+++  +     H ++ T   + +P  D ++ SS +D    +WD++          I
Sbjct: 170 IDLRNMNLGITIFGKHLNSKTLCCKINPVRDNLIASSDNDGMIRIWDVR-----MNYRSI 224

Query: 356 EDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWK 399
           E+           H  SIND+  N N   L+++   D  +QIW+
Sbjct: 225 EEWK--------AHSRSINDMVWNDNGTKLISTG-VDGKIQIWR 259

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 119/274 (43%), Gaps = 25/274 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  I+   Y    D +I+  +  G I I+  + N V+ + ++   HTE    ++F +N 
Sbjct: 124 HDTAISTMVYSHAGDWLISG-DSSGTIKIWQPNFNMVKEIDNS---HTECLRDISF-SNT 178

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++    T      H   +    WH  E  +  S S+D+ 
Sbjct: 179 DSKFVTCSDDNILKIWNFSNGKQERILT-----GHHWDVKSCDWHP-EMGLIVSGSKDNL 232

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +K +D RS Q +  I N K       F P   N       D    ++DIR+ +  L  + 
Sbjct: 233 VKFWDPRSGQCVSTILNFKHTVLRTRFQPTRGNYLLGISKDKSCRVFDIRNHTKELLTVR 292

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T + + P N+ +   +  D           G+ +  D +ED    +  I   H+
Sbjct: 293 DEVDFMT-LSWHPINESVFTLANYD-----------GSIKHFDILEDLEKPIHTIPFAHE 340

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
             I  ++ NP I  ++ASA +D  ++ W  S  I
Sbjct: 341 KCITAMSYNP-IGHILASASKDRTIRFWTRSKPI 373

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 98/208 (47%), Gaps = 28/208 (13%)

Query: 175 LEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVK 234
             Y  EN + L      ++ L++   D ++ L D  N +     TI+    HT  IND+K
Sbjct: 8   CRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLK-----TISSIQCHTTSINDMK 62

Query: 235 WHSSE---AHIFGSVSEDSTMKLFDKRSSQIIHNINTKK--PYNTLAFSPFSSNLFAAAG 289
             +S+     +F + +ED  +K++D R+   + ++   K  P+    FS  S +   A G
Sbjct: 63  VINSDFDTGAVFATAAEDG-VKVWDIRARNNVASLQNDKASPF----FSLDSRHNMLACG 117

Query: 290 T-----DNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           T     D  +++YDIR+ + P+ +    H D +T I+F P +  +L S  +D    ++DL
Sbjct: 118 TELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDL 177

Query: 344 QEIGAEQTQDEIEDGPPEVLMIHAGHKT 371
                  TQD+ ED   +V+   + H  
Sbjct: 178 -------TQDDEEDALHQVINFASIHSC 198

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 111/240 (46%), Gaps = 26/240 (10%)

Query: 164 SKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFE 223
           S  G  ALL T  ++ E+ +    +     + ++G   + I LWD+     N K  ++  
Sbjct: 162 SDTGDGALLKT--FYGEHAFQSIDHHRRNPNFVTGG--AQIQLWDV-----NRKKPLSNL 212

Query: 224 DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSN 283
               D ++ V+++ +E  I  S   D+++ L+D R++     +  +   N L ++P    
Sbjct: 213 SWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQKVVQRMRTNALCWNPMEPF 272

Query: 284 LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWD 342
            FA A  D+  Y YD+R++S  L+    H  AV  ++F P  + I+  +GS  +TI +++
Sbjct: 273 NFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGEEIV--TGSYDKTIRIFN 330

Query: 343 LQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           L+   + +             + H      +  +    +  ++V+ +++ N V++W+  +
Sbjct: 331 LKHGHSRE-------------VYHTKRMQHVFQVKFTMDSKYIVSGSDDGN-VRLWRAKA 376

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 80/190 (42%), Gaps = 31/190 (16%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDV---K 234
           H +  Y LA N N    L SGS D  +  W+++  E+      +F  AH  ++  +    
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREE----LCSFR-AHYGLVTGLCVTP 120

Query: 235 WHSSEAH---IFGSVSEDSTMKLFD---------KRSSQIIHNIN----TKKPYNTLAFS 278
            H S         S  +D T+KL+          K  ++I+ +       K  Y   AF 
Sbjct: 121 THLSPTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGEHAFQ 180

Query: 279 PFSSNL----FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS 334
               +     F   G    + L+D+ +   PL  ++   D V+ + F+ N + IL S+GS
Sbjct: 181 SIDHHRRNPNFVTGGAQ--IQLWDV-NRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGS 237

Query: 335 DRRTIVWDLQ 344
           D   +++DL+
Sbjct: 238 DNSIVLYDLR 247

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 4/42 (9%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKN 215
           YHT   ++ + + F  + KY ++SGSDD N+ LW    +E++
Sbjct: 340 YHTKRMQHVFQVKFTMDSKY-IVSGSDDGNVRLWRAKAWERS 380

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 100/219 (45%), Gaps = 32/219 (14%)

Query: 200 DDSNIAL--WD-----ISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTM 252
           DD ++A+  WD     IS    NIK ++  E+AHT  + +V W+SS   +  +  ED  +
Sbjct: 189 DDKHLAVGSWDGGIKTISAGSLNIKSSV--ENAHTGKVGEVDWNSS-GDLLATGGEDGLV 245

Query: 253 KLFDKRSSQIIHNINTKKPYNTLA---FSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAM 309
           KLF  +S ++    + +     +A   F PF   + A+A  DN   L+D  + ++ L   
Sbjct: 246 KLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYI-ASASFDNTWRLWDA-ETNHELLLQ 303

Query: 310 TGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGH 369
            GH   V  + F  +   +L S+G D   ++WD++                   M+ +GH
Sbjct: 304 EGHGKEVFCLAFQSDGS-LLCSAGLDCTGMIWDIR--------------SGNCAMVLSGH 348

Query: 370 KTSINDIAVNPNINWLVASAEEDNIVQIWKC-SSNIPRI 407
              I  +  +P   + VA+A  D  V IW    +N P++
Sbjct: 349 TKPIYSVDWSPR-GFEVATASGDGTVNIWDIRKTNQPQV 386

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 113/268 (42%), Gaps = 25/268 (9%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T  +Y    D +++  + +G I I+  + N V+ L +    HTE    ++FN N 
Sbjct: 122 HDSAVTTMKYSNAGDWMVSG-DTDGNIKIWQPNFNMVKELENA---HTECIRDISFN-NA 176

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
               ++ SDD+ + +W+ SN ++           H D+     WH +   +  S S+D+ 
Sbjct: 177 DSKFVTCSDDNILKIWNFSNGQQER----VLSGHHWDV-KSCDWHPTMG-LIASASKDNL 230

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +KL+D RS   +  I   K       F P   NL  A   D    ++DIR     L  + 
Sbjct: 231 IKLWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISKDKSCRVFDIRHSMKELMVVR 290

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T + + P N+ +      D           G+ +  D ++D       I   H 
Sbjct: 291 DEVDYMTLL-WHPINESVFTVGNYD-----------GSLKHFDILQDLSNPTHSIPFAHD 338

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I  ++ N  +  ++ASA +D  V+ W
Sbjct: 339 KCITSMSYNA-MGTVLASASKDRTVRFW 365

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 111/269 (41%), Gaps = 69/269 (25%)

Query: 136 ITRARYMPQDDNIIATINGEGKIF-IYDRSKNGVEALLSTLEYH-----TENGYGLA--- 186
           ++R ++MP     +AT +   +I+ + D+ K  V   LS ++Y        NG+ L    
Sbjct: 110 VSRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVN--LSLVKYGKGVGDVANGHTLGKLP 167

Query: 187 ------FNANEKYSLLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSS 238
                 +N+ +   +LS S D+   +WD+  SN+ K      T   AH   + D K+ + 
Sbjct: 168 PVTSFDWNSIDTNIILSSSIDTTCTVWDLQASNYVK------TQLIAHDSEVFDAKFLTQ 221

Query: 239 EAHIFGSVSEDSTMKLFDKRS---SQIIH----NINTKKPYNT----------------- 274
            +++F S   D ++++FD R    S II+     I T  P                    
Sbjct: 222 SSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQ 281

Query: 275 -------------------LAFSPFSSNLFAAAGTD-NLVYLYDIRDVSNPLYAMTGHED 314
                              L  SPF  N+ A    D N+V + D+R   +P+  + GH  
Sbjct: 282 NAAETSLAVSSLESQALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYC 341

Query: 315 AVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           A+  + + P+   +L + G D + + WDL
Sbjct: 342 ALNQLRWHPSKPNVLATCGDDCQILYWDL 370

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 70/171 (40%), Gaps = 36/171 (21%)

Query: 122 SNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL----STLEY 177
           SN    +   HD E+  A+++ Q  N+ A+  G+G + ++D        ++    S ++ 
Sbjct: 199 SNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQT 258

Query: 178 HT-----------ENGYGLAFNANEKYSLLSGSDDSNIALWDI--SNFEKNIKPTITFE- 223
           HT           ++G+    N N   + L+ S   + AL  +  S F+ NI  TI  + 
Sbjct: 259 HTPSQIQLSAQGHDDGHARKNNQNAAETSLAVSSLESQALLRLEPSPFDPNILATIQQDS 318

Query: 224 ------------------DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
                             + H   +N ++WH S+ ++  +  +D  +  +D
Sbjct: 319 NVVIILDMRYPGSPILTLNGHYCALNQLRWHPSKPNVLATCGDDCQILYWD 369

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 100/205 (48%), Gaps = 29/205 (14%)

Query: 170 ALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDI 229
           +L+    + +EN + L      K+ LL+G  +  I L D  N  K ++     E A    
Sbjct: 5   SLVDLNSFGSEN-WCLKLQPAYKHGLLTGLSNGEICLLDW-NTGKPLQKIRASETA---- 58

Query: 230 INDVKWHSSE---AHIFGSVSEDSTMKLFDKRSSQIIHNIN--TKKPYNTLAFSPFSSNL 284
           IND+K   S+    ++  S S DS +K+FD RS+  +  IN  T  P+ +L     S + 
Sbjct: 59  INDMKIIDSDFVAGNLISSASIDS-VKVFDIRSNDCVAKINNETNSPFLSLD----SRHG 113

Query: 285 FAAAGT-----DNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRT 338
             A GT     D  +++YD+R    PL ++   H D VT I+F P++  +L S  +D  T
Sbjct: 114 LLACGTELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYT 173

Query: 339 IVWDLQEIGAEQTQDEIEDGPPEVL 363
            ++DL+       QD+ ED   +V+
Sbjct: 174 NIYDLK-------QDDEEDALHQVI 191

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 91/208 (43%), Gaps = 22/208 (10%)

Query: 166 NGVEALLSTLEY--------HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIK 217
           NGV    S  EY        H+     + FNA +   L SG     I +WD +  E    
Sbjct: 83  NGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETPGY 142

Query: 218 PTITFEDAHT--DIINDVKWHSSEAHIFGSVSEDSTMKLFD-KRSSQIIHNINT------ 268
                  A T  D I  + W+ ++ H+F S        ++D K   ++IH  +T      
Sbjct: 143 APFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTSSITGQ 202

Query: 269 KKPYNTLAFSPFSSNLFAAAG---TDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPN 324
           K   + + + P +S   A A    +D  + ++D+R+ + PL  ++ GH   V ++++   
Sbjct: 203 KNQLSIVEWHPNNSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQ 262

Query: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
           ++ +L SSG D   ++W+  E G   TQ
Sbjct: 263 DETLLLSSGRDNSCVLWN-PESGQNLTQ 289

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 61/131 (46%), Gaps = 5/131 (3%)

Query: 202 SNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ 261
           + I LWD++     +KP         D I  VK++ SE  I  S   D+++ L+D R++ 
Sbjct: 199 AKIHLWDVNR----LKPVSNLSWG-ADNITSVKFNQSETDILASTGSDNSIVLYDLRTNS 253

Query: 262 IIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF 321
               I      N + ++P  +  F  A  D+  Y YD+R++S  L     H  AV  ++F
Sbjct: 254 PTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 322 DPNNDGILYSS 332
            P  D I+  S
Sbjct: 314 SPTGDEIVTGS 324

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 86/194 (44%), Gaps = 36/194 (18%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDV---- 233
           H +  Y +A N      L +GS D  I  W++S  E+     ++F+ AH  +I  +    
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREE----FVSFK-AHYGLITGLCVTQ 120

Query: 234 -KWHSSE-----AHIFGSVSEDSTMKLFD-----------------KRSSQIIHNINTKK 270
            ++H  +      +   S S+D T+KL+                       ++   + + 
Sbjct: 121 PRFHDKKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGES 180

Query: 271 PYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILY 330
            +  +  S   ++ FA  G    ++L+D+  +  P+  ++   D +T+++F+ +   IL 
Sbjct: 181 AFQGID-SHRENSTFATGGAK--IHLWDVNRLK-PVSNLSWGADNITSVKFNQSETDILA 236

Query: 331 SSGSDRRTIVWDLQ 344
           S+GSD   +++DL+
Sbjct: 237 STGSDNSIVLYDLR 250

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 5/47 (10%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPT 219
           YHT   ++ + + ++ + KY ++SGSDD N+ LW    +E+ N+K T
Sbjct: 343 YHTKRMQHVFQVKYSMDAKY-IISGSDDGNVRLWRSKAWERSNVKTT 388

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 127/299 (42%), Gaps = 49/299 (16%)

Query: 140 RYMPQDDNIIAT-------INGEGKIFIYDRSKNGVEALLSTLEYHTENG-YGLAFNANE 191
           +Y P  DN +A        + G GK+FI D    G   +L T  + T++G + +A+N   
Sbjct: 15  QYSPFFDNKVAVATGSNFGLVGNGKLFIIDIDNQG--RMLETKSFVTQDGLFDVAWNELH 72

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
           +  +L    D ++ L+DI   + N  P   F++   ++ +   W+     +F S S D T
Sbjct: 73  ENHVLVAQGDGSLRLFDI---QLNDYPVAIFQEHEKEVFS-CNWNLINKQLFVSSSWDGT 128

Query: 252 MKLFD-KRSSQII---------HN---------INTKKPYNTLA----------FSPFSS 282
           +K++   R S +          HN         ++ +K + +L+          FSP   
Sbjct: 129 VKVWTPMRQSSLTTLTPKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDP 188

Query: 283 NLFAAAGTDNLVYLYDIRDVSNP-LYAMTGHEDAVT-AIEFDPNNDGILYSSGSDRRTIV 340
           N+  +   ++ V ++D+R  +N   Y+   H    T   +F+     I+ + G D    V
Sbjct: 189 NIVMSCAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKV 248

Query: 341 WDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWK 399
           WDL+ +              E+     GH  +I  ++ +P+ + ++ S   D   ++W+
Sbjct: 249 WDLRMVRKMAANSRQPMSVNEI----CGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 10/88 (11%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDV-------SNPLYA--MTGHEDAVTAIEFDPN 324
           T  F+ + S++ A  G DN+V ++D+R V         P+    + GH+ A+  + + P+
Sbjct: 226 TCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPH 285

Query: 325 NDGILYSSGSDRRTIVW-DLQEIGAEQT 351
           +  +L S+  D    VW DL + G   T
Sbjct: 286 HSNMLLSTSYDMTCRVWQDLSDDGRRPT 313

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/125 (19%), Positives = 54/125 (43%), Gaps = 5/125 (4%)

Query: 136 ITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSL 195
           I ++++ P D NI+ +  G   + ++D  +       S + ++        FN    + +
Sbjct: 178 IYQSQFSPHDPNIVMSCAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHII 237

Query: 196 LSGSDDSNIALWDISNFEK---NIKPTITFED--AHTDIINDVKWHSSEAHIFGSVSEDS 250
            +G  D+ + +WD+    K   N +  ++  +   H   I  V W    +++  S S D 
Sbjct: 238 ATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDM 297

Query: 251 TMKLF 255
           T +++
Sbjct: 298 TCRVW 302

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 101/204 (49%), Gaps = 26/204 (12%)

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           +GS+D+ I +WD+++ +  +K T++    H   + D+   +   ++F S SED   K +D
Sbjct: 129 TGSNDTTIKIWDLASGK--LKITLS---GHAMTVRDIAISNRHPYLF-SASEDKLAKCWD 182

Query: 257 KRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDA 315
              +  I + +      +T+   P + +L A AG D++V L+DIR    P+  + GH+  
Sbjct: 183 LEKNTAIRDYHGHLSGVHTVDIHP-TLDLIATAGRDSVVKLWDIRS-RVPVVTLIGHKSP 240

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSIND 375
           +  +   P N  ++ SS  D    +WD            I  G    ++ H  HK SI D
Sbjct: 241 INKVHCLPVNPQVI-SSSVDATIRLWD------------IVAGKASKVLTH--HKRSIRD 285

Query: 376 IAVNPNINWLVASAEEDNIVQIWK 399
           IA +P+  + +A+A  D+I + WK
Sbjct: 286 IAFHPS-EFSMATACTDDI-RSWK 307

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 61/130 (46%), Gaps = 19/130 (14%)

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPL-YAMTGHEDAVTAIEFDPNNDGILYSSGSDRR 337
           P  +  FA    D  + ++D+   S  L   ++GH   V  I    N    L+S+  D+ 
Sbjct: 121 PVDNEWFATGSNDTTIKIWDL--ASGKLKITLSGHAMTVRDIAIS-NRHPYLFSASEDKL 177

Query: 338 TIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQI 397
              WDL++  A      I D        + GH + ++ + ++P ++ L+A+A  D++V++
Sbjct: 178 AKCWDLEKNTA------IRD--------YHGHLSGVHTVDIHPTLD-LIATAGRDSVVKL 222

Query: 398 WKCSSNIPRI 407
           W   S +P +
Sbjct: 223 WDIRSRVPVV 232

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 42/98 (42%), Gaps = 15/98 (15%)

Query: 306 LYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMI 365
           +  + GH   V  ++ DP ++    +  +D    +WDL              G  ++ + 
Sbjct: 104 MRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDLAS------------GKLKITL- 150

Query: 366 HAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSN 403
            +GH  ++ DIA++    +L  SA ED + + W    N
Sbjct: 151 -SGHAMTVRDIAISNRHPYLF-SASEDKLAKCWDLEKN 186

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 79/174 (45%), Gaps = 23/174 (13%)

Query: 195 LLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTM 252
           L+S S D+   +WD+  SN+ K      T   AH   + DV++ +    +F S   D ++
Sbjct: 296 LISSSIDTTCIVWDLQSSNYVK------TQLIAHDSEVYDVRFLTKSTQLFASCGGDGSV 349

Query: 253 KLFDKRS---SQIIHNINTKKPYNT-----------LAFSPFSSNLFAA-AGTDNLVYLY 297
           ++FD RS   S II+   T    N            L  SP  +N+ A      N + + 
Sbjct: 350 RVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILIL 409

Query: 298 DIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQT 351
           D+R+  +P+  + GH+ A+  I++ P    IL S   D + + WDL    +  T
Sbjct: 410 DMRNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNSTFSGNT 463

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 61/150 (40%), Gaps = 15/150 (10%)

Query: 122 SNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTEN 181
           SN    +   HD E+   R++ +   + A+  G+G + ++D        ++     +  +
Sbjct: 313 SNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVS 372

Query: 182 GYGLAFNANEKYSLLSGSDDSN-----------IALWDISNFEKNIKPTITFEDAHTDII 230
              L+   N    L     D+N           I + D+ N E    P +  E  H   I
Sbjct: 373 NADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSES---PVLVLE-GHKSAI 428

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSS 260
           N +KWH ++ +I  S S+D  +  +D  S+
Sbjct: 429 NQIKWHPTKRYILLSCSDDCQVLYWDLNST 458

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 87/188 (46%), Gaps = 28/188 (14%)

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN--INTKKPYNTLAFSPFSSNLFAA 287
           +    W+ ++ ++  S S D+T  ++D +SS  +    I        + F   S+ LFA+
Sbjct: 283 VTSFDWNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTKSTQLFAS 342

Query: 288 AGTDNLVYLYDIRDV----------SNPLYA--MTGHEDAVTAIEFDPNNDGILYSSGSD 335
            G D  V ++D+R +          +NP+    ++  ++A+  +E  P +  ++ +  S+
Sbjct: 343 CGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSE 402

Query: 336 -RRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNI 394
             + ++ D++            + P   +++  GHK++IN I  +P   +++ S  +D  
Sbjct: 403 SNKILILDMRN----------SESP---VLVLEGHKSAINQIKWHPTKRYILLSCSDDCQ 449

Query: 395 VQIWKCSS 402
           V  W  +S
Sbjct: 450 VLYWDLNS 457

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 104/204 (50%), Gaps = 26/204 (12%)

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           +GS+DS I +WD ++    +K T++    H   + D+       ++F S SED  +K +D
Sbjct: 126 TGSNDSTIKVWDFAS--GKLKLTLS---GHVMGVRDLVVSKRHPYMF-SASEDKLVKCWD 179

Query: 257 -KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDA 315
            ++++ I          +T+   P + +L A+AG D++V L+DIR     +  + GH+  
Sbjct: 180 LEKNAPIRDYFGHLSGVHTVDIHP-TLSLIASAGRDSVVKLWDIRS-KKAVITLVGHKSP 237

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSIND 375
           + +++  P +  I+ S  +D   I WDL  + A+          P  ++ H  H+ ++ D
Sbjct: 238 INSVKCTPADPQII-SCSNDTTVITWDL--VAAK----------PMKVITH--HRKAVRD 282

Query: 376 IAVNPNINWLVASAEEDNIVQIWK 399
           IAV+P   + VAS   ++I + WK
Sbjct: 283 IAVHPG-EFSVASCSTNDI-RSWK 304

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 58/129 (44%), Gaps = 17/129 (13%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
            +A  P  +  FA    D+ + ++D       L  ++GH   V  +     +   ++S+ 
Sbjct: 113 CIAMDPVDNEWFATGSNDSTIKVWDFASGKLKL-TLSGHVMGVRDLVVSKRHP-YMFSAS 170

Query: 334 SDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDN 393
            D+    WDL++         I D        + GH + ++ + ++P ++ L+ASA  D+
Sbjct: 171 EDKLVKCWDLEK------NAPIRD--------YFGHLSGVHTVDIHPTLS-LIASAGRDS 215

Query: 394 IVQIWKCSS 402
           +V++W   S
Sbjct: 216 VVKLWDIRS 224

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 17/99 (17%)

Query: 308 AMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIH 366
            + GH   V  I  DP  D   +++GS+  TI VWD                  ++ +  
Sbjct: 103 VINGHLGWVRCIAMDPV-DNEWFATGSNDSTIKVWDF--------------ASGKLKLTL 147

Query: 367 AGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
           +GH   + D+ V+    ++  SA ED +V+ W    N P
Sbjct: 148 SGHVMGVRDLVVSKRHPYMF-SASEDKLVKCWDLEKNAP 185

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 127/302 (42%), Gaps = 54/302 (17%)

Query: 138 RARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGL-AFNANEKYSLL 196
           R+     D   +AT   +  I I+D S    + ++ TL+ H ++ Y L  F + +K  L+
Sbjct: 382 RSVCFSPDGKFLATGAEDKLIRIWDLS---TKRIVMTLQGHEQDIYSLDYFPSGDK--LV 436

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           SGS D  + +WD+   + ++  T++ ED     +  V     E     + S D T++++D
Sbjct: 437 SGSGDRTVRIWDLRTGQCSL--TLSIEDG----VTTVAVSPGEGKFIAAGSLDRTLRVWD 490

Query: 257 KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT-------DNLVYLYDIRDV------- 302
             +  ++  ++++    T       S +F   G        D  V L+++ +        
Sbjct: 491 SETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKND 550

Query: 303 SNPLYAM-----TGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIED 357
           S P  A      TGH+D V ++     ND  + S   DR  + WD Q             
Sbjct: 551 SKPTAATCEVTYTGHKDFVLSVATT-QNDKYILSGSKDRGVLFWDTQS------------ 597

Query: 358 GPPEVLMIHAGHKTSINDIAV------NPNINWLVASAEEDNIVQIWKCSSNIPRIGGEP 411
           G P  L++  GH+ S+  +AV       P+   + A+   D   +IWK S N      EP
Sbjct: 598 GNP--LLMLQGHRNSVISVAVANGFPLGPDYG-VFATGSGDCKARIWKYSKNKAN-ASEP 653

Query: 412 EV 413
           +V
Sbjct: 654 QV 655

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 123/282 (43%), Gaps = 47/282 (16%)

Query: 138 RARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGL-AFNANEKYSLL 196
           R+     D   +AT   +  I I+D S    + +L TL+ H ++ Y L  F A +K  L+
Sbjct: 373 RSVCFSPDGKYLATGAEDKLIRIWDLSS---KKILMTLQGHEQDIYSLDYFPAGDK--LV 427

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           SGS D  + +WD+   + ++  T++ ED     +  V     +     + S D T++++D
Sbjct: 428 SGSGDRTVRIWDLRTGQCSL--TLSIEDG----VTTVAVSPGDGKYIAAGSLDRTVRVWD 481

Query: 257 KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT-------DNLVYLYDIRDVSNPL--- 306
             +  ++  ++++   +T       S +F   G        D  V L+D+R ++      
Sbjct: 482 SETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHA 541

Query: 307 ---YAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVL 363
                 TGH+D V ++    +++ IL S   DR  + WD               G P  L
Sbjct: 542 TCEVTYTGHKDFVLSVATTQDDEYIL-SGSKDRGVLFWD------------TASGNP--L 586

Query: 364 MIHAGHKTSINDIAV------NPNINWLVASAEEDNIVQIWK 399
           ++  GH+ S+  +AV       P+I  + A+   D   +IWK
Sbjct: 587 LMLQGHRNSVISVAVVNGFPLGPDIG-VFATGSGDCKARIWK 627

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 51/124 (41%), Gaps = 24/124 (19%)

Query: 300 RDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ--EIGAEQTQDEI-- 355
           RD+   L+    H   V  + F  +NDG   ++G ++ T V+ +   E+ A  + D +  
Sbjct: 280 RDLDVDLHHSLDHSSVVCCVRF--SNDGEYLATGCNKTTQVYKVSTGELVARLSDDSVSG 337

Query: 356 ---------------EDGPPEVLMIHAGHKTS--INDIAVNPNINWLVASAEEDNIVQIW 398
                          E G      I  G  +   I  +  +P+  +L A+  ED +++IW
Sbjct: 338 INNESSSVVAGNGATEKGDESSATIQPGSSSDLYIRSVCFSPDGKYL-ATGAEDKLIRIW 396

Query: 399 KCSS 402
             SS
Sbjct: 397 DLSS 400

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 83/178 (46%), Gaps = 11/178 (6%)

Query: 162 DRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT 221
           D++ N  + LL T  ++ E+ +    +   K + ++G     I LWD +      KP   
Sbjct: 157 DQNLNSQDGLLKT--FYGEHAFQGIDHHKVKTTFVTGG--PTIQLWDTAR----SKPLSN 208

Query: 222 FEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFS 281
                 D I  VK++ +E  I  S   D+++ L+D R++     I  +   N + ++P  
Sbjct: 209 LSWG-ADNITSVKFNQTETDILASTGSDNSIVLYDVRTNSPTQKIVQRLRTNAICWNPME 267

Query: 282 SNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
           +  F  A  D+  Y YD+R++S  L     H  AV  ++F P  D I+  +GS  +TI
Sbjct: 268 AFNFVTANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPTGDEIV--TGSYDKTI 323

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 78/187 (41%), Gaps = 28/187 (14%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWH- 236
           H +  Y +A + ++   + SGS D  I  W++S+     +  I    AH  +I  +    
Sbjct: 66  HRDGVYVIAKDYHDLNKVASGSGDGVIKYWNMSS-----RDEICSFKAHYGLITGLCVSP 120

Query: 237 -----SSEAHIFGSVSEDSTMKLFDKRSSQII-----HNINT-----KKPYNTLAFSPFS 281
                + + H   S  +D T+KL+              N+N+     K  Y   AF    
Sbjct: 121 QRSPLNRDQHFMLSCGDDKTVKLWSMNGDDFANVKDDQNLNSQDGLLKTFYGEHAFQGID 180

Query: 282 SN----LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRR 337
            +     F   G    + L+D    S PL  ++   D +T+++F+     IL S+GSD  
Sbjct: 181 HHKVKTTFVTGGP--TIQLWDTAR-SKPLSNLSWGADNITSVKFNQTETDILASTGSDNS 237

Query: 338 TIVWDLQ 344
            +++D++
Sbjct: 238 IVLYDVR 244

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 5/47 (10%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPT 219
           YHT   ++ +   ++ + KY ++SGSDD+N+ LW    +E+ N+K T
Sbjct: 337 YHTKRMQHVFQTKYSMDSKY-IISGSDDANVRLWRAKAWERSNVKTT 382

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 108/224 (48%), Gaps = 17/224 (7%)

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204
           D+  IA     G + ++  +       +  L  H  +   + FNA ++  L SGS +  I
Sbjct: 73  DNKYIAGALDNGMVELFKTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEI 132

Query: 205 ALWDISNF---EKNIKPTITFEDAHTDI--INDVKWHSSEAHIFGSVSEDSTMKLFDKRS 259
            +WD++       +    +T   A T +  I  + W+ S +H+F S    S   ++D ++
Sbjct: 133 FIWDLNKCIDQSNDSYSPLTPGMAMTPVEEITSLAWNQSLSHVFASAGNTSYASIWDLKA 192

Query: 260 SQIIHNINTKKPYNTLA-------FSPFSSNLFA-AAGTDN--LVYLYDIRDVSNPLYAM 309
            + + +++   P ++L        + P +S   A A+ +DN  ++ ++D+R+ + PL  +
Sbjct: 193 KKEVIHLSYTSPSSSLKPQLSVVEWHPENSTRVATASNSDNEPIILIWDLRNANTPLQIL 252

Query: 310 -TGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
             G+   + ++++  ++  +L SSG D   ++W+ +E G E TQ
Sbjct: 253 ENGNSKGILSLDWCKHDSNLLLSSGRDNTAVLWNPEE-GKELTQ 295

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 13/146 (8%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIAL-WDISNFEKNIKPT 219
           Y    + ++  LS +E+H EN   +A  +N        SD+  I L WD+ N      P 
Sbjct: 201 YTSPSSSLKPQLSVVEWHPENSTRVATASN--------SDNEPIILIWDLRNANT---PL 249

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYN-TLAFS 278
              E+ ++  I  + W   ++++  S   D+T  L++    + +    ++  +     F+
Sbjct: 250 QILENGNSKGILSLDWCKHDSNLLLSSGRDNTAVLWNPEEGKELTQYPSRSNWCFKTKFA 309

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSN 304
           P + +LFA A  D  V +  +++++N
Sbjct: 310 PEAPDLFACASFDGKVEIQTLQNLTN 335

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 79/172 (45%), Gaps = 11/172 (6%)

Query: 168 VEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHT 227
            E LL T  ++ E+ +    +  E  + ++G   + I LWD      N    I+      
Sbjct: 162 TEGLLKT--FYGEHAFQGIDHHREASTFVTGG--AQIHLWD-----SNRSKPISNLSWGA 212

Query: 228 DIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAA 287
           D I  VK++ +E  I  S   D+ + L+D R++     I      N + ++P  +  F  
Sbjct: 213 DNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQKIIQTMRTNAICWNPMEAFNFVI 272

Query: 288 AGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
           A  D+  Y YD+R++S  L+    H  AV  ++F P  D I+  +GS  +TI
Sbjct: 273 ANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 322

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 91/194 (46%), Gaps = 28/194 (14%)

Query: 171 LLSTLEY-HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDI 229
            +  L Y H +  Y +A N N    L SGS D  I  W++S  E+     ++F+ AH  +
Sbjct: 58  FIGQLGYGHRDGVYTIAKNYNNLNKLASGSADGIIKYWNMSTREE----FVSFK-AHYGL 112

Query: 230 INDV---KWHSSE---AHIFGSVSEDSTMKLF-----DKRSSQIIHNINT----KKPYNT 274
           +  +     H+S+    +   S  +D T+KL+     D  + +    +NT    K  Y  
Sbjct: 113 VTGLCVTPEHTSKNKNENFMLSCGDDKTVKLWSVNNDDFSNVKSDAELNTEGLLKTFYGE 172

Query: 275 LAFSPF----SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILY 330
            AF        ++ F   G    ++L+D  + S P+  ++   D +T+++F+ N   IL 
Sbjct: 173 HAFQGIDHHREASTFVTGGAQ--IHLWD-SNRSKPISNLSWGADNITSVKFNQNEVDILA 229

Query: 331 SSGSDRRTIVWDLQ 344
           S+GSD   +++DL+
Sbjct: 230 STGSDNAIVLYDLR 243

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 5/47 (10%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPT 219
           YHT   ++ + + F+ + KY ++SGSDD N+ LW    +E+ N+K T
Sbjct: 336 YHTKRMQHVFQVKFSMDSKY-IISGSDDGNVRLWRSKAWERSNVKTT 381

>TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {ON}
           Anc_8.672 YPL151C
          Length = 414

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 115/248 (46%), Gaps = 40/248 (16%)

Query: 160 IYDRSKNGVEALLSTLEYHTE-------NGY-----GLAFNANEKYSLLSGSDDSNIALW 207
           + DR +N    +L T E+H         NG+      +  +  E     +GS D+ I +W
Sbjct: 74  VLDRHRN---LMLQTPEWHEPWQLKRVINGHLGWVRCVEVDTVENKWFATGSSDTTIKIW 130

Query: 208 DISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD-KRSSQIIHNI 266
           D+ + +  +K T++    H   + D+       ++F S SED  +K +D +++  I    
Sbjct: 131 DLESGK--LKITLS---GHVMPVRDIAISKRSPYLF-SASEDKLIKCWDLEKNMAIREYF 184

Query: 267 NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNND 326
                 NT+   P + +L A AG D+ + L+DIR     +  + GH+  VT ++  P + 
Sbjct: 185 GHLSGVNTVDVHP-TLDLIATAGRDSTIRLWDIRS-RTAVMTLIGHKAPVTTVKCIPVDP 242

Query: 327 GILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLV 386
            ++ S+ +D    +WD+    A +T            + H  HK ++ DIAVNP   + +
Sbjct: 243 QVV-SASNDATVKLWDIVAGKAIKT------------LTH--HKRTVRDIAVNPT-EFSI 286

Query: 387 ASAEEDNI 394
           ASA  D+I
Sbjct: 287 ASACTDDI 294

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 100/245 (40%), Gaps = 27/245 (11%)

Query: 168 VEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           V  L  TLE H  NG+   LA +A +   L+S S D  +  W ++  ++     +     
Sbjct: 5   VLVLRGTLEGH--NGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKG 62

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLF 285
           H  I+ D    +  A+   S S D T++L++  + +        K           +++ 
Sbjct: 63  HNHIVQDCALTADGAYAL-SASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMI 121

Query: 286 AAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN-----NDGILYSSGSDRRTIV 340
            +   D  + ++ I+   + L  + GH D V+ +   PN     ++  L S+GSD+    
Sbjct: 122 ISGSRDKTIKVWSIK--GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKA 179

Query: 341 WDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKC 400
           W++ +   E                  GH   IN I  +P+ + LVASA +D  + +W  
Sbjct: 180 WNINQFQIEAD--------------FVGHNNYINSITASPDGS-LVASAGKDGDIMLWNL 224

Query: 401 SSNIP 405
               P
Sbjct: 225 KQKTP 229

>SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 878

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 97/212 (45%), Gaps = 26/212 (12%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++ GSDD  I +++ +  EK     +T  + H D I  +  H +  ++  S S+D T+KL
Sbjct: 70  IVVGSDDFKIRVFNYNTGEK-----VTDFEGHPDYIRSIAVHPTRPYVL-SASDDMTIKL 123

Query: 255 FDKRSSQIIHNINTKKPYNTL--AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH 312
           ++   +  +        +  +  AF+P   N FA+A  D+ V ++ +   S P + MT H
Sbjct: 124 WNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQS-PNFTMTAH 182

Query: 313 E-DAVTAIEFDPNNDG-ILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
           E   V  +++ P  D   L +S  DR   +WD Q      T +              GH 
Sbjct: 183 ETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLE--------------GHM 228

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
            +++    +P++  ++ S  ED  V+IW  ++
Sbjct: 229 ANVSYAIFHPSLP-IIISGSEDGTVKIWNANT 259

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 12/164 (7%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLA--FNA 189
           H+  +    + P+D N  A+   +  + I+     G ++   T+  H   G      +  
Sbjct: 139 HEHFVMCVAFNPKDPNTFASACLDHTVKIWSL---GQQSPNFTMTAHETRGVNFVDYYPL 195

Query: 190 NEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED 249
            +K  L++ SDD ++ +WD        K  +   + H   ++   +H S   I  S SED
Sbjct: 196 QDKPYLITSSDDRSVKIWDYQT-----KSCVATLEGHMANVSYAIFHPSLPIII-SGSED 249

Query: 250 STMKLFDKRSSQIIHNINTKKPYN-TLAFSPFSSNLFAAAGTDN 292
            T+K+++  + ++   +N     +  +A  P     + A+G DN
Sbjct: 250 GTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVASGFDN 293

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 78/176 (44%), Gaps = 33/176 (18%)

Query: 195 LLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTM 252
           L+S S D+   +WD+  SN+ +      T   AH   + DV++ +    +F S   D ++
Sbjct: 259 LISSSIDTTCIVWDLQSSNYVR------TQLIAHDSEVYDVRFLTQTTQLFSSCGGDGSV 312

Query: 253 KLFDKRS---SQIIH---------------------NINTKKPYNTLAFSPFSSNLFAAA 288
           ++FD R    S II+                     + +T  P   L  SPF  N+ A  
Sbjct: 313 RVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSSSAADSDTGVPLLRLEPSPFDPNVIATF 372

Query: 289 GTDN-LVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
             D+  V + D+R+  +P+  + GH  AV  + + P+   +L S   D + + WDL
Sbjct: 373 AIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDL 428

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 31/152 (20%), Positives = 66/152 (43%), Gaps = 17/152 (11%)

Query: 122 SNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL-------ST 174
           SN    +   HD E+   R++ Q   + ++  G+G + ++D        ++       +T
Sbjct: 276 SNYVRTQLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPAT 335

Query: 175 LEYHTENGYGLAFNANEKYSLL----SGSDDSNIALWDISNFE------KNIKPTITFED 224
           L+  T  G   A +++    LL    S  D + IA + I +        +N    +   +
Sbjct: 336 LQPTTAAGSSSAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLVLE 395

Query: 225 AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
            H+  +N ++WH S+ ++  S ++D  +  +D
Sbjct: 396 GHSAAVNQMRWHPSKRNVLLSCADDCQVLYWD 427

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 62/153 (40%), Gaps = 26/153 (16%)

Query: 208 DISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHI--FGSVSEDSTMKLFDKRSSQIIHN 265
           D+ ++++  +  +TF       ++ ++W  S  H   F + S+   +  F +    +   
Sbjct: 148 DLLSWDRVAECNVTFP------VSTIQWQPSMTHPRRFATCSDSLRIWSFCEEERNLQEQ 201

Query: 266 INTKKPYNTLAFSPF------SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAI 319
           IN       L+   +      +S + AAAG         IR        + G    +T+ 
Sbjct: 202 IN-------LSLCKYDKQQQGASRVNAAAGGSG-----SIRTNPQQQQGLIGELPPITSF 249

Query: 320 EFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
            ++P +  +L SS  D   IVWDLQ     +TQ
Sbjct: 250 HWNPVDPNLLISSSIDTTCIVWDLQSSNYVRTQ 282

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 66/127 (51%), Gaps = 3/127 (2%)

Query: 225 AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ--IIHNINTKKPYNTLAFSPFSS 282
            H   I D+ +H  +  I  + S D+    +D RS +       N +     + ++  +S
Sbjct: 112 GHFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWNHKNS 171

Query: 283 NLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWD 342
           N+ A + + N+VY++D+R  ++PL  + GH  +V +I+F+P N+  + SSG+D     WD
Sbjct: 172 NVLATSHS-NIVYVWDVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWD 230

Query: 343 LQEIGAE 349
             ++  E
Sbjct: 231 YNKVEDE 237

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 73/174 (41%), Gaps = 19/174 (10%)

Query: 230 INDVKW--HSSEAH-IFGSVSEDSTMKLFDKRSSQIIHNI--NTKKPYNTLAFSPFSSNL 284
           + DV+W  H ++ H +  + ++ + +    + SS+ + ++     +    + F P    +
Sbjct: 70  VADVQWCPHPAKHHWVISTSNQKAIVWNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEI 129

Query: 285 FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
            A +  D     +D+R    P +  +        ++++  N  +L +S S+    VWD++
Sbjct: 130 LATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSNI-VYVWDVR 188

Query: 345 EIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
           +  +          P  VL    GH  S+N I  NP     + S+  D  V+ W
Sbjct: 189 KGTS----------PLSVL---EGHSGSVNSIDFNPFNETEIMSSGNDGTVKFW 229

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 138 RARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLS 197
           + ++  ++ N++AT +    ++++D  K    + LS LE H+ +   + FN   +  ++S
Sbjct: 163 QVKWNHKNSNVLATSHS-NIVYVWDVRKG--TSPLSVLEGHSGSVNSIDFNPFNETEIMS 219

Query: 198 GSDDSNIALWDISNFEKNIKPTITFE 223
             +D  +  WD +  E  ++ TIT E
Sbjct: 220 SGNDGTVKFWDYNKVEDELQMTITTE 245

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 93/192 (48%), Gaps = 11/192 (5%)

Query: 175 LEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVK 234
           ++ HT     L F  N    LLSG +D+ + +WD  + ++N+   +     H+  IN + 
Sbjct: 151 MDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-KRNL---LRDYKGHSKAINSLD 206

Query: 235 WHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLV 294
           ++    + F S S D T+K++D    ++   ++ K   N + F PF+S+ F     ++ +
Sbjct: 207 FNDDGTN-FISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKI 265

Query: 295 YLYDIRDVSN--PLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQ-EIGAEQ 350
           Y YD R   N   +     H  ++ A++F P  DG  + S S+ +T+ +WD Q  +  +Q
Sbjct: 266 YHYDTRISENDGRVQVYDHHMSSILALKFFP--DGSKFISSSEDKTVRIWDNQVNVPIKQ 323

Query: 351 TQDEIEDGPPEV 362
             D  +   P +
Sbjct: 324 ISDTTQYSMPSI 335

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 37/165 (22%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
           +L F P S NL  + G DN+V ++D     N L    GH  A+ +++F  N+DG  + S 
Sbjct: 160 SLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDF--NDDGTNFISS 217

Query: 334 SDRRTI-VWDLQEIGAEQTQDEIEDGPPEV------------------------------ 362
           S   TI +WD ++ G  +T+   +  P +V                              
Sbjct: 218 SFDHTIKIWDTEQ-GKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYDTRISEND 276

Query: 363 --LMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
             + ++  H +SI  +   P+ +  ++S+ ED  V+IW    N+P
Sbjct: 277 GRVQVYDHHMSSILALKFFPDGSKFISSS-EDKTVRIWDNQVNVP 320

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 14/92 (15%)

Query: 307 YAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIH 366
           YAM GH +  T++ F PN+  +L S G+D    VWD                   +L  +
Sbjct: 149 YAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-------------KRNLLRDY 195

Query: 367 AGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            GH  +IN +  N +    ++S+  D+ ++IW
Sbjct: 196 KGHSKAINSLDFNDDGTNFISSS-FDHTIKIW 226

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 80/171 (46%), Gaps = 11/171 (6%)

Query: 169 EALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTD 228
           + LL T  Y     +GL  + N    +  G+    I LWD +N  K I   +T+     D
Sbjct: 164 DGLLKTY-YGDHAFFGLDHHRNNSTFVTGGA---QIQLWD-ANRSKPI-SNLTWG---AD 214

Query: 229 IINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAA 288
            +  VK++ +E  I  S   D+++ L+D R++     I      N + ++P  +  F  A
Sbjct: 215 NVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIRQSMRTNAICWNPMEAFNFVIA 274

Query: 289 GTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
             D+  Y YD+R++S  L     H  AV  ++F P  D I+  +GS  +TI
Sbjct: 275 NEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 323

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 28/187 (14%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN------ 231
           H +  Y +A N N+   L S S D  +  +++S  E+     I    AH  ++       
Sbjct: 66  HRDGVYTIAKNYNQLNKLASSSADGVVKYFNMSTREE-----ICSFKAHYGLVTGLCVRP 120

Query: 232 DVKWHSSEAHIFGSVSEDSTMKLF--------DKRSSQIIHNINT--KKPYNTLAFSPF- 280
           +    +   H   S  +D T+KL+        + +    IH  +   K  Y   AF    
Sbjct: 121 ETSATNKNEHYMISCGDDKTVKLWSVDSNDFSNNKKDDTIHKGDGLLKTYYGDHAFFGLD 180

Query: 281 ---SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRR 337
              +++ F   G    + L+D  + S P+  +T   D VT+++F+     IL S+GSD  
Sbjct: 181 HHRNNSTFVTGGAQ--IQLWDA-NRSKPISNLTWGADNVTSVKFNQTETDILASTGSDNS 237

Query: 338 TIVWDLQ 344
            +++DL+
Sbjct: 238 IVLYDLR 244

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 5/47 (10%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPT 219
           YHT   ++ + + ++ + KY ++SGSDD N+ LW    +E+ N+K T
Sbjct: 337 YHTKRMQHVFQVKYSMDSKY-IISGSDDGNVRLWRSKAWERSNVKST 382

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 5/131 (3%)

Query: 202 SNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ 261
           + I LWD++     +KP         D I  VK++ +E  I  S   D+++ L+D R++ 
Sbjct: 199 AKIQLWDVNR----VKPVSNLSWG-ADNITSVKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 262 IIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF 321
               I      N + ++P  +  F  A  D+  Y YD+R++S  L     H  AV  ++F
Sbjct: 254 PTQKIVQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 322 DPNNDGILYSS 332
            P  D I+  S
Sbjct: 314 SPTGDEIVTGS 324

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 87/193 (45%), Gaps = 34/193 (17%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII------- 230
           H +  Y +A N      L +GS D  I  W++S  E+     ++F+ AH  +I       
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREE----FVSFK-AHYGLITGLCVTQ 120

Query: 231 ---NDVKWHSSEAHIFGSVSEDSTMKLF--------DKRSSQIIHNINTKKPYNTL---- 275
              +D K      +   S S+D T+KL+        +KRSS     IN +    T     
Sbjct: 121 PHFHDKKPDLKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVINEEGLVRTFDGES 180

Query: 276 AFSPFSSN----LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYS 331
           AF    S+     FA  G    + L+D+  V  P+  ++   D +T+++F+ N   IL S
Sbjct: 181 AFQGIDSHRVNSTFATGGAK--IQLWDVNRVK-PVSNLSWGADNITSVKFNQNETDILAS 237

Query: 332 SGSDRRTIVWDLQ 344
           +GSD   +++DL+
Sbjct: 238 TGSDNSIVLYDLR 250

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 95/209 (45%), Gaps = 12/209 (5%)

Query: 131 PHDGEITRARYMPQDDNIIATINGEGKIFIYDRSK-NGVEALLSTLEYHTENGYGLAFNA 189
           PH G+I   ++ P+ +N I +   +G I  +  SK  G   LL  L  H      + ++ 
Sbjct: 216 PHKGKIGAVQWHPESNNQIISCAEDGHIKNFQYSKEEGEIKLLGDLVGHERRVSDVKYHP 275

Query: 190 NEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED 249
           + K  + S S D    LWD S +++     +  ++ HT+ +  + +   +  +  S   D
Sbjct: 276 SGKL-IGSASHDMTWRLWDASTYQE-----LLLQEGHTEGVFSLSFQ-CDGSLVCSGGMD 328

Query: 250 STMKLFDKRSSQIIHNINT-KKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDV-SNPLY 307
           +   ++D RS   +  +    KP  T+A+S     + A  G D L+ ++DIR      + 
Sbjct: 329 TLSMIWDIRSGNKVMTLTGHSKPVYTVAWSTNGYQV-ATGGGDGLINVWDIRQRDGGQVS 387

Query: 308 AMTGHEDAVTAIEFDPNNDG-ILYSSGSD 335
            +  H + VT ++F   + G  L SSG D
Sbjct: 388 QILAHRNIVTQVQFSKGDGGKKLVSSGYD 416

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 76/190 (40%), Gaps = 23/190 (12%)

Query: 214 KNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD--KRSSQII---HNINT 268
           + ++P     D H   I  V+WH    +   S +ED  +K F   K   +I      +  
Sbjct: 205 QTLQPLAQKLDPHKGKIGAVQWHPESNNQIISCAEDGHIKNFQYSKEEGEIKLLGDLVGH 264

Query: 269 KKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGI 328
           ++  + + + P S  L  +A  D    L+D       L    GH + V ++ F  +   +
Sbjct: 265 ERRVSDVKYHP-SGKLIGSASHDMTWRLWDA-STYQELLLQEGHTEGVFSLSFQCDGS-L 321

Query: 329 LYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVAS 388
           + S G D  +++WD++                  +M   GH   +  +A + N  + VA+
Sbjct: 322 VCSGGMDTLSMIWDIRS--------------GNKVMTLTGHSKPVYTVAWSTN-GYQVAT 366

Query: 389 AEEDNIVQIW 398
              D ++ +W
Sbjct: 367 GGGDGLINVW 376

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 80/174 (45%), Gaps = 11/174 (6%)

Query: 166 NGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           N    LL T  Y+++  +    +   K + ++G   + I LWD      N    +T    
Sbjct: 161 NTASGLLKT--YYSDFAFQGIDHHRSKSNFVTGG--AKIQLWD-----SNRSKPLTDLSW 211

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLF 285
             D I+ VK++ +E  I  S   D+++ L+D R++     I      N + ++P  +  F
Sbjct: 212 GADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNF 271

Query: 286 AAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
             A  D+  Y YD+R++S  L     H  AV  ++F P  D I+  +GS  +TI
Sbjct: 272 VVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 323

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 85/187 (45%), Gaps = 28/187 (14%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKW-- 235
           H +  Y +A N      L +GS D  +  W++S  E+      +F+ AH  +I  +    
Sbjct: 66  HRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREE----LCSFK-AHYGLITGLCVTP 120

Query: 236 -HSSEA---HIFGSVSEDSTMKLFDKRSSQIIH-----NINT-----KKPYNTLAFSPF- 280
            H S+    +   S S+D T+KL+   S    +     +INT     K  Y+  AF    
Sbjct: 121 EHLSKQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGID 180

Query: 281 ---SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRR 337
              S + F   G    + L+D  + S PL  ++   D ++ ++F+ N   IL S+GSD  
Sbjct: 181 HHRSKSNFVTGGAK--IQLWD-SNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNS 237

Query: 338 TIVWDLQ 344
            +++DL+
Sbjct: 238 LVLYDLR 244

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 5/47 (10%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPT 219
           YHT   ++ + + F+ + KY ++SGSDD N+ LW    +E+ N+K T
Sbjct: 337 YHTKRMQHVFQVKFSMDAKY-IVSGSDDGNVRLWRSKAWERSNVKTT 382

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 64/129 (49%), Gaps = 5/129 (3%)

Query: 204 IALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQII 263
           I LWDI     N    ++      D IN VK++ ++A++ GS   D+++ L+D R++   
Sbjct: 198 INLWDI-----NRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSAT 252

Query: 264 HNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP 323
             I      N++ ++P  +  F  A  D+  Y YD+R++S  L     H  AV  ++  P
Sbjct: 253 QKIVQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISP 312

Query: 324 NNDGILYSS 332
             + ++ +S
Sbjct: 313 TGEEVVTAS 321

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 86/197 (43%), Gaps = 33/197 (16%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAH---------TD 228
           H +  Y LA + N+   + SGS D  I  WD+S+ E+     I    AH         T 
Sbjct: 66  HQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQ-----IASFKAHYGTITGLCITP 120

Query: 229 IINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-----INT-----KKPYNTLAF- 277
            +N     S   +   S S+D T+KL+        H      INT     K  Y   AF 
Sbjct: 121 KVNIDSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQ 180

Query: 278 ----SPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
               S  +SN F   G    + L+DI + S PL  ++   D +  ++F+ N+  +L S+G
Sbjct: 181 GLDHSRMTSN-FVTGGP--RINLWDI-NRSKPLSDLSWGADNINTVKFNQNDANVLGSAG 236

Query: 334 SDRRTIVWDLQEIGAEQ 350
           SD   +++DL+   A Q
Sbjct: 237 SDNSIVLYDLRTNSATQ 253

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/121 (19%), Positives = 57/121 (47%), Gaps = 11/121 (9%)

Query: 136 ITRARYMPQDDNIIATINGEGKIFIYD-RSKNGVEALLSTLEYHTENGYGLAFNANEKYS 194
           I   ++   D N++ +   +  I +YD R+ +  + ++ T+  ++     + +N  E ++
Sbjct: 219 INTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIVQTMRVNS-----MCWNPMEAFN 273

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            +  S+D N   +D+ N  + +     F+D H   + DV    +   +  + S D T+++
Sbjct: 274 FVVASEDHNAYYYDMRNMSRALN---VFKD-HVSAVMDVDISPTGEEVV-TASYDKTIRI 328

Query: 255 F 255
           F
Sbjct: 329 F 329

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 5/47 (10%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPT 219
           YHT   ++ +   F+ + KY ++SGSDD N+ LW    +E+ N+K T
Sbjct: 340 YHTKRMQHVFQAKFSMDSKY-VMSGSDDGNVRLWRAKAWERSNVKST 385

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 6/88 (6%)

Query: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN 231
           LS L +  +N   + FN N+   L S   D++I L+D+       K   T        +N
Sbjct: 209 LSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIVQTMR------VN 262

Query: 232 DVKWHSSEAHIFGSVSEDSTMKLFDKRS 259
            + W+  EA  F   SED     +D R+
Sbjct: 263 SMCWNPMEAFNFVVASEDHNAYYYDMRN 290

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 77/165 (46%), Gaps = 22/165 (13%)

Query: 195 LLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTM 252
           L+S S D+   +WD+  SN+ K      T   AH   + DV++ +    +F S   D ++
Sbjct: 264 LISSSIDTTCIIWDLESSNYVK------TQLIAHDSEVFDVRFLTQSTQLFASCGGDGSV 317

Query: 253 KLFDKRS---SQIIHNINTK-KPYNT---------LAFSPFSSNLFAAAGTD-NLVYLYD 298
           ++FD RS   S II+    +  P ++         L  SP   N+ A    D N + + D
Sbjct: 318 RVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIIILD 377

Query: 299 IRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           +R+   P+  + GH  ++  I++ P    IL S   D + + WDL
Sbjct: 378 MRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 68/154 (44%), Gaps = 24/154 (15%)

Query: 122 SNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL-STLEYHTE 180
           SN    +   HD E+   R++ Q   + A+  G+G + ++D     + +L  ST+ Y   
Sbjct: 281 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFD-----LRSLAHSTIIYEPP 335

Query: 181 NGYGLAFNANEKYSLLS--------------GSDDSNIALWDISNFEKNIKPTITFEDAH 226
                + +A    +LL                +D + I + D+ N E    P +T +  H
Sbjct: 336 AQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIIILDMRNPE---TPVLTLQ-GH 391

Query: 227 TDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS 260
           +  +N +KWH +E +I  S ++D  +  +D  SS
Sbjct: 392 SSSLNQIKWHPTERNILLSCADDCQVLYWDLNSS 425

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 80/189 (42%), Gaps = 27/189 (14%)

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN--INTKKPYNTLAFSPFSSNLFAA 287
           I    W+  + ++  S S D+T  ++D  SS  +    I        + F   S+ LFA+
Sbjct: 251 ITSFHWNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIAHDSEVFDVRFLTQSTQLFAS 310

Query: 288 AGTDNLVYLYDIRDVSNP--LYAMTGHEDA---------VTAIEFDPNNDGILYSSGSD- 335
            G D  V ++D+R +++   +Y      D          +  +E  P++  I+ +  +D 
Sbjct: 311 CGGDGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADS 370

Query: 336 RRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIV 395
            + I+ D++              P   ++   GH +S+N I  +P    ++ S  +D  V
Sbjct: 371 NKIIILDMR-------------NPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQV 417

Query: 396 QIWKCSSNI 404
             W  +S++
Sbjct: 418 LYWDLNSSL 426

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
           YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 101/229 (44%), Gaps = 49/229 (21%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           H G +T+AR+     NI+AT + +G I I+D +K   +A           G G+    + 
Sbjct: 109 HAGAVTQARFHSLQSNILATGDSKGGILIWDTNKCLTKA----------QGGGV---VST 155

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
              +L  ++ S+                        + +  + W+  +AHIF S +  S 
Sbjct: 156 YTPMLPAANKSS-----------------------EEPVQCLAWNKKQAHIFASTNSTSF 192

Query: 252 MKLFDKRSSQIIHNINTKKPYNTLA-------FSPFSSNLFAAAGTDN----LVYLYDIR 300
             ++D ++ + + +++   P   L        + P  S  + A GT N    +V ++D+R
Sbjct: 193 ASIWDLKAKKDVLHLSYTSPLTGLKPQLSVVEWHPDQST-YVATGTGNDTGPVVVVWDLR 251

Query: 301 DVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGA 348
           + + PL  +T GH   + ++++   ++ +L SSG D   ++W+  E  A
Sbjct: 252 NANTPLQELTGGHSKGILSLDWCQQDETLLLSSGRDNSVVLWNPIEGAA 300

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 123/282 (43%), Gaps = 47/282 (16%)

Query: 138 RARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGL-AFNANEKYSLL 196
           R+     D   +AT   +  I I+D +    + +L TL+ H ++ Y L  F A +K  L+
Sbjct: 356 RSVCFSPDGKYLATGAEDKLIRIWDLT---TKKILMTLQGHEQDIYSLDYFPAGDK--LV 410

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           SGS D  + +WD+   + ++  T++ ED     +  V     +     + S D T++++D
Sbjct: 411 SGSGDRTVRIWDLRTGQCSL--TLSIEDG----VTTVAVSPGDGKYIAAGSLDRTVRVWD 464

Query: 257 KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT-------DNLVYLYDIRDV------S 303
             +  ++  ++++   +T       S +F   G        D  V L+D+R +      +
Sbjct: 465 SETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHA 524

Query: 304 NPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVL 363
                 TGH+D V ++    +++ IL S   DR  + WD               G P  L
Sbjct: 525 TCEVTYTGHKDFVLSVATTQDDEYIL-SGSKDRGVLFWD------------TASGNP--L 569

Query: 364 MIHAGHKTSINDIAV------NPNINWLVASAEEDNIVQIWK 399
           ++  GH+ S+  +AV       P++  + A+   D   +IWK
Sbjct: 570 LMLQGHRNSVISVAVVNGFPLGPDVG-VFATGSGDCKARIWK 610

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 107/242 (44%), Gaps = 28/242 (11%)

Query: 164 SKNGVEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT 221
           + N V  L  TLE H  NG+   LA +A +   LLS S D  +  W ++  ++     + 
Sbjct: 2   ASNEVLVLRGTLEGH--NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVR 59

Query: 222 FEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPF 280
               H+ I+ D       A+   S S D T++L+D  + +     +  K    ++A    
Sbjct: 60  SFKGHSHIVQDCTLTQDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRK 118

Query: 281 SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP---NNDGI-LYSSGSDR 336
           +S + + +  D  + ++ I+     L  + GH D V+ +   P   N+D + + S+G+D+
Sbjct: 119 ASMIISGS-RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDK 175

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQ 396
               W+L +   E                  GH  ++N +  +P+ + L+ASA +D  + 
Sbjct: 176 MVKAWNLNQFQIEAD--------------FVGHNGNVNAVTASPDGS-LIASAGKDGEIM 220

Query: 397 IW 398
           +W
Sbjct: 221 LW 222

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 5/131 (3%)

Query: 202 SNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ 261
           + I LWD++     +KP I+      D I  V+++ +E  I  S   D+++ L+D R++ 
Sbjct: 199 AKIHLWDVNR----LKP-ISNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 262 IIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF 321
               I      N + ++P  +  F  A  D+  Y YD+R++S  L     H  AV  ++F
Sbjct: 254 PTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVDF 313

Query: 322 DPNNDGILYSS 332
            P  D I+  S
Sbjct: 314 SPTGDEIVTGS 324

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 86/193 (44%), Gaps = 34/193 (17%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII------- 230
           H +  Y +A N      L +GS D  I  W++S  E+     ++F+ AH  +I       
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWNMSTREE----FVSFK-AHYGLITGLCVTQ 120

Query: 231 ---NDVKWHSSEAHIFGSVSEDSTMKLF--------DKRSSQIIHNINTKKPYNTL---- 275
              +D K      +   S S+D T+KL+        +KRSS      N +    T     
Sbjct: 121 PHFHDKKSDWKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGES 180

Query: 276 AFSPFSSN----LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYS 331
           AF    S+     FA  G    ++L+D+  +  P+  ++   D +T++ F+ N   IL S
Sbjct: 181 AFQGIDSHRENSTFATGGAK--IHLWDVNRLK-PISNLSWGADNITSVRFNQNETDILAS 237

Query: 332 SGSDRRTIVWDLQ 344
           +GSD   +++DL+
Sbjct: 238 TGSDNSIVLYDLR 250

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 5/47 (10%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPT 219
           YHT   ++ + + ++ + KY ++SGSDD N+ LW    +E+ N+K T
Sbjct: 343 YHTKRMQHVFQVKYSMDAKY-IISGSDDGNVRLWRSKAWERSNVKTT 388

>NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {ON}
           Anc_2.469 YMR093W
          Length = 514

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 109/228 (47%), Gaps = 23/228 (10%)

Query: 125 KIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYG 184
           +++K F    ++  +     D  ++   +  G + IYD S N    LLS +   T   + 
Sbjct: 72  QVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSIYD-SYNPRTILLS-INASTHPTHV 129

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
             F++ +  +L++ SDD  I LWDISN     +PT+    A TD +  V    S  H+  
Sbjct: 130 TKFHSQDNKTLITASDDRVIRLWDISN---AYQPTLELT-AATDYVRSVTCVPSAPHMIV 185

Query: 245 SVSEDSTMKLFDKRSSQI---IHNINTKKPY-NTLAFSPFSSNLFAAAGTDNLVYLYDIR 300
           S S D  ++L+D R+S     I+++N ++P  + ++ SP  + + +  G +     + I 
Sbjct: 186 SGSYDGVVRLYDTRTSSASTPIYSLNHEQPVEDIISISP--TQIVSCGGPN-----FKIW 238

Query: 301 DVSN--PLYAMTGHEDAVTAIEF--DPNN--DGILYSSGSDRRTIVWD 342
           D+++   L+       +VT +++  DP +  +  L +S  D    V+D
Sbjct: 239 DLTSNKKLFERGNFNKSVTCLDYIQDPQSPMNQTLIASSLDGHVKVFD 286

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 12/121 (9%)

Query: 233 VKWHSSEAHI-FG-------SVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSN- 283
           VK H+S  HI F        +V+  + +++F  R+ Q+I   +  K  + +  + F S+ 
Sbjct: 36  VKEHNSVTHIAFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFK--DVVYSASFRSDG 93

Query: 284 -LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWD 342
            L  A     LV +YD  +    L ++          +F   ++  L ++  DR   +WD
Sbjct: 94  KLLCAGDATGLVSIYDSYNPRTILLSINASTHPTHVTKFHSQDNKTLITASDDRVIRLWD 153

Query: 343 L 343
           +
Sbjct: 154 I 154

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 108/248 (43%), Gaps = 26/248 (10%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           +L+  E  +    G+AF+ +  + L++    S I LWD     +       FED H   +
Sbjct: 3   MLTKFESKSTRAKGIAFHPSRPWVLVALFS-STIQLWDY----RMGTLLHRFED-HEGPV 56

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT 290
             + +H ++  IF S  +D ++K++   +++ ++ +N    Y    F         +A  
Sbjct: 57  RGIDFHPTQP-IFVSAGDDYSIKVWSLETNKCLYTLNGHLDYVRTVFFHRELPWIISASD 115

Query: 291 DNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEI---- 346
           D  + +++ ++    L  +TGH   V   +F P  D ++ S+  D    VWD+  +    
Sbjct: 116 DQTIRIWNWQN-RKELACLTGHNHFVMCAQFHPTED-LVVSASLDETIRVWDIAGLRKRH 173

Query: 347 ---GAEQTQDEIED---------GPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNI 394
              GA   +D++           G   V  I  GH   +N  + +P +  L+ S  +D  
Sbjct: 174 SAPGASSFEDQMASQQNLLDAGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQ 232

Query: 395 VQIWKCSS 402
           V++W+ SS
Sbjct: 233 VKLWRMSS 240

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 110/242 (45%), Gaps = 26/242 (10%)

Query: 162 DRSKNGVEALLSTLEYHTENGY-GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTI 220
           D S N  + L+ T  ++ E+ + GL  + N    +  G+    I LWD S      KP I
Sbjct: 157 DESVNTKDGLIKT--FYGEHAFQGLDHHRNNSTFVTGGA---QIQLWDSSR----SKP-I 206

Query: 221 TFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPF 280
           +      D + +VK++ +E  I  S   D+++ L+D R++     I      N + ++P 
Sbjct: 207 SNLTWGADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIVQSMRSNAICWNPM 266

Query: 281 SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIV 340
            +  F  A  D+  Y YD+R++S  L     H  AV  ++F P   G    +GS  +TI 
Sbjct: 267 EAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPT--GTELVTGSYDKTI- 323

Query: 341 WDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKC 400
             + +IG   +++          + H      +  +  + +  ++V+ +++ N V++W+ 
Sbjct: 324 -RIYDIGHGHSRE----------IYHTKRMQHVFQVKYSMDSRYIVSGSDDGN-VRLWRS 371

Query: 401 SS 402
            +
Sbjct: 372 KA 373

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 86/227 (37%), Gaps = 66/227 (29%)

Query: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN 231
             TL  H+   Y  +F+ + KY LLSGS+D  + LW +              D HT ++ 
Sbjct: 518 CKTLVGHSGTVYSTSFSPDNKY-LLSGSEDKTVRLWSM--------------DTHTALV- 561

Query: 232 DVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTD 291
                S + H                             P   ++FSP   + FA A  D
Sbjct: 562 -----SYKGH---------------------------NHPVWDVSFSPL-GHYFATASHD 588

Query: 292 NLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQT 351
               L+    +  PL    GH + V  + F PN    +++  SD+   +WD+       T
Sbjct: 589 QTARLWSCDHIY-PLRIFAGHLNDVDCVSFHPNG-CYVFTGSSDKTCRMWDV------ST 640

Query: 352 QDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            D +         +  GH   +  IAV P+  WL ++  ED I+ +W
Sbjct: 641 GDSVR--------LFLGHTAPVISIAVCPDGRWL-STGSEDGIINVW 678

>KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 106/248 (42%), Gaps = 25/248 (10%)

Query: 164 SKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFE 223
           + N V  L  TLE H      LA +A +   L+S S D  +  W ++  ++     +   
Sbjct: 2   ASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSF 61

Query: 224 DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPFSS 282
             H+ I+ DV      A+   S S D T++L+D  + +     +  K    ++A    +S
Sbjct: 62  KGHSHIVQDVTLTPDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKAS 120

Query: 283 NLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP----NNDGI-LYSSGSDRR 337
            + + +  D  + ++ I+     L  + GH D V+ +   P    N+D + + S+G+D+ 
Sbjct: 121 MIISGS-RDKSIKVWTIK--GQCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKM 177

Query: 338 TIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQI 397
              W+L +   E                  GH  ++N I  +P+   L+ASA++   + +
Sbjct: 178 VKAWNLNQFQIEAD--------------FVGHNANVNTITASPDGT-LIASADKSGEIML 222

Query: 398 WKCSSNIP 405
           W   +  P
Sbjct: 223 WNLHNKTP 230

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 78/172 (45%), Gaps = 27/172 (15%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++S S D+   +WD+ +    +K  +    AH   + DV++ +    +F S   D ++++
Sbjct: 259 IISSSIDTTCIVWDLQS-SHYVKTQLI---AHDSEVFDVRFLTKSTQLFASCGGDGSVRV 314

Query: 255 FDKRS---SQIIH------------NINTKKPYNTLAF-------SPFSSNLFAAAGTD- 291
           FD RS   S II+               T  P +  ++       SP+  N+ A    D 
Sbjct: 315 FDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAADS 374

Query: 292 NLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           N + + D+R+  +P+  + GH  +V  I++ P    +L S   D + + WDL
Sbjct: 375 NKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDL 426

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 64/148 (43%), Gaps = 23/148 (15%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL---------------STLE 176
           HD E+   R++ +   + A+  G+G + ++D        ++                T  
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTT 345

Query: 177 YHTENGYGLAFNANEKYS---LLSGSDDSN-IALWDISNFEKNIKPTITFEDAHTDIIND 232
             ++  Y L       Y    L + + DSN I + D+ N E    P +T E  H+  +N+
Sbjct: 346 PSSDGSYALLRLEPSPYDPNVLATFAADSNKIIILDMRNPES---PILTLE-GHSSSVNE 401

Query: 233 VKWHSSEAHIFGSVSEDSTMKLFDKRSS 260
           +KWH ++ ++  S S+D  +  +D  +S
Sbjct: 402 IKWHPTKRNVLLSCSDDCQVLYWDLNNS 429

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 85/203 (41%), Gaps = 36/203 (17%)

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN--INTKKPYNTLAFSPFSSNLFAA 287
           I    W++ + ++  S S D+T  ++D +SS  +    I        + F   S+ LFA+
Sbjct: 246 ITSFDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFAS 305

Query: 288 AGTDNLVYLYDIRDVSNP--LY---------------AMTGHED---AVTAIEFDPNNDG 327
            G D  V ++D+R +++   +Y                 T   D   A+  +E  P +  
Sbjct: 306 CGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPN 365

Query: 328 ILYSSGSD-RRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLV 386
           +L +  +D  + I+ D++              P   ++   GH +S+N+I  +P    ++
Sbjct: 366 VLATFAADSNKIIILDMRN-------------PESPILTLEGHSSSVNEIKWHPTKRNVL 412

Query: 387 ASAEEDNIVQIWKCSSNIPRIGG 409
            S  +D  V  W  +++   I G
Sbjct: 413 LSCSDDCQVLYWDLNNSFMEING 435

>KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 420

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 104/255 (40%), Gaps = 53/255 (20%)

Query: 136 ITRARYMPQ-DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYG---------- 184
           I+R ++ P  +   +AT +   +++ Y          LS   Y+   G G          
Sbjct: 108 ISRVQWCPNGNSQQLATCSDSLRLWDYSDFVLQERLNLSFCRYNKSGGQGTVAALGQLPP 167

Query: 185 ---LAFNANEKYSLLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSE 239
                +NA +   ++S S D+   +WD+  +N+ K      T   AH   + DVK+ +  
Sbjct: 168 VSSFHWNAVDPNLIISSSIDTTCTVWDLQATNYVK------TQLIAHDSEVFDVKFLTQS 221

Query: 240 AHIFGSVSEDSTMKLFDKRS---SQIIHNINTKKPYNT---------------------- 274
             +F S   D ++++FD RS   S II+  +++    +                      
Sbjct: 222 TQLFASCGGDGSVRVFDLRSLAHSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNSASSGS 281

Query: 275 -----LAFSPFSSNLFAAAGTD-NLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGI 328
                L  SPF  N+ A    D N V + D+R     +  + GH  AV  I++ P+   +
Sbjct: 282 NALLRLEPSPFDPNVVATFAHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQWHPSRHNV 341

Query: 329 LYSSGSDRRTIVWDL 343
           L + G D + ++WDL
Sbjct: 342 LLTCGDDCQALLWDL 356

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 107/246 (43%), Gaps = 27/246 (10%)

Query: 164 SKNGVEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT 221
           + N V  L  TLE H  NG+   LA +A +   LLS S D  +  W ++  ++     + 
Sbjct: 2   ASNEVLVLRGTLEGH--NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVR 59

Query: 222 FEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFS 281
               H+ I+ D    +  A+   S S D T++L+D  + +        K           
Sbjct: 60  SFKGHSHIVQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKK 118

Query: 282 SNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN----NDGI-LYSSGSDR 336
           +++  +   D  + ++ I+     L  + GH D V+ +   PN    +D + + S+G+D+
Sbjct: 119 ASMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQ 396
               W+L +   E   D I            GH ++IN +  +P+   L+ASA +D  + 
Sbjct: 177 MVKAWNLNQFQIE--ADFI------------GHNSNINTLTASPDGT-LIASAGKDGEIM 221

Query: 397 IWKCSS 402
           +W  ++
Sbjct: 222 LWNLAA 227

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 107/246 (43%), Gaps = 27/246 (10%)

Query: 164 SKNGVEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT 221
           + N V  L  TLE H  NG+   LA +A +   LLS S D  +  W ++  ++     + 
Sbjct: 2   ASNEVLVLRGTLEGH--NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVR 59

Query: 222 FEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFS 281
               H+ I+ D    +  A+   S S D T++L+D  + +        K           
Sbjct: 60  SFKGHSHIVQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKK 118

Query: 282 SNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN----NDGI-LYSSGSDR 336
           +++  +   D  + ++ I+     L  + GH D V+ +   PN    +D + + S+G+D+
Sbjct: 119 ASMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQ 396
               W+L +   E   D I            GH ++IN +  +P+   L+ASA +D  + 
Sbjct: 177 MVKAWNLNQFQIE--ADFI------------GHNSNINTLTASPDGT-LIASAGKDGEIM 221

Query: 397 IWKCSS 402
           +W  ++
Sbjct: 222 LWNLAA 227

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 107/246 (43%), Gaps = 27/246 (10%)

Query: 164 SKNGVEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT 221
           + N V  L  TLE H  NG+   LA +A +   LLS S D  +  W ++  ++     + 
Sbjct: 2   ASNEVLVLRGTLEGH--NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVR 59

Query: 222 FEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFS 281
               H+ I+ D    +  A+   S S D T++L+D  + +        K           
Sbjct: 60  SFKGHSHIVQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKK 118

Query: 282 SNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN----NDGI-LYSSGSDR 336
           +++  +   D  + ++ I+     L  + GH D V+ +   PN    +D + + S+G+D+
Sbjct: 119 ASMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQ 396
               W+L +   E   D I            GH ++IN +  +P+   L+ASA +D  + 
Sbjct: 177 MVKAWNLNQFQIE--ADFI------------GHNSNINTLTASPDGT-LIASAGKDGEIM 221

Query: 397 IWKCSS 402
           +W  ++
Sbjct: 222 LWNLAA 227

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 107/246 (43%), Gaps = 27/246 (10%)

Query: 164 SKNGVEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT 221
           + N V  L  TLE H  NG+   LA +A +   LLS S D  +  W ++  ++     + 
Sbjct: 2   ASNEVLVLRGTLEGH--NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVR 59

Query: 222 FEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFS 281
               H+ I+ D    +  A+   S S D T++L+D  + +        K           
Sbjct: 60  SFKGHSHIVQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKK 118

Query: 282 SNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN----NDGI-LYSSGSDR 336
           +++  +   D  + ++ I+     L  + GH D V+ +   PN    +D + + S+G+D+
Sbjct: 119 ASMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQ 396
               W+L +   E   D I            GH ++IN +  +P+   L+ASA +D  + 
Sbjct: 177 MVKAWNLNQFQIE--ADFI------------GHNSNINTLTASPDGT-LIASAGKDGEIM 221

Query: 397 IWKCSS 402
           +W  ++
Sbjct: 222 LWNLAA 227

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 78/174 (44%), Gaps = 11/174 (6%)

Query: 166 NGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           N  + LL T  +H E  +    +   K + ++G   + I LWD        KP       
Sbjct: 161 NTGDGLLKT--FHGEYAFQSIDHHRTKSTFVTGG--AQIELWDTGR----SKPVSNLSWG 212

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLF 285
             D +  VK++ +E  I  S   D+++ L+D R++     I      N + ++P  +  F
Sbjct: 213 -ADNVTSVKFNQNETDILASTGSDNSVVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNF 271

Query: 286 AAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
             A  D+  Y YD+R++S  L     H  AV  ++F P  D I+  +GS  +T+
Sbjct: 272 VIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTV 323

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 303 SNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
           S P+  ++   D VT+++F+ N   IL S+GSD   +++DL+
Sbjct: 203 SKPVSNLSWGADNVTSVKFNQNETDILASTGSDNSVVLYDLR 244

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 102/224 (45%), Gaps = 21/224 (9%)

Query: 144 QDDNIIATI--NGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDD 201
            D+ IIA    NG  + F  +  ++     ++ L  HT     + FNA +   L SG   
Sbjct: 72  HDNAIIAGALENGVVEFFAPEEPRS-----VAKLAQHTTPVKTVTFNARQHNVLCSGGSK 126

Query: 202 SNIALWDISNFEKNIKPTITFEDAHT--DIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS 259
             I +WD +  E           A T  D I  + W+ ++AH+F S        ++D ++
Sbjct: 127 GEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFASAGSSGYASIWDLKA 186

Query: 260 SQIIHNINTKKP----YNTLA---FSPFSSNLFAAAG---TDNLVYLYDIRDVSNPLYAM 309
            + + +++   P     N L+   + P +S   A A    +D  + ++D+R+ + P+  +
Sbjct: 187 KKEVIHLSYASPVTGQRNQLSIVEWHPNNSTRIATASGNDSDPSILIWDLRNANVPMQVL 246

Query: 310 T-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
           +  H   V ++++   ++ +L SSG D   ++W+ +E G   TQ
Sbjct: 247 SQPHTKGVLSLDWCKQDETLLLSSGRDNVCVLWNPEE-GQSLTQ 289

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 64/148 (43%), Gaps = 13/148 (8%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD-DSNIALWDISNFEKNIKPT 219
           Y     G    LS +E+H  N   +A          SG+D D +I +WD+ N   N+ P 
Sbjct: 195 YASPVTGQRNQLSIVEWHPNNSTRIA--------TASGNDSDPSILIWDLRN--ANV-PM 243

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYN-TLAFS 278
                 HT  +  + W   +  +  S   D+   L++    Q +    T+  +     F+
Sbjct: 244 QVLSQPHTKGVLSLDWCKQDETLLLSSGRDNVCVLWNPEEGQSLTQYPTRGNWCFKTKFA 303

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
           P + +LFA+A  DN + +  +++V+  L
Sbjct: 304 PQTPDLFASASFDNKIEVQTLQNVTCSL 331

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 93/218 (42%), Gaps = 35/218 (16%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++S S D+   +WD+ +    +K  +    AH   + DV++ +    +F S   D ++++
Sbjct: 259 IISSSIDTTCIVWDLQS-SHYVKTQLI---AHDSEVFDVRFLTKSTQLFASCGGDGSVRV 314

Query: 255 FDKRS---SQIIH----------NINTKKP-------YNTLAFSPFSSNLFAAAGTD-NL 293
           FD RS   S II+          N     P          L  SP+  N+ A    D N 
Sbjct: 315 FDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNK 374

Query: 294 VYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ----EIGAE 349
           + + D+R+  +P+  + GH  +V  I++ P    +L S   D + + WDL     EI   
Sbjct: 375 IIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDLNNSFMEINGS 434

Query: 350 QTQD------EIEDGPPEVLMIHAGHKTSINDIAVNPN 381
            ++        +ED   + +M   G K +  +  +N N
Sbjct: 435 DSKSPTASGASLEDSDGDTVMADGGAKANQQEDPLNSN 472

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 72/163 (44%), Gaps = 32/163 (19%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL-STLEYHTENGYGLAFNAN 190
           HD E+   R++ +   + A+  G+G + ++D     + +L  ST+ Y   +      NA 
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFD-----LRSLAHSTIIYEPPSSPASGPNAG 340

Query: 191 EKYSLLSGSD--------------------DSN-IALWDISNFEKNIKPTITFEDAHTDI 229
                L GSD                    DSN I + D+ N E    P +  E  HT  
Sbjct: 341 ATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPE---SPILNLE-GHTCS 396

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQI-IHNINTKKP 271
           +N++KWH ++ ++  S S+D     +D  +S + I+  ++K P
Sbjct: 397 VNEIKWHPTKRNVLLSCSDDCQALYWDLNNSFMEINGSDSKSP 439

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 78/183 (42%), Gaps = 23/183 (12%)

Query: 150 ATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDI 209
           +  N EG I  +D      E+    ++ H EN            +  +G   + I LWD+
Sbjct: 165 SVTNEEGLIRTFD-----GESAFQGIDSHRENS-----------TFATGG--AKIHLWDV 206

Query: 210 SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTK 269
           +     +KP         D I  +K++ +E  I  S   D+++ L+D R++     I   
Sbjct: 207 NR----LKPVSDLSWG-ADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQT 261

Query: 270 KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGIL 329
              N + ++P  +  F  A  D+  Y YD+R++S  L     H  AV  ++F P  D I+
Sbjct: 262 MRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEIV 321

Query: 330 YSS 332
             S
Sbjct: 322 TGS 324

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 88/193 (45%), Gaps = 34/193 (17%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDV---- 233
           H +  Y +A N      L +GS D  I  W++S  E+     ++F+ AH  ++  +    
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREE----FVSFK-AHYGLVTGLCVTQ 120

Query: 234 -KWHSSE-----AHIFGSVSEDSTMKLF--------DKRSSQIIHNINTKKPYNTL---- 275
            ++H  +      +   S S+D T+KL+        +K SS      N +    T     
Sbjct: 121 PRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGES 180

Query: 276 AFSPFSSN----LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYS 331
           AF    S+     FA  G    ++L+D+  +  P+  ++   D +T+++F+ N   IL S
Sbjct: 181 AFQGIDSHRENSTFATGGAK--IHLWDVNRLK-PVSDLSWGADNITSLKFNQNETDILAS 237

Query: 332 SGSDRRTIVWDLQ 344
           +GSD   +++DL+
Sbjct: 238 TGSDNSIVLYDLR 250

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 98/245 (40%), Gaps = 27/245 (11%)

Query: 168 VEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           V  L  TLE H  NG+   LA +A +   LLS S D  +  W ++  ++     +     
Sbjct: 5   VLVLRGTLEGH--NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKG 62

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLF 285
           H+ I+ D    +  A+   S S D T++L++  + +        K           +++ 
Sbjct: 63  HSHIVQDCALTADGAYAL-SASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMI 121

Query: 286 AAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDG-----ILYSSGSDRRTIV 340
            +   D  + ++ I+   + L  M GH D V+ +   PN +       L S+G D+    
Sbjct: 122 ISGSRDKTIKVWTIK--GDCLATMLGHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKA 179

Query: 341 WDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKC 400
           W++ +   E                  GH   IN I  +P+   L+ASA +D  + +W  
Sbjct: 180 WNVNQFQIEAD--------------FVGHNNYINTITASPDGT-LIASAGKDGDIMLWNL 224

Query: 401 SSNIP 405
               P
Sbjct: 225 KEKSP 229

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 93/178 (52%), Gaps = 12/178 (6%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           ++++ E H+    G+ ++++ ++ L+SG +D  + L+   NF+ N     T    H   +
Sbjct: 216 VITSRETHSGKISGIDWSSDSRH-LVSGGEDGIVKLY---NFDSNSIQVATSFIGHDARV 271

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFD--KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAA 288
            +VK+H S+ +I GS S D+T +L+D    S  ++   ++K+ Y +L+F    S L A A
Sbjct: 272 TNVKFHPSQKYI-GSASFDTTWRLWDIVTNSELLLQEGHSKEIY-SLSFQTDGS-LIATA 328

Query: 289 GTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEI 346
           G D +  ++D+R   N L ++ GH   +   ++  N  G       D    +WDL+++
Sbjct: 329 GADKVGIIWDLRSGKNIL-SLVGHAKPIYCSDWSQN--GYQXXXSGDGTIKIWDLRKV 383

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (47%), Gaps = 10/142 (7%)

Query: 208 DISNFE-KNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL--FDKRSSQIIH 264
           DIS F  K + P IT  + H+  I+ + W S   H+  S  ED  +KL  FD  S Q+  
Sbjct: 204 DISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLV-SGGEDGIVKLYNFDSNSIQVAT 262

Query: 265 N-INTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNP-LYAMTGHEDAVTAIEFD 322
           + I        + F P S     +A  D    L+DI  V+N  L    GH   + ++ F 
Sbjct: 263 SFIGHDARVTNVKFHP-SQKYIGSASFDTTWRLWDI--VTNSELLLQEGHSKEIYSLSFQ 319

Query: 323 PNNDGILYSSGSDRRTIVWDLQ 344
            +   ++ ++G+D+  I+WDL+
Sbjct: 320 TDG-SLIATAGADKVGIIWDLR 340

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 89/212 (41%), Gaps = 30/212 (14%)

Query: 197 SGSDDSNIALWDISNF---------EKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVS 247
           +G  DS I LW +             K+   T+T    H+  +  V + S +     S S
Sbjct: 504 AGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTL-IGHSGPVYSVSF-SPDNRYLVSAS 561

Query: 248 EDSTMKLFDKRS-SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
           ED T++L+   + + ++       P   + FSP   + FA    D    L+   D   PL
Sbjct: 562 EDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLG-HYFATGSHDQTARLWSC-DHIYPL 619

Query: 307 YAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIH 366
               GH + V  + F PN   +L  S SD+   +WD+Q      T D +         + 
Sbjct: 620 RIFAGHLNDVDCVTFHPNGTYVLTGS-SDKTCRMWDIQ------TGDSVR--------LF 664

Query: 367 AGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            GH  S+  +AV+P+  WL  +  ED ++ +W
Sbjct: 665 LGHTASVVSVAVSPDGRWLT-TGSEDGVIIVW 695

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 71/156 (45%), Gaps = 13/156 (8%)

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           +GS D    LW   +    I P   F   H + ++ V +H +  ++  + S D T +++D
Sbjct: 601 TGSHDQTARLWSCDH----IYPLRIFA-GHLNDVDCVTFHPNGTYVL-TGSSDKTCRMWD 654

Query: 257 KRSSQIIH-NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH-ED 314
            ++   +   +       ++A SP           D ++ ++DI      +  M GH + 
Sbjct: 655 IQTGDSVRLFLGHTASVVSVAVSP-DGRWLTTGSEDGVIIVWDI-GTGKRIKQMRGHGKS 712

Query: 315 AVTAIEFDPNNDG-ILYSSGSDRRTIVWDLQEIGAE 349
           AV ++ F  N +G IL S G+D+   VWDL++   E
Sbjct: 713 AVYSLSF--NKEGNILVSGGADQSVRVWDLKKFTNE 746

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 73/152 (48%), Gaps = 26/152 (17%)

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENG-YGLAFNANEKYSLLSGSDDSN 203
           D   + T + +G I ++D    G    +  +  H ++  Y L+FN  E   L+SG  D +
Sbjct: 679 DGRWLTTGSEDGVIIVWDI---GTGKRIKQMRGHGKSAVYSLSFN-KEGNILVSGGADQS 734

Query: 204 IALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR----- 258
           + +WD+  F    +P++  E  ++  + D++          SV++D  +K + +R     
Sbjct: 735 VRVWDLKKFTN--EPSLEPEQPYSGYLGDME---------ASVNQD--VKEYGRRRTVFP 781

Query: 259 SSQIIHNINTKK-PYNTLAFSPFSSNLFAAAG 289
           +  ++ + +TKK P  T+ F+   +NL  A G
Sbjct: 782 TQDLMASFHTKKTPIYTVKFT--RTNLVLAGG 811

>Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]
           {ON} complement(171777..175607) [3831 nt, 1277 aa]
          Length = 1276

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 100/213 (46%), Gaps = 16/213 (7%)

Query: 145 DDNIIATI--NGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202
           DD+++A    NG  K F +D S N V + +S    H++    + FN  +   +LSG  DS
Sbjct: 67  DDHVVAGAMKNGGLKFFKFDAS-NNVVSQVSEFNSHSKEANVVKFNYVQSNVMLSGGSDS 125

Query: 203 NIALWDISNFEKNIKPTITFEDAHT----DIINDVKWHSSEAHIFGSVSEDSTMKLFD-K 257
            I +WD       +  T     A T      I+ + W+ S +H+F S ++ +   ++D K
Sbjct: 126 EIFIWDTKKCLSQLDYTPLTPGAVTGTSNPTISSLAWNHSLSHVFASAADTTHASIWDLK 185

Query: 258 RSSQIIH------NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTG 311
              +++H          K   + + + P +S   A + T +++ ++D+R+ + PL  +  
Sbjct: 186 AKKEVMHLAYSNPETGMKSQLSIVEWDPKNSTRVATSSTSSIL-IWDLRNSAKPLQILDS 244

Query: 312 HEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
            +  V ++++   +   L +S  +   ++W+ Q
Sbjct: 245 -QATVKSLDWCAKDQDYLLASSDNNTVVLWNPQ 276

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 28/146 (19%), Positives = 70/146 (47%), Gaps = 16/146 (10%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTI 220
           Y   + G+++ LS +E+  +N   +A            S  S+I +WD+ N   + KP  
Sbjct: 195 YSNPETGMKSQLSIVEWDPKNSTRVA-----------TSSTSSILIWDLRN---SAKPLQ 240

Query: 221 TFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPF 280
             +   T  +  + W + +     + S+++T+ L++ ++++ +        Y+ + F+P 
Sbjct: 241 ILDSQAT--VKSLDWCAKDQDYLLASSDNNTVVLWNPQTNEKLSTFPGNTCYSKVKFAPE 298

Query: 281 SSNLFAAAGTDNLVYLYDIRDVSNPL 306
              +FA+A ++  + +  ++D++  L
Sbjct: 299 LPEIFASASSETPIKVRSLQDITTSL 324

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 105/247 (42%), Gaps = 25/247 (10%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           +L+  E  +    G+AF+ +  + L++    S I LWD       +   +   + H   +
Sbjct: 3   MLTKFESKSTRAKGIAFHPSRPWVLVALFS-STIQLWDY-----RMGTLLHRFEGHEGPV 56

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT 290
             + +H ++  IF S  +DST+KL+   +++ ++       Y    F         +A  
Sbjct: 57  RGIDFHPTQP-IFASSGDDSTIKLWSLDTNKCLYTFTGHLDYIRTVFFHKELPWIISASD 115

Query: 291 DNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQ 350
           D  + +++ ++    L  +TGH   V   +F P  D ++ S+  D    VWD+  +  + 
Sbjct: 116 DQTIRIWNWQN-RKELACITGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISALRKKH 173

Query: 351 TQ--DEIED-------------GPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIV 395
           +   D +E+             G   V  I  GH   +N    +P +  L+ S  +D  V
Sbjct: 174 SAPVDRLEEMMIQQQNLLDSGFGDYVVKFILEGHTRGVNWATFHPTLP-LIVSGSDDRQV 232

Query: 396 QIWKCSS 402
           ++W+ S+
Sbjct: 233 KLWRMSA 239

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 102/264 (38%), Gaps = 51/264 (19%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           LL   E H     G+ F+  +     SG DDS I LW +       K   TF   H D I
Sbjct: 45  LLHRFEGHEGPVRGIDFHPTQPIFASSG-DDSTIKLWSLDTN----KCLYTFT-GHLDYI 98

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLA-FSPFSSNLFAAAG 289
             V +H     I  S S+D T+++++ ++ + +  I     +   A F P + +L  +A 
Sbjct: 99  RTVFFHKELPWII-SASDDQTIRIWNWQNRKELACITGHNHFVMCAQFHP-TEDLVVSAS 156

Query: 290 TDNLVYLYDI----RDVSNPL------------------------YAMTGHEDAVTAIEF 321
            D  V ++DI    +  S P+                        + + GH   V    F
Sbjct: 157 LDETVRVWDISALRKKHSAPVDRLEEMMIQQQNLLDSGFGDYVVKFILEGHTRGVNWATF 216

Query: 322 DPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPN 381
            P    ++ S   DR+  +W +    A +                 GH  +++ +  +P+
Sbjct: 217 HPTLP-LIVSGSDDRQVKLWRMSATKAWEVD------------TCRGHSNNVDCVIFHPH 263

Query: 382 INWLVASAEEDNIVQIWKCSSNIP 405
            N L+ SA ED  +++W     +P
Sbjct: 264 QN-LIISAGEDKTLRVWDLDKRMP 286

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 80/171 (46%), Gaps = 19/171 (11%)

Query: 186 AFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGS 245
           AF  +    +++G+ D+   +WD         P  T +  H + +  V W S +  +  +
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDTQT----PMHTLK-GHYNWVLCVSW-SPDGEVIAT 203

Query: 246 VSEDSTMKLFDKRSSQIIHNI--NTKKPYNTLAFSPF------SSNLFAAAGTDNLVYLY 297
            S D+T++L+D +S Q + +      K   +L++ P       S    A++  D  + ++
Sbjct: 204 GSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 263

Query: 298 D-IRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIG 347
           D +  V    Y M+GH ++V+ +++     G+LYS   DR   VWD+   G
Sbjct: 264 DTVSRVCQ--YTMSGHTNSVSCVKW--GGQGLLYSGSHDRTVRVWDINSQG 310

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 106/260 (40%), Gaps = 37/260 (14%)

Query: 143 PQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202
           P     +A+ + +G I I+D      +    T+  HT +   + +       L SGS D 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQY---TMSGHTNSVSCVKWGGQGL--LYSGSHDR 299

Query: 203 NIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSV----SEDSTMKLFDKR 258
            + +WDI++  +     I    +H   +N +   +  A   G+      + ST +   K+
Sbjct: 300 TVRVWDINSQGR----CINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKK 355

Query: 259 SSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTA 318
           + +    I  KK  N       S  +   A  D  ++L++    + P+  MTGH+  V  
Sbjct: 356 ALENYEKI-CKKNGN-------SEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNH 407

Query: 319 IEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAV 378
           + F P+   I+ S+  D    +WD +            DG  + +    GH  S+  +A 
Sbjct: 408 VAFSPDGRYIV-SASFDNSIKLWDGR------------DG--KFISTFRGHVASVYQVAW 452

Query: 379 NPNINWLVASAEEDNIVQIW 398
           + +   L+ S  +D  +++W
Sbjct: 453 SSDCR-LLVSCSKDTTLKVW 471

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 70/155 (45%), Gaps = 9/155 (5%)

Query: 188 NANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVS 247
           N N +  +++ SDD  + LW   N  K+ KP I     H  ++N V + S +     S S
Sbjct: 367 NGNSEEMMVTASDDYTMFLW---NPLKSTKP-IARMTGHQKLVNHVAF-SPDGRYIVSAS 421

Query: 248 EDSTMKLFDKRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
            D+++KL+D R  + I            +A+S     L  +   D  + ++D+R     +
Sbjct: 422 FDNSIKLWDGRDGKFISTFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVRTRKLSV 480

Query: 307 YAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVW 341
             + GH+D V  +++  +   +  S G D+   +W
Sbjct: 481 -DLPGHKDEVYTVDWSVDGKRVC-SGGKDKMVRLW 513

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
           +AF+ + +Y ++S S D++I LWD     ++ K   TF   H   +  V W SS+  +  
Sbjct: 408 VAFSPDGRY-IVSASFDNSIKLWD----GRDGKFISTFR-GHVASVYQVAW-SSDCRLLV 460

Query: 245 SVSEDSTMKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLY 297
           S S+D+T+K++D R+ ++  ++   K    T+ +S        + G D +V L+
Sbjct: 461 SCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWS-VDGKRVCSGGKDKMVRLW 513

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 101/206 (49%), Gaps = 26/206 (12%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            ++GS+D+ + +WD+++ +  +K T++    HT  + DV       ++F S SED  +K 
Sbjct: 102 FVTGSNDTTLKVWDLASGK--LKLTLS---GHTMGVRDVAVSERHPYMF-SASEDKLVKC 155

Query: 255 FD-KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHE 313
           +D ++++ I          +T+   P + +L A  G D +V L+DIR     +  + GH+
Sbjct: 156 WDLEKNTAIRDYYGHLSGVHTVDIHP-TLDLIATGGRDAVVKLWDIR-TRKAVKTLVGHK 213

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSI 373
             +T ++  P +  ++ SS +D    +WD            I  G    ++ H  HK ++
Sbjct: 214 APITKVKCTPVDPQVV-SSSTDTTVRLWD------------IVAGKSMKVLTH--HKRAV 258

Query: 374 NDIAVNPNINWLVASAEEDNIVQIWK 399
             IA++P    L ++  +D  V+ W+
Sbjct: 259 RSIALHPGEFSLASACTDD--VRSWR 282

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 106/247 (42%), Gaps = 26/247 (10%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           +L+  E  +    G+AF+ +  + L++    S I LWD     +       FED H   +
Sbjct: 3   MLTKFESKSSRAKGIAFHPSRPWVLVALFS-STIQLWDY----RMGTLLHRFED-HEGPV 56

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT 290
             + +H ++  IF S  +D T+K++   +++ ++ +     Y    F         +A  
Sbjct: 57  RGLDFHPTQP-IFVSAGDDYTIKVWSLETNKCLYTLQGHLDYVRTVFFHHELPWIISASD 115

Query: 291 DNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEI---- 346
           D  + +++ ++    +  +TGH   V   +F PN D ++ S+  D    VWD+  +    
Sbjct: 116 DQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPNED-LVVSASLDESVRVWDISGLRKKH 173

Query: 347 ---GAEQTQDEIED---------GPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNI 394
              G    +D+I           G   V  I  GH   +N  + +P +  L+ S  +D  
Sbjct: 174 SAPGTTSMEDQIAAQNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQ 232

Query: 395 VQIWKCS 401
           V++W+ S
Sbjct: 233 VKLWRMS 239

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 102/265 (38%), Gaps = 52/265 (19%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           LL   E H     GL F+  +    +S  DD  I +W +   E N K   T +  H D +
Sbjct: 45  LLHRFEDHEGPVRGLDFHPTQPI-FVSAGDDYTIKVWSL---ETN-KCLYTLQ-GHLDYV 98

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLA-FSPFSSNLFAAAG 289
             V +H     I  S S+D T+++++ ++ + I  +     +   A F P + +L  +A 
Sbjct: 99  RTVFFHHELPWII-SASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHP-NEDLVVSAS 156

Query: 290 TDNLVYLYDIRDV----SNP-------------------------LYAMTGHEDAVTAIE 320
            D  V ++DI  +    S P                          + + GH   V    
Sbjct: 157 LDESVRVWDISGLRKKHSAPGTTSMEDQIAAQNNLLDGGFGDCVVKFILEGHTRGVNWAS 216

Query: 321 FDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNP 380
           F P    ++ S   DR+  +W + +  A +                 GH  +++ +  +P
Sbjct: 217 FHPTLP-LIVSGSDDRQVKLWRMSQTKAWEVD------------TCRGHTNNVDCVIFHP 263

Query: 381 NINWLVASAEEDNIVQIWKCSSNIP 405
           + N L+ S  ED  ++IW     +P
Sbjct: 264 HQN-LIISVGEDKTLRIWDLDKRVP 287

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 82/179 (45%), Gaps = 36/179 (20%)

Query: 195 LLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTM 252
           L+S S D+   +WD+  SN+ K      T   AH   + DVK+      +F S   D ++
Sbjct: 316 LISSSIDTTCIVWDLQSSNYVK------TQLIAHDSEVFDVKFLIQSTQLFASCGGDGSI 369

Query: 253 KLFDKRS---SQIIH--------------NINTK---KPYNTLAF-------SPFSSNLF 285
           ++FD R+   S II+              ++ TK      N+L+        SP   NL 
Sbjct: 370 RVFDLRALQHSTIIYETANDLQGNNTFNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLI 429

Query: 286 AAAGTDN-LVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           A  G D   + + D+R+   P+  ++GH  +V  I++ P+   +L S G D + + WDL
Sbjct: 430 ATFGLDKKAILILDMRNPGVPVLVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 136 ITRARYMPQDDNIIATINGEGK-IFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYS 194
           + R    P D N+IAT   + K I I D    GV  L+  L  H+ +   + ++ ++ Y 
Sbjct: 416 LLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLV--LSGHSPSVNQIKWHPSKPYV 473

Query: 195 LLSGSDDSNIALWDISNFEKNIKPT 219
           LLS  DD  +  WD+ N E N K T
Sbjct: 474 LLSCGDDCQVLYWDL-NSELNPKVT 497

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 119/268 (44%), Gaps = 23/268 (8%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T   Y    D +++  + +G++ I+  + N V+ +    + H E    ++F+  +
Sbjct: 122 HDSAVTVMTYSHTGDWMVSG-SADGELKIWQPNFNMVKVMD---QAHMECVREISFSPTD 177

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
           +   +S SDD+ + +W+ SN ++           H D+     WH     I  S S+D+ 
Sbjct: 178 Q-KFVSCSDDNVLKIWNFSNGQQER----VLSGHHWDV-KSCDWHPKMGLIV-SGSKDNL 230

Query: 252 MKLFDKRSSQIIHN-INTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +K +D RS   +   +  K    +  F P   NL +    D    +YDIR  +  L+++ 
Sbjct: 231 IKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVR 290

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
              D +T +++ P ++ +      D     +DL       +Q+   + P     I   H+
Sbjct: 291 DDVDYMT-LQWHPIDETVFTVGCYDGSIKHFDL-------SQENQPNKPTH--NIPYAHE 340

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             +  +A +P I  ++ASA +D  ++ W
Sbjct: 341 KCVTSLAYSP-IGHIMASASKDRTIRFW 367

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 95/206 (46%), Gaps = 26/206 (12%)

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           +GS+D+ I +WD+++    +K T+T    H   +  V        +F S SED  +K +D
Sbjct: 139 TGSNDTTIKVWDMAS--GKLKLTLT---GHVMTVRSVAVSQRHPLMF-SASEDKMVKCWD 192

Query: 257 KRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDA 315
              +  I + +      NT+   P + +L A+AG D +V L+DIR    P+  + GH+  
Sbjct: 193 LERNAAIRDYHGHFSGVNTVDVHP-TLDLIASAGRDAVVRLWDIR-TRLPVMTLAGHKSP 250

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSIND 375
           +  ++  P +  I+ S  SD    +WD            I  G    ++ H  H  S+  
Sbjct: 251 INQVKCFPVDPQIM-SCSSDATVRLWD------------IRAGKATKILTH--HSKSVRA 295

Query: 376 IAVNPNINWLVASAEEDNIVQIWKCS 401
           IA +P  + +  ++  D  V+ W+ S
Sbjct: 296 IAAHPAESSVATASTSD--VRSWRHS 319

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 59/127 (46%), Gaps = 17/127 (13%)

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRT 338
           P  +  FA    D  + ++D+      L  +TGH   V ++     +  +++S+  D+  
Sbjct: 131 PVDNAWFATGSNDTTIKVWDMASGKLKL-TLTGHVMTVRSVAVSQRHP-LMFSASEDKMV 188

Query: 339 IVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
             WDL+   A      I D        + GH + +N + V+P ++ L+ASA  D +V++W
Sbjct: 189 KCWDLERNAA------IRD--------YHGHFSGVNTVDVHPTLD-LIASAGRDAVVRLW 233

Query: 399 KCSSNIP 405
              + +P
Sbjct: 234 DIRTRLP 240

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 87/227 (38%), Gaps = 66/227 (29%)

Query: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN 231
             TL  H+   Y  +F+ + KY LLSGS+D  + LW +              D HT +++
Sbjct: 520 CKTLVGHSGTVYSTSFSPDNKY-LLSGSEDKTVRLWSM--------------DTHTALVS 564

Query: 232 DVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTD 291
             K H+                                 P   + FSP   + FA A  D
Sbjct: 565 -YKGHN--------------------------------HPVWDVNFSPLG-HYFATASHD 590

Query: 292 NLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQT 351
               L+    +  PL    GH + V  + F PN    L++  SD+   +W++       T
Sbjct: 591 QTARLWSCDHIY-PLRIFAGHLNDVDCVSFHPNG-CYLFTGSSDKTCRMWNVS------T 642

Query: 352 QDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            D +         +  GH   +  IAV+P+  WL ++  ED I+ +W
Sbjct: 643 GDSVR--------LFLGHTAPVISIAVSPDGRWL-STGSEDGIINVW 680

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 119/232 (51%), Gaps = 21/232 (9%)

Query: 125 KIVKKFPHDG-EITRARYMPQ-----DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYH 178
           K +KKF   G ++  +R + Q     DD+++AT +  G + I   S   +E + +    H
Sbjct: 167 KSLKKFELSGSQLVSSRPVSQVAISSDDSMVATCSWGGDLKIL--STETLEIIKAFDTAH 224

Query: 179 TENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSS 238
                G+ +N  +  +L++G+ +  I +W+++N  ++   T+T    H + +  V++H S
Sbjct: 225 DSKIGGVDWNP-DGTALVTGAANGEIRIWNLNNDSESPAGTLT---GHENRVARVRFHPS 280

Query: 239 EAHIFGSVSEDSTMKLFD--KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYL 296
             ++  S S D T +L+D  K+    +   + K+ Y  +AF    S L  + G D++  +
Sbjct: 281 GKYV-ASASFDMTWRLWDVEKQIELQLQEGHAKEVY-CVAFQKDGS-LLCSTGLDSVGLV 337

Query: 297 YDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIG 347
           +D+R     + A+ GH   +  +++ PN  G   ++GS   TI +WD++++G
Sbjct: 338 WDLRS-GKSIMALEGHIKPIYGLDWSPN--GYDIATGSADGTIRLWDVRKVG 386

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 54/113 (47%), Gaps = 11/113 (9%)

Query: 144 QDDNIIATINGEGKIFIYD-RSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202
           +D +++ +   +    ++D RS   + AL    E H +  YGL ++ N  Y + +GS D 
Sbjct: 321 KDGSLLCSTGLDSVGLVWDLRSGKSIMAL----EGHIKPIYGLDWSPN-GYDIATGSADG 375

Query: 203 NIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLF 255
            I LWD+          +    AH  I+++VK+  +  H   S S D T+ ++
Sbjct: 376 TIRLWDVRKV-----GILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIY 423

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 68/169 (40%), Gaps = 18/169 (10%)

Query: 237 SSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTK--KPYNTLAFSPFSSNLFAAAGTDNLV 294
           SS+  +  + S    +K+    + +II   +T        + ++P  + L   A    + 
Sbjct: 191 SSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANGEIR 250

Query: 295 YLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDE 354
                 D  +P   +TGHE+ V  + F P+    + S+  D    +WD+++        +
Sbjct: 251 IWNLNNDSESPAGTLTGHENRVARVRFHPSGK-YVASASFDMTWRLWDVEK--------Q 301

Query: 355 IEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSN 403
           IE      L +  GH   +  +A   + + L+ S   D++  +W   S 
Sbjct: 302 IE------LQLQEGHAKEVYCVAFQKDGS-LLCSTGLDSVGLVWDLRSG 343

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 110/251 (43%), Gaps = 30/251 (11%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           LL+  E  +    G+AF+ +  ++L++    S I LWD       +   +   + H   +
Sbjct: 3   LLTKFESKSTRAKGIAFHPSRPWALVALFS-STIQLWDY-----RMGTLLHRFEGHEGPV 56

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNL--FAAA 288
             V +H ++  IF S  +D+++K++   +++ ++ +     Y    F  F S L    +A
Sbjct: 57  RAVDFHPTQP-IFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVF--FHSELPWVISA 113

Query: 289 GTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEI-- 346
             D  V +++ ++    L  +TGH   V   +F    D ++ S+  D    VWD+  +  
Sbjct: 114 SDDQTVRIWNWQN-RKELACLTGHNHFVMCAQFHQTED-LVVSASLDETVRVWDISGLRK 171

Query: 347 -----GAEQTQDEIED---------GPPEVLMIHAGHKTSINDIAVNPNINWLVASAEED 392
                G    +D +           G  +V  I  GH   +N  + +P +  L+ +  +D
Sbjct: 172 KHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLP-LIVTGGDD 230

Query: 393 NIVQIWKCSSN 403
             V++W+ SSN
Sbjct: 231 RQVKLWRMSSN 241

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 73/177 (41%), Gaps = 29/177 (16%)

Query: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNF-EKNIKPTIT-FEDAHTDI 229
           L+ L  H        F+  E   ++S S D  + +WDIS   +K+  P +T +ED+    
Sbjct: 130 LACLTGHNHFVMCAQFHQTEDL-VVSASLDETVRVWDISGLRKKHSAPGVTSYEDS---- 184

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAG 289
                  +S+ ++      D  +K   +  ++ +         N  +F P +  L    G
Sbjct: 185 ------LASQQNLLDGAFGDCKVKFILEGHTRGV---------NWASFHP-TLPLIVTGG 228

Query: 290 TDNLVYLYDIRDVSNPLY---AMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
            D  V L+  R  SN  +      GH + V  + F P+ + IL S   D+   +WDL
Sbjct: 229 DDRQVKLW--RMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLIL-SVAEDKTLRIWDL 282

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 103/237 (43%), Gaps = 25/237 (10%)

Query: 168 VEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHT 227
           V  L  TLE H      LA +A +   LLS S D  +  W ++  ++     +     H+
Sbjct: 4   VLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHS 63

Query: 228 DIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPFSSNLFA 286
            I+ D    +  A+   S S D T++L+D  + +     +  K    ++A    +S + +
Sbjct: 64  HIVQDCALTADGAYAL-SASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAIDRKASMIIS 122

Query: 287 AAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN----NDGI-LYSSGSDRRTIVW 341
            +  D  + ++ I+     L  M GH D V+ +   PN    +D + + S+GSD+    W
Sbjct: 123 GS-RDKTIKVWSIK--GECLATMLGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSW 179

Query: 342 DLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
           ++ +               ++     GH   IN I  +P+ + L+ASA +D  + +W
Sbjct: 180 NVNQF--------------QIDADFIGHNNYINAIVASPDGS-LIASAGKDGEIMMW 221

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 111/242 (45%), Gaps = 28/242 (11%)

Query: 164 SKNGVEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTIT 221
           S + +  L  TLE H  NG+   L+ +  +   LLSGS D  +  W ++  ++     + 
Sbjct: 18  STDEILVLRGTLEGH--NGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVR 75

Query: 222 FEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPF 280
               H+ I+ D    + +     S S D T++L+D +S + I   +  K    +++  P 
Sbjct: 76  SFKGHSHIVQDCT-VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPR 134

Query: 281 SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP---NNDGI-LYSSGSDR 336
           ++ + +A+  D  V +++   V + +  + GH D V+ +   P   ++D + + S+G D+
Sbjct: 135 ATQIVSAS-RDKTVKVWNT--VGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDK 191

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQ 396
              VWDLQ    E   D I            GH   +  +  +P+ + + ASA +D  + 
Sbjct: 192 VVKVWDLQSFTIE--ADFI------------GHNNYVTTVTPSPDGS-IFASAGKDGQII 236

Query: 397 IW 398
           +W
Sbjct: 237 LW 238

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 96/214 (44%), Gaps = 31/214 (14%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSE----AHIFGSVSEDS 250
           ++S S D  + +W+       +   +     H D +++V+   SE    A    S   D 
Sbjct: 138 IVSASRDKTVKVWN------TVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDK 191

Query: 251 TMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
            +K++D +S  I  +      Y T        ++FA+AG D  + L+++ +    LY + 
Sbjct: 192 VVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNE-KTALYTLD 250

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
             +D V A+ F PN   +  ++ S  +  ++DL+E      +  ++D  PE     AG+ 
Sbjct: 251 A-KDEVFAVAFSPNRYWLTAATASGIK--IFDLEE------RTIVDDLKPEF----AGYN 297

Query: 371 TSINDIAVNPNINW-----LVASAEEDNIVQIWK 399
            + +  AV  ++ W      + +   DNI+++W+
Sbjct: 298 KAQDPHAV--SLAWSADGQTLFAGYTDNIIRVWQ 329

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 117/274 (42%), Gaps = 28/274 (10%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           HD  +T  +Y    D +++  + +G I I+  + N V+ L      H E    +AF+  +
Sbjct: 120 HDSAVTVMQYSNAGDWLVSG-DADGTIKIWQPNFNMVKVLDHA---HMECMRDIAFSCGD 175

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
           +   ++ SDD+ + +W+ SN ++           H D+     WH     I  S S+D+ 
Sbjct: 176 Q-KFVTCSDDNVLKIWNFSNGQQER----VLSGHHWDV-KSCDWHPRFGLIV-SGSKDNL 228

Query: 252 MKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           +K +D R+ + +  I   K       F P   NL A    D    +YDIR     L  + 
Sbjct: 229 IKFWDPRTGRNVSTILGLKHTIIKTKFQPTQGNLLAVVAKDKSTKIYDIRQNMRELQTIR 288

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDG---PPEVLMIHA 367
              D ++ + + P N+  ++S G             GA +  D + D     P    I  
Sbjct: 289 DDVDYMSLV-WHPINE-TMFSVGCYN----------GAIKHFDLLHDNNSPVPSSHTITY 336

Query: 368 GHKTSINDIAVNPNINWLVASAEEDNIVQIWKCS 401
            H+ S+  +A +P +  ++ASA +D  ++ W  S
Sbjct: 337 AHEKSVTSLAYSP-VGHILASAAKDRTIRFWARS 369

>TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 106/239 (44%), Gaps = 29/239 (12%)

Query: 168 VEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           V  L  TLE H  NG+   LA +A +   LLS S D  +  W ++  ++     +     
Sbjct: 6   VLVLRGTLEGH--NGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKG 63

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPFSSNL 284
           H+ I+ D    +  A+   S S D T++L+D  + +     +  K    ++A    +S +
Sbjct: 64  HSHIVQDCALTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMI 122

Query: 285 FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP----NNDGI-LYSSGSDRRTI 339
            + +  D  V ++ I+     L  M GH D V+ +   P    N+D + + S+G D+   
Sbjct: 123 ISGS-RDKTVKVWTIK--GQCLATMLGHNDWVSQVRIVPTEDVNDDTVTVISAGMDKMVK 179

Query: 340 VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            W++ +   E   D I            GH   +N +  +P+ + L+ASA +D  + +W
Sbjct: 180 AWNVNQFQIE--ADFI------------GHNNYVNTVTASPDGS-LIASAGKDGEIMLW 223

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 228 DIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAA 287
           D I  VK++ +E  IF S   D+++ L+D R++     I      N + ++P  +  F  
Sbjct: 214 DNITTVKFNQNETDIFASAGSDNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVI 273

Query: 288 AGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
              D+  Y YD+R++S  +     H  AV  ++F P  D I+  +GS  +TI
Sbjct: 274 GNEDHNAYYYDMRNMSRAINVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 323

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 86/187 (45%), Gaps = 28/187 (14%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKW-- 235
           H +  Y +A N      L +GS D  I  W++S  ++      +F+ AH  +I  +    
Sbjct: 66  HRDGVYVIAKNYRNLNKLATGSADGVIKYWNMSTRDE----VCSFK-AHYGLITGLCVTP 120

Query: 236 -HSSEA---HIFGSVSEDSTMKLFDKRSSQIIH-----NINT-----KKPYNTLAFSPF- 280
            H S+    +   S S+D T+KL+   S   ++      +NT     K  Y+ +AF    
Sbjct: 121 EHLSKNKNDNFMLSCSDDKTVKLWSVNSEDYVNLKDDEQLNTTSGLLKTFYSDIAFQGID 180

Query: 281 ---SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRR 337
              S++ F   G    + L+D  + S PL  ++   D +T ++F+ N   I  S+GSD  
Sbjct: 181 HHRSNSNFVTGGAQ--IQLWD-SNRSTPLSNLSWGADNITTVKFNQNETDIFASAGSDNS 237

Query: 338 TIVWDLQ 344
            +++DL+
Sbjct: 238 IVLYDLR 244

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 5/47 (10%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPT 219
           YHT   ++ + + F+ + KY ++SGSDD N+ LW    +E+ N+K T
Sbjct: 337 YHTKRMQHVFQVKFSMDSKY-VISGSDDGNVRLWRSKAWERSNVKTT 382

>KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 723

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 81/194 (41%), Gaps = 42/194 (21%)

Query: 186 AFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFED---------AHTDIINDVKWH 236
               +E  SL++G  D+ + LWD+   E+     +  ED         AH D I  + + 
Sbjct: 454 CMQMDESSSLITGGRDALLKLWDLDKAEEQYFEGVPEEDEELCLHTFDAHVDEITALHF- 512

Query: 237 SSEAHIFGSVSEDSTMKLFDKRSSQIIH--NINTKKPYNTLAFSPFSSN----------- 283
             E +   S S+D T++ +D R+ + +   +IN      +  FS  SSN           
Sbjct: 513 --EGNSLVSGSQDRTIRQWDLRTGKCLQTIDINFTNRGTSDGFSTISSNNPRSSVLLTHN 570

Query: 284 -------------LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILY 330
                          A    D +V L+D+R +   +  + GH DAVT ++FD  N   L 
Sbjct: 571 DPPVIGALQCYDAAMATGTKDGIVRLWDLR-MGQVVRTLEGHTDAVTGLQFDAVN---LV 626

Query: 331 SSGSDRRTIVWDLQ 344
           +   DR   +WDL+
Sbjct: 627 TGSLDRSIRIWDLR 640

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 101/207 (48%), Gaps = 26/207 (12%)

Query: 178 HTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKW 235
           H  +G+   +A +  +     +GS+D  I +W++++ +  +K T+    AH   + D+  
Sbjct: 112 HGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGK--LKVTLK---AHDMTVRDLAI 166

Query: 236 HSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLV 294
            +   ++F SVSED T+K +D   +  I N +      +T+   P + ++   AG D++V
Sbjct: 167 SNRHPYMF-SVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHP-TVDVVVTAGRDSVV 224

Query: 295 YLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDE 354
            ++DIR    P+  + GH+  +T +   P +  ++ SS  D    +WDL           
Sbjct: 225 KVWDIR-TRLPVMTLPGHKGPITKVRCLPVDPQVI-SSSVDASIRLWDLVA--------- 273

Query: 355 IEDGPPEVLMIHAGHKTSINDIAVNPN 381
              G    ++ H  H+ ++ DI+V+P+
Sbjct: 274 ---GKSMKVLTH--HQRTVRDISVHPS 295

>Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,
           581 aa] {ON} complement(43262..43506,43751..45251) [1746
           nt, 582 aa]
          Length = 581

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 99/213 (46%), Gaps = 18/213 (8%)

Query: 125 KIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYG 184
           ++VK F    ++  +     D  ++   +  G + +YD     V  LL +++  T   + 
Sbjct: 72  QVVKTFSRFKDVVYSASFRNDGKLLCAGDATGLVSVYDSYNPRV--LLLSIKASTHPTHV 129

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
             F+  +  +L++ SDD    LWDIS+     +P I    A +D +  V    S  H+  
Sbjct: 130 TKFHTQDPKTLITASDDRVTRLWDISH---AYEPQIELTGA-SDYVRTVSCIPSAPHLIS 185

Query: 245 SVSEDSTMKLFDKR--SSQIIHNINTKKPY-NTLAFSPFSSNLFAAAGTDNLVYLYDIRD 301
           + S D  ++L+D R  +S  I+++N  +P  N +A SP  + L +  G +     + + D
Sbjct: 186 TGSYDGIVRLYDTRASASSPIYSLNHDQPVENVIAISP--TQLVSCGGPN-----FKVWD 238

Query: 302 VSN--PLYAMTGHEDAVTAIEFDPNNDGILYSS 332
           +++   LY        VT +++  N++  + S+
Sbjct: 239 LTSNKKLYERGNFNKTVTCLDYVENSESPMQSA 271

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 69/174 (39%), Gaps = 21/174 (12%)

Query: 233 VKWHSSEAHIFG--------SVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNL 284
           VK H+S  H++         +V+  + +++F  R+ Q++   +  K     A       L
Sbjct: 36  VKEHNSVTHVYFNPQHPHDFAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRNDGKL 95

Query: 285 FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
             A     LV +YD  +    L ++          +F   +   L ++  DR T +WD+ 
Sbjct: 96  LCAGDATGLVSVYDSYNPRVLLLSIKASTHPTHVTKFHTQDPKTLITASDDRVTRLWDIS 155

Query: 345 EIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
              A + Q E+            G    +  ++  P+   L+++   D IV+++
Sbjct: 156 H--AYEPQIEL-----------TGASDYVRTVSCIPSAPHLISTGSYDGIVRLY 196

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 99/232 (42%), Gaps = 29/232 (12%)

Query: 177 YHTENGYGLAFNANEKYSLLS-GSDDSNIALWDISNFEKNIK-PTITFEDA-------HT 227
           +H  N    +   +E   L++ G  DS+I +W +       K P+ + E +       H+
Sbjct: 468 FHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGHS 527

Query: 228 DIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS-SQIIHNINTKKPYNTLAFSPFSSNLFA 286
             +  V + S +     S SED T++L+   + + ++       P   + FSP   + FA
Sbjct: 528 GPVYSVSF-SPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLG-HYFA 585

Query: 287 AAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEI 346
               D    L+    +  PL    GH + V  + F PN   +L  S SD+   +WD+Q  
Sbjct: 586 TVSHDQTARLWSCDHIY-PLRIFAGHLNDVDCVAFHPNGTYVLTGS-SDKTCRMWDIQ-- 641

Query: 347 GAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
               T D +         +  GH  S+  +AV+P+  WL  +  ED ++ +W
Sbjct: 642 ----TGDSVR--------LFLGHTASVVSVAVSPDGRWLT-TGSEDGVIIVW 680

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 88/223 (39%), Gaps = 58/223 (26%)

Query: 173 STLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIND 232
           +TL  H+   Y ++F+ + +Y L+S S+D  + LW +  F       +     H   + D
Sbjct: 521 TTLIGHSGPVYSVSFSPDNRY-LVSASEDKTVRLWSLDTFT-----CLVSYKGHNHPVWD 574

Query: 233 VKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPY----NTLAFSPFSSNLFAAA 288
           VK+ S   H F +VS D T +L+   S   I+ +     +    + +AF P  + +   +
Sbjct: 575 VKF-SPLGHYFATVSHDQTARLW---SCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGS 630

Query: 289 GTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDP------------------------- 323
            +D    ++DI+   + +    GH  +V ++   P                         
Sbjct: 631 -SDKTCRMWDIQ-TGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI 688

Query: 324 ----------------NNDG-ILYSSGSDRRTIVWDLQEIGAE 349
                           N +G IL S G+D+   VWDL++   E
Sbjct: 689 KQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTNE 731

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 89/234 (38%), Gaps = 66/234 (28%)

Query: 165 KNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFED 224
           K+  +    TL  H+   Y  +F+ + KY LLSGS+D  + LW +     +    +    
Sbjct: 513 KDADDPTCKTLVGHSGTVYATSFSPDNKY-LLSGSEDKTVRLWSM-----DTHTALVSYK 566

Query: 225 AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNL 284
            H   + DV + S   H F + S D T +L+                             
Sbjct: 567 GHNHPVWDVNF-SPLGHYFATASHDQTARLW----------------------------- 596

Query: 285 FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
                  +  ++Y       PL    GH + V  + F PN    +++  SD+   +WD+ 
Sbjct: 597 -------SCDHIY-------PLRIFAGHLNDVDCVSFHPNG-CYVFTGSSDKTCRMWDV- 640

Query: 345 EIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
                 T D +         +  GH   +  IAV+P+  WL ++  ED I+ IW
Sbjct: 641 -----STGDSVR--------LFLGHTAPVICIAVSPDGRWL-STGSEDGIINIW 680

>CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178w PRP4
           U4/U6 snRNP
          Length = 500

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 90/218 (41%), Gaps = 26/218 (11%)

Query: 132 HDGEITRARYMPQD--------DNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGY 183
           HDG++    +   D        D++I   N     FI   S  G E  ++ L+ H    +
Sbjct: 253 HDGKVGGIAWTSNDSVLITGGEDHLITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGKF 312

Query: 184 GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIF 243
                      + + S DS   LWDI       +  +  ++ H+  +  + + +  A + 
Sbjct: 313 -----------IGTSSFDSTWRLWDIEK-----QKQLLLQEGHSKELYCLAFQADGA-LV 355

Query: 244 GSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVS 303
            +   D T  ++D RS + +  +                +  A  G D ++ ++D+R  S
Sbjct: 356 STAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRK-S 414

Query: 304 NPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVW 341
           + L  +T H+  VT+++FD  ND  L SSG DR   V+
Sbjct: 415 DKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVY 452

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 91/211 (43%), Gaps = 14/211 (6%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           H+G IT  +  P     I T + +    ++D  K   +  L   E H++  Y LAF A+ 
Sbjct: 297 HEGRITDLQVHPSG-KFIGTSSFDSTWRLWDIEK---QKQLLLQEGHSKELYCLAFQADG 352

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
                +G+D + I +WD+ +        ++    H   I  + W S + H   +   D  
Sbjct: 353 ALVSTAGTDKTAI-IWDLRS-----GKAVSQLQGHAKTIYCMDW-SIDGHTLATGGGDGV 405

Query: 252 MKLFDKRSSQIIHNINTKKPYNT-LAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT 310
           + ++D R S  +  I   K   T L F   + +   ++G D  +++Y  +D    + ++ 
Sbjct: 406 ITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYS-KDNYLKVSSLI 464

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVW 341
           GH D V   + D NN  ++ S G DR    W
Sbjct: 465 GHADKVLTFDIDKNNKNLI-SGGWDRSVKHW 494

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 90/215 (41%), Gaps = 24/215 (11%)

Query: 158 IFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIK 217
           I +YD  +NG  AL               F     +  LSG +D+ + +WD+ +  + ++
Sbjct: 171 INVYDGHENGTTAL--------------KFLPKSGHLFLSGGNDNKLKIWDLYHDRRLLR 216

Query: 218 PTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAF 277
                   H   I D  + ++++  F SVS D  +K++D     IIH        N + F
Sbjct: 217 DFC----GHQKPIRDFNF-TTDSKQFTSVSYDKFLKIWDTEKGAIIHRTKLTSVPNCVTF 271

Query: 278 SPFSSNLFAAAGTDNLVYLYDIRD-VSNPLYAMTGHE-DAVTAIEFDPNNDGILYSSGSD 335
            P ++        ++ +  YD RD   N L     H   ++ A++F PN    + SS  D
Sbjct: 272 HPINNYELVVGLLNSEIKHYDTRDNYKNGLIQTYDHHTSSIIALKFFPNGSKFI-SSSED 330

Query: 336 RRTIVWDLQ-EIGAEQTQDEIEDGPPEVLMIHAGH 369
           +   +WD Q  I  +Q  D  +   P +  IH  H
Sbjct: 331 KTIRIWDNQINIPIKQISDTAQHSMPWI-EIHPEH 364

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 14/88 (15%)

Query: 311 GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHK 370
           GHE+  TA++F P +  +  S G+D +  +WDL                  +L    GH+
Sbjct: 176 GHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYH-------------DRRLLRDFCGHQ 222

Query: 371 TSINDIAVNPNINWLVASAEEDNIVQIW 398
             I D     +      S   D  ++IW
Sbjct: 223 KPIRDFNFTTDSKQFT-SVSYDKFLKIW 249

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 79/196 (40%), Gaps = 27/196 (13%)

Query: 217 KPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD-KRSSQIIHNI-NTKKPYNT 274
           K  I   D H +    +K+     H+F S   D+ +K++D     +++ +    +KP   
Sbjct: 168 KKIINVYDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYHDRRLLRDFCGHQKPIRD 227

Query: 275 LAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNND-----GIL 329
             F+   S  F +   D  + ++D       +   T        + F P N+     G+L
Sbjct: 228 FNFTT-DSKQFTSVSYDKFLKIWDTE--KGAIIHRTKLTSVPNCVTFHPINNYELVVGLL 284

Query: 330 YSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASA 389
            S             EI    T+D  ++G   ++  +  H +SI  +   PN +  ++S+
Sbjct: 285 NS-------------EIKHYDTRDNYKNG---LIQTYDHHTSSIIALKFFPNGSKFISSS 328

Query: 390 EEDNIVQIWKCSSNIP 405
            ED  ++IW    NIP
Sbjct: 329 -EDKTIRIWDNQINIP 343

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 69/155 (44%), Gaps = 19/155 (12%)

Query: 245 SVSEDSTMKLFDKRS-SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVS 303
           S SED T++L+   + + ++       P   +AFSP   + FA A  D    L+   D  
Sbjct: 499 SASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLG-HYFATASHDQTARLWSC-DHI 556

Query: 304 NPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVL 363
            PL    GH + V  + F PN    +++  SD+   +WD+       T D +        
Sbjct: 557 YPLRIFAGHLNDVDTVSFHPNGT-YVFTGSSDKTCRMWDMS------TGDSVR------- 602

Query: 364 MIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            +  GH   +   AV+P+  WL ++  ED I+ +W
Sbjct: 603 -LFLGHTAPVTATAVSPDGRWL-STGSEDGIINVW 635

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 85/217 (39%), Gaps = 46/217 (21%)

Query: 173 STLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK------------------ 214
           +TL  H+   Y  AF+ + +Y LLS S+D  + LW    +                    
Sbjct: 476 ATLVGHSGTVYSTAFSPDNRY-LLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSP 534

Query: 215 --------------------NIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
                               +I P   F   H + ++ V +H +  ++F + S D T ++
Sbjct: 535 LGHYFATASHDQTARLWSCDHIYPLRIFA-GHLNDVDTVSFHPNGTYVF-TGSSDKTCRM 592

Query: 255 FDKRSSQIIH-NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH- 312
           +D  +   +   +    P    A SP      +    D ++ ++DI      L  M GH 
Sbjct: 593 WDMSTGDSVRLFLGHTAPVTATAVSP-DGRWLSTGSEDGIINVWDI-GTGKRLKQMRGHG 650

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAE 349
           ++AV ++ +      +L S G+D    VWD+++  AE
Sbjct: 651 KNAVYSLSYSKEGH-VLVSGGADHSLRVWDVKKSTAE 686

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 110/248 (44%), Gaps = 26/248 (10%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           +L+  E  +    G+AF+ +  + L++    S I LWD     +       FED H   +
Sbjct: 3   MLTKFESKSTRAKGIAFHPSRPWVLVALFS-STIQLWDY----RMGTLLHRFED-HEGPV 56

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT 290
             + +H ++  IF S  +D T+K++   +++ ++ ++    Y    F         +A  
Sbjct: 57  RGLDFHPTQP-IFVSAGDDYTIKVWSLDTNKCLYTLSGHLDYVRTVFFHRELPWIISASD 115

Query: 291 DNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------- 343
           D  + +++ ++    +  +TGH   V   +F P +D ++ S+  D    +WD+       
Sbjct: 116 DQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRH 173

Query: 344 ---------QEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNI 394
                    +++ A+Q   +   G   V  I  GH   +N  + +P +  L+ SA +D  
Sbjct: 174 SAPSNNSFEEQLNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQ 232

Query: 395 VQIWKCSS 402
           V++W+ S+
Sbjct: 233 VKLWRMSA 240

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 110/248 (44%), Gaps = 26/248 (10%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           +L+  E  +    G+AF+ +  + L++    S I LWD     +       FED H   +
Sbjct: 3   MLTKFESKSTRAKGIAFHPSRPWVLVALFS-STIQLWDY----RMGTLLHRFED-HEGPV 56

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT 290
             + +H ++  IF S  +D T+K++   +++ ++ ++    Y    F         +A  
Sbjct: 57  RGLDFHPTQP-IFVSAGDDYTIKVWSLDTNKCLYTLSGHLDYVRTVFFHRELPWIISASD 115

Query: 291 DNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------- 343
           D  + +++ ++    +  +TGH   V   +F P +D ++ S+  D    +WD+       
Sbjct: 116 DQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRH 173

Query: 344 ---------QEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNI 394
                    +++ A+Q   +   G   V  I  GH   +N  + +P +  L+ SA +D  
Sbjct: 174 SAPGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQ 232

Query: 395 VQIWKCSS 402
           V++W+ S+
Sbjct: 233 VKLWRMSA 240

>TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {ON}
           Anc_6.239 YGL137W
          Length = 866

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 98/211 (46%), Gaps = 24/211 (11%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++ GSDD  I +++ +  EK     + FE AH D I  +  H ++ ++  S S+D T+KL
Sbjct: 70  IIVGSDDFKIRVFNYNTGEK----VVDFE-AHPDYIRSIAVHPTKPYVL-SGSDDLTVKL 123

Query: 255 FD-KRSSQIIHNINTKKPY-NTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH 312
           ++ ++S ++    +    +   + F+P   + FA+A  D  V ++ +         +TG 
Sbjct: 124 WNWEKSWELEQQFDGHTHFVMCVTFNPKDPSTFASACLDRTVKVWSLGQQDPNFTLVTGQ 183

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKT 371
           E  V  I++ P  D     + SD  T+ +WD Q      T +              GH +
Sbjct: 184 EKGVNYIDYYPLPDKPYMITASDDLTVKIWDYQTKSCVATLE--------------GHMS 229

Query: 372 SINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +++    +P +  ++ S  ED  V+IW  S+
Sbjct: 230 NVSYAVFHPTLP-IIISGSEDGTVKIWNSST 259

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 115/247 (46%), Gaps = 41/247 (16%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           ++  L+ H ++ Y L +  + +  L+SGS D +I +WD+   + ++  T++ ED     +
Sbjct: 375 IVMVLKGHEQDIYSLDYFPDGQ-KLVSGSGDRSIRIWDLKTGQCSL--TLSIEDG----V 427

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINT--------KKPYNTLAFSPFSS 282
             V    +E  +  + S D +++++D  +  ++  +++        +    ++AF+    
Sbjct: 428 TTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQ 487

Query: 283 NLFAAAGTDNLVYLYDIRDVSNPL----YAMTGHEDAVTAIEFDPNNDGILYSSGSDRRT 338
           ++ + +  D  V L+++ D  +          GH+D V ++    N+D  ++S   DR  
Sbjct: 488 HVVSGS-LDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATS-NDDKYIFSGSKDRGV 545

Query: 339 IVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIA-VNPNIN-----WLVASAEED 392
           I+WD             +D    +LM+  GH+ S+  +A VN N++      L A+   D
Sbjct: 546 IIWD-------------KDSGNPILMLQ-GHRNSVISVATVNSNVDDGKNYKLFATGSGD 591

Query: 393 NIVQIWK 399
              +IWK
Sbjct: 592 CKARIWK 598

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 18/129 (13%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
           ++ FSP      A    D L+ +++I++    +  + GHE  + ++++ P+   ++  SG
Sbjct: 346 SICFSP-DGEFLATGAEDKLIRIWNIKE-RKIVMVLKGHEQDIYSLDYFPDGQKLVSGSG 403

Query: 334 SDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDN 393
            DR   +WDL+  G       IEDG              +  +AV+PN   L+A+   D 
Sbjct: 404 -DRSIRIWDLK-TGQCSLTLSIEDG--------------VTTVAVSPNEGKLIAAGSLDR 447

Query: 394 IVQIWKCSS 402
            V+IW  S+
Sbjct: 448 SVRIWDSST 456

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 74/165 (44%), Gaps = 16/165 (9%)

Query: 237 SSEAHIFGSVSEDSTMKLFDKRSSQIIHNINT-KKPYNTLAFSPFSSNLFAAAGTDNLVY 295
           S +     + +ED  +++++ +  +I+  +   ++   +L + P    L + +G D  + 
Sbjct: 350 SPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSG-DRSIR 408

Query: 296 LYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS-DRRTIVWDLQE-IGAEQTQD 353
           ++D++     L      ED VT +   P N+G L ++GS DR   +WD       E+   
Sbjct: 409 IWDLKTGQCSLTLSI--EDGVTTVAVSP-NEGKLIAAGSLDRSVRIWDSSTGFLVERLDS 465

Query: 354 EIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
           + E G         GH+ S+  +A   +   +V S   D  V++W
Sbjct: 466 DNESG--------NGHQDSVYSVAFTKDGQHVV-SGSLDRTVKLW 501

>Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa]
           {ON} similar to Ashbya gossypii AFR199C
          Length = 318

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 105/239 (43%), Gaps = 24/239 (10%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           L  TLE H      LA +  +   LLS S D  +  W ++  ++     +     H+ II
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKGHSHII 68

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ-IIHNINTKKPYNTLAFSPFSSNLFAAAG 289
            D    +++     S S D T++L+D  S + +I  +  K    +++    ++ + +A+ 
Sbjct: 69  QDCT-VTNDGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSIDAGATQIVSAS- 126

Query: 290 TDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDG----ILYSSGSDRRTIVWDLQE 345
            D  V +++   V   +  + GH D V+ +   P ++      + S+G D+   VWDLQ 
Sbjct: 127 RDKTVKVWNT--VGECVVTLLGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVKVWDLQS 184

Query: 346 IGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNI 404
              E   D I            GH   +N +  +P+ + + ASA +D  + +W  ++ I
Sbjct: 185 FTIE--ADFI------------GHNNYVNTVTPSPDGS-IFASAGKDGQIMLWNLNAKI 228

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 120/304 (39%), Gaps = 57/304 (18%)

Query: 141 YMPQDDNIIATINGE-------GKIFIYDRSKNGVEALLSTLEYHTENG-YGLAFNANEK 192
           Y P  DN +A  +G        GK+ I D   NG   L+ +  + T++G + LA+N + +
Sbjct: 16  YSPFYDNKLAVASGSNFGLVGNGKLIILDIMPNG--QLVESNSFLTQDGLFDLAWNESHE 73

Query: 193 YSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTM 252
              L    D ++ L+DI    K     I     H   +    W+  +  +F S S D  +
Sbjct: 74  NQCLVAQGDGSLRLFDI----KLKDYPIAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKV 129

Query: 253 KLFD---------------------KRSSQII-------------HNINTKKPYNTLAFS 278
           KL+                       R+S +              H    K+      FS
Sbjct: 130 KLWSLMRPQSLMTMSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHADGNKECIYQATFS 189

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSN--PLYAMTGHE--DAVTAIEFDPNNDGILYSSGS 334
           P   NL   +  ++ + LYD+R  +N  P +   GH   +A+T  +F+     I+ + G 
Sbjct: 190 PHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTC-DFNKYRPHIIATGGV 248

Query: 335 DRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNI 394
           D+   VWDL+      +Q        E+     GH+ ++  +  +P+ + ++ S   D  
Sbjct: 249 DKMIKVWDLRMCRKMLSQGHQPININEI----QGHELAVRKVTWSPHHSNMLLSTSYDMT 304

Query: 395 VQIW 398
            ++W
Sbjct: 305 CRVW 308

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 10/84 (11%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYA---------MTGHEDAVTAIEFDPN 324
           T  F+ +  ++ A  G D ++ ++D+R     L           + GHE AV  + + P+
Sbjct: 232 TCDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPH 291

Query: 325 NDGILYSSGSDRRTIVW-DLQEIG 347
           +  +L S+  D    VW DL + G
Sbjct: 292 HSNMLLSTSYDMTCRVWTDLSDDG 315

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 52/132 (39%), Gaps = 18/132 (13%)

Query: 136 ITRARYMPQDDNIIATINGEGKIFIYD-RSKNGVEALLSTLEYHTENGYG------LAFN 188
           I +A + P D N++   +G   I +YD R  N      + L  H   G+G        FN
Sbjct: 183 IYQATFSPHDPNLVLCSSGNSFISLYDLRVPN------NGLPQHQFLGHGGFEALTCDFN 236

Query: 189 ANEKYSLLSGSDDSNIALWDISNFEKNIKP-----TITFEDAHTDIINDVKWHSSEAHIF 243
               + + +G  D  I +WD+    K +        I     H   +  V W    +++ 
Sbjct: 237 KYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNML 296

Query: 244 GSVSEDSTMKLF 255
            S S D T +++
Sbjct: 297 LSTSYDMTCRVW 308

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 96/222 (43%), Gaps = 53/222 (23%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           H   +   ++  + DN++A+    G+IFI+D +K             TE+          
Sbjct: 107 HSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNK------------CTESPSSYT----- 149

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
              L  G   S++                       D +N + W+ S AH+F S    + 
Sbjct: 150 --PLTPGQSMSSV-----------------------DEVNSLAWNQSLAHVFASAGSSNF 184

Query: 252 MKLFD-KRSSQIIH------NINTKKPYNTLAFSPFSSNLFA-AAGTDN--LVYLYDIRD 301
             ++D K   ++IH      N   K+  + + + P +S   A A G+DN   + ++D+R+
Sbjct: 185 ASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRN 244

Query: 302 VSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWD 342
            + PL  ++ GH+  + ++++   ++ +L SSG D   ++W+
Sbjct: 245 ANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 71/162 (43%), Gaps = 20/162 (12%)

Query: 247 SEDSTMKLFD---KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVS 303
           S DS+++L+      S + + ++     +N L +S  ++   A A  +  + LY I D  
Sbjct: 37  STDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWS-HNNKTIAGALDNGTLELYSIGDAH 95

Query: 304 NPLYA---MTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPP 360
           + + +    + H  +V  ++F+   D +L S G++    +WD+         ++  + P 
Sbjct: 96  DTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDM---------NKCTESPS 146

Query: 361 EVLMIHAGHKTS----INDIAVNPNINWLVASAEEDNIVQIW 398
               +  G   S    +N +A N ++  + ASA   N   IW
Sbjct: 147 SYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIW 188

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 80/172 (46%), Gaps = 30/172 (17%)

Query: 195 LLSGSDDSNIALWDIS------NFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSE 248
           ++S   D+ + LW++       N E+   P I   D+HTD I  +   SS      S S 
Sbjct: 423 VISAGKDATVKLWNVDLGIESFNTERYFNPCIYTFDSHTDEITAI---SSYHENLVSGSR 479

Query: 249 DSTMKLFDKRSSQIIHNINT----------------KKPYNTLAFSPFSSNLFAAAGTDN 292
           D T++ +D ++ + I  +N                 + P    A     + L A  G D 
Sbjct: 480 DKTIRQWDLKTGKCIQILNIGFLNSQKELLGTVDPIRSPPPIGALQCRDAAL-ATGGQDG 538

Query: 293 LVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
           +V L+D+R +   + +++GHE+A+TA++FD   D  + +   D+  I WDL+
Sbjct: 539 IVRLWDLR-IGKVVRSLSGHENAITALKFD---DLHVVTGSLDKTAITWDLR 586

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 21/95 (22%)

Query: 307 YAMTGHEDAVTAIEFD-PNNDGILYSSGSDRRTI-VWDLQEIGAEQTQ-DEIEDGPPEVL 363
           Y    HED +T ++FD PN  G L ++G    TI +WDL     + TQ  E++       
Sbjct: 359 YVQKAHEDNITTLDFDFPN--GTLSTAGHLDHTIKLWDL----TKSTQIGELK------- 405

Query: 364 MIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
               GHK ++N + ++   N +V SA +D  V++W
Sbjct: 406 ----GHKATVNSLQMDLTYN-MVISAGKDATVKLW 435

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 98/254 (38%), Gaps = 59/254 (23%)

Query: 186 AFNANEKYSLLSGSDD--SNIALWDI-SNFEKNIKPTITF-------------EDAHTDI 229
            F+ +  Y L S SDD  SN++L    S   K IK  + F             + AH D 
Sbjct: 308 TFSDDSSYRLESTSDDLLSNMSLDRFYSGPHKKIKRYLGFAFEDSFNNQTGYVQKAHEDN 367

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKLFD-KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAA 288
           I  + +      +  +   D T+KL+D  +S+QI      K   N+L     + N+  +A
Sbjct: 368 ITTLDFDFPNGTLSTAGHLDHTIKLWDLTKSTQIGELKGHKATVNSLQM-DLTYNMVISA 426

Query: 289 GTDNLVYLYDI----------RDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRT 338
           G D  V L+++          R  +  +Y    H D +TAI     N   L S   D+  
Sbjct: 427 GKDATVKLWNVDLGIESFNTERYFNPCIYTFDSHTDEITAISSYHEN---LVSGSRDKTI 483

Query: 339 IVWDLQ--------EIGAEQTQDEIED------GPPEVLMIHAGHKTSINDIAVNPNINW 384
             WDL+         IG   +Q E+         PP +  +         D A       
Sbjct: 484 RQWDLKTGKCIQILNIGFLNSQKELLGTVDPIRSPPPIGALQC------RDAA------- 530

Query: 385 LVASAEEDNIVQIW 398
            +A+  +D IV++W
Sbjct: 531 -LATGGQDGIVRLW 543

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 77/163 (47%), Gaps = 9/163 (5%)

Query: 177 YHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWH 236
           ++ E+ +    +  E  S ++G   + I LWDI     N +  ++      D I  VK++
Sbjct: 172 FYGEHAFQGIDHHKENTSFVTGG--AQIELWDI-----NRRKPLSNLSWGIDNITAVKFN 224

Query: 237 SSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYL 296
            +EA +  S   D+++ L+D R++     I      N++ ++P     F  A  D   Y 
Sbjct: 225 QNEADLLLSSGSDNSVVLYDLRTNSPTQKIVQTMKTNSMCWNPMEPFNFVTANEDQNAYY 284

Query: 297 YDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
           YD+R++S  L+    H  A+  ++  P  + I+  +GS  +TI
Sbjct: 285 YDMRNMSRALHVFKDHVSAIMDVDISPTGEEIV--TGSYDKTI 325

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 85/190 (44%), Gaps = 32/190 (16%)

Query: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVK--- 234
           H +  Y +A N N    L S S D  +  W+IS  E+      +F+ AH  ++  +    
Sbjct: 66  HRDGCYVIAKNYNVLNRLASASADGVVKYWNISTREE----LCSFK-AHYGLVTGLCVSP 120

Query: 235 ---WHSSEAHIFGSVSEDSTMKLFD---------KRSSQIIH----NINTKKPYNTLAFS 278
               + S++++  S  +D  +K++          K  ++++H    N   K  Y   AF 
Sbjct: 121 QHIGNQSDSYML-SCGDDKMVKMWSVDSGDFNNVKDDTKVLHPSDGNGLIKTFYGEHAFQ 179

Query: 279 PFSSNL----FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS 334
               +     F   G    + L+DI +   PL  ++   D +TA++F+ N   +L SSGS
Sbjct: 180 GIDHHKENTSFVTGGAQ--IELWDI-NRRKPLSNLSWGIDNITAVKFNQNEADLLLSSGS 236

Query: 335 DRRTIVWDLQ 344
           D   +++DL+
Sbjct: 237 DNSVVLYDLR 246

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 5/47 (10%)

Query: 177 YHT---ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPT 219
           YHT   ++ + + F  + KY ++SGSDD N+ LW  + +E+ N+K T
Sbjct: 339 YHTKRMQHVFQVKFTMDSKY-IVSGSDDGNVRLWRSNAYERSNVKST 384

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 7/94 (7%)

Query: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN 231
           LS L +  +N   + FN NE   LLS   D+++ L+D+    +   PT       T   N
Sbjct: 208 LSNLSWGIDNITAVKFNQNEADLLLSSGSDNSVVLYDL----RTNSPTQKI--VQTMKTN 261

Query: 232 DVKWHSSEAHIFGSVSEDSTMKLFDKRS-SQIIH 264
            + W+  E   F + +ED     +D R+ S+ +H
Sbjct: 262 SMCWNPMEPFNFVTANEDQNAYYYDMRNMSRALH 295

>YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}
           UTP15Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 513

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 97/211 (45%), Gaps = 14/211 (6%)

Query: 125 KIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYG 184
           +++K F    ++  +     D  ++   +  G + +YD S N    LLS +   T   + 
Sbjct: 72  QVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYD-SYNPRTILLS-INASTHPTHV 129

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
             F+  +   L + SDD    LWDISN     +P +    A TD +  + +  +  H+  
Sbjct: 130 TKFHTQDNKILATASDDRVTRLWDISN---AYEPQLELTGA-TDYVRTLSFIPAAPHLVA 185

Query: 245 SVSEDSTMKLFDKRS--SQIIHNINTKKPY-NTLAFSPFSSNLFAAAGTDNLVYLYDIRD 301
           + S D  ++L+D RS  S  I+++N  +P  N +A SP  + + +  G  N   ++D+  
Sbjct: 186 TGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSP--TQIVSCGG--NNFKVWDLTS 241

Query: 302 VSNPLYAMTGHEDAVTAIEFDPNNDGILYSS 332
            +  LY       AVT +++  N D  + S+
Sbjct: 242 -NKKLYERGNFNKAVTCLDYVENFDSPMQSA 271

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 77/181 (42%), Gaps = 25/181 (13%)

Query: 233 VKWHSSEAHI-FG-------SVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSN- 283
           VK H+S  HI F        +V+  + +++F  R+ Q+I   +  K  + +  + F S+ 
Sbjct: 36  VKEHNSVTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFK--DVVYSASFRSDG 93

Query: 284 -LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWD 342
            L  A     LV +YD  +    L ++          +F   ++ IL ++  DR T +WD
Sbjct: 94  KLLCAGDATGLVSVYDSYNPRTILLSINASTHPTHVTKFHTQDNKILATASDDRVTRLWD 153

Query: 343 LQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +    A + Q E+            G    +  ++  P    LVA+   D +++++   S
Sbjct: 154 IS--NAYEPQLEL-----------TGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRS 200

Query: 403 N 403
           +
Sbjct: 201 S 201

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 58/143 (40%), Gaps = 17/143 (11%)

Query: 262 IIHNIN-TKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIE 320
           I+ +IN +  P +   F    + + A A  D +  L+DI +   P   +TG  D V  + 
Sbjct: 116 ILLSINASTHPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLS 175

Query: 321 FDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNP 380
           F P    ++ +   D    ++D +  G+        D P E            N IAV+P
Sbjct: 176 FIPAAPHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVE------------NVIAVSP 223

Query: 381 NINWLVASAEEDNIVQIWKCSSN 403
                + S   +N  ++W  +SN
Sbjct: 224 T---QIVSCGGNNF-KVWDLTSN 242

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 88/211 (41%), Gaps = 28/211 (13%)

Query: 197 SGSDDSNIALWDISNFEKNIK-PTITFED-------AHTDIINDVKWHSSEAHIFGSVSE 248
           +G  DS I LW +     + K P+   E         H+  +    +     ++  S SE
Sbjct: 438 AGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLL-SASE 496

Query: 249 DSTMKLFDKRS-SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLY 307
           D T++L+   + S ++       P   ++FSP   + FA A  D    L+    +  PL 
Sbjct: 497 DKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLG-HYFATASHDQTARLWSCDHIY-PLR 554

Query: 308 AMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHA 367
              GH + V  + F PN    +++  +D+   +WD+              G  + + +  
Sbjct: 555 IFAGHLNDVDCVSFHPNGT-YVFTGSTDKTCRMWDI--------------GTGDSVRLFL 599

Query: 368 GHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
           GH   +   AV+P+  WL ++  ED I+ +W
Sbjct: 600 GHTAPVISTAVSPDGRWL-STGSEDGIINVW 629

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 86/217 (39%), Gaps = 46/217 (21%)

Query: 173 STLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK------------------ 214
           +TL  H+   Y  +F+ + KY LLS S+D  + LW +  +                    
Sbjct: 470 TTLIGHSGTVYSTSFSPDNKY-LLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSP 528

Query: 215 --------------------NIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
                               +I P   F   H + ++ V +H +  ++F + S D T ++
Sbjct: 529 LGHYFATASHDQTARLWSCDHIYPLRIFA-GHLNDVDCVSFHPNGTYVF-TGSTDKTCRM 586

Query: 255 FDKRSSQIIH-NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH- 312
           +D  +   +   +    P  + A SP      +    D ++ ++DI      L  M GH 
Sbjct: 587 WDIGTGDSVRLFLGHTAPVISTAVSP-DGRWLSTGSEDGIINVWDI-GTGKRLKQMRGHG 644

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAE 349
           ++AV ++ +      +L S G+D    VWDL+   AE
Sbjct: 645 KNAVYSLSYS-KEGTVLVSGGADHSVRVWDLKRSTAE 680

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 116/267 (43%), Gaps = 43/267 (16%)

Query: 148 IIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALW 207
           ++ T  GE ++F    S      LLST E HT   + L   +N K  L++GS D +   W
Sbjct: 438 VVGTRQGELQLFDLASS-----TLLSTTEAHTAAIWSLDLTSNGK-RLVTGSADKSCKFW 491

Query: 208 DISNFEKNIKPT-------------ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           D    E+ +  T              T E   TD I  VK  S + ++  S+  D+T+K+
Sbjct: 492 DFEVVEQLVPGTKDKYIPQLKLVHDTTLE--LTDDILAVKISSEDRYLAVSLL-DNTVKV 548

Query: 255 FDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNL-VYLYDIRDVSNPLYAMTGH 312
           F   S +   ++   K P  ++ FS  S  L  ++   N+ ++  D  D    ++A   H
Sbjct: 549 FFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFA---H 605

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTS 372
           +D++ ++ F+ +     +S G D     WD  +    Q  +              GH++ 
Sbjct: 606 QDSIMSVRFEADTHN-FFSCGKDGAVKRWDGDKFDCIQKLN--------------GHQSE 650

Query: 373 INDIAVNPNINWLVASAEEDNIVQIWK 399
           +  IAV+P+    V S   D+ +++W+
Sbjct: 651 VWCIAVSPD-GRTVVSTSHDHSIRVWQ 676

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 22/136 (16%)

Query: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324
           NI+       + F    + L      D ++ ++D+   S  L    GH+  VT +  D  
Sbjct: 69  NISKPSVVTAMCFHK-ETELLCVGYEDGVIKVWDLLSKS-VLMQFNGHKSGVTVLRLD-- 124

Query: 325 NDGILYSSGS-DRRTIVWDL-QEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNI 382
           ++G    SGS D   I+WDL  E+G               LM    HK +I  I ++ N+
Sbjct: 125 SEGTRLVSGSKDSDLIIWDLVGEVG---------------LMKLRSHKDAITGIWIDHNM 169

Query: 383 NWLVASAEEDNIVQIW 398
           +WL++ A +D ++++W
Sbjct: 170 DWLISVA-KDGLIKVW 184

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 96/247 (38%), Gaps = 67/247 (27%)

Query: 157 KIFIYDRSKNGVEALLS-TLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKN 215
           +I I DRS   ++  LS TL  H+   Y  +F+ + +Y L+SGS+D  + LW +      
Sbjct: 502 RITITDRSLTHMDNELSATLIGHSGTVYSTSFSPDNRY-LISGSEDKTVRLWSL------ 554

Query: 216 IKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTL 275
                   D HT ++      S + H                             P   +
Sbjct: 555 --------DTHTALV------SYKGH---------------------------NHPIWDV 573

Query: 276 AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSD 335
            FSP   + FA A  D    L+    +  PL    GH + V  + F PN    +++  SD
Sbjct: 574 QFSPLG-HYFATASHDQTARLWSCDHIF-PLRIFAGHLNDVDCVSFHPNG-YYVFTGSSD 630

Query: 336 RRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIV 395
           +   +WD+       T D +         +  GH +++   AV+P+  WL  +  +D  +
Sbjct: 631 KTCRMWDIS------TGDSVR--------LFLGHTSAVVSTAVSPDGRWLT-TGSDDGTI 675

Query: 396 QIWKCSS 402
            +W   S
Sbjct: 676 NVWDIGS 682

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 102/230 (44%), Gaps = 21/230 (9%)

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
           + F+ + K+ L +G++D  I +WDI    +  K  +  +    D+ +   + S +  + G
Sbjct: 389 VCFSPDGKF-LATGAEDKLIRIWDI----QQRKIVMVLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 245 SVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIR---- 300
           S   D T++++D ++ Q    ++ +    T+A SP      AA   D  V ++D      
Sbjct: 444 S--GDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFL 501

Query: 301 ----DVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS-DRRTIVWDLQEIGAEQTQDEI 355
               D  N L   TGH+D+V ++ F    DG    SGS DR   +W+L++  A  + +  
Sbjct: 502 VERLDSENEL--GTGHKDSVYSVVF--TKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNS 557

Query: 356 EDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
                   + + GHK  +  +    N  +++ S  +D  V  W   S  P
Sbjct: 558 NKSNATCDVTYVGHKDFVLSVTTTANDEYIL-SGSKDRGVLFWDTKSGNP 606

>Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {ON}
           complement(40550..41851) [1302 nt, 434 aa]
          Length = 433

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 95/199 (47%), Gaps = 25/199 (12%)

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           +GS D+ + +WD+     ++K T++    H   + D+       ++F S SED  +K +D
Sbjct: 139 TGSTDTTVKVWDL--VSGHLKLTLS---GHVMPVRDITVSDRHPYLF-SASEDKLVKCWD 192

Query: 257 KRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDA 315
              +  I + +       ++A  P + +L A AG D++V L+DIR     +  + GH+  
Sbjct: 193 LEKNMAIRDYHGHLSGVYSVAIHP-TLDLIATAGRDSVVRLWDIRS-RMEVMTLIGHKGP 250

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSIND 375
           +  +   P +  I+ S  +D    +WD            I  G    ++ H  HK S+ D
Sbjct: 251 INKVRSLPVDPQII-SCSTDATVHLWD------------IVAGKSAKVLTH--HKRSVRD 295

Query: 376 IAVNPNINWLVASAEEDNI 394
           IA+NP+  + +ASA  D+I
Sbjct: 296 IALNPS-EFSLASACTDDI 313

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 19/133 (14%)

Query: 273 NTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPL-YAMTGHEDAVTAIEFDPNNDGILYS 331
           N +A  P  +  FA   TD  V ++D+  VS  L   ++GH   V  I     +   L+S
Sbjct: 125 NCVASEPVENTWFATGSTDTTVKVWDL--VSGHLKLTLSGHVMPVRDITVSDRHP-YLFS 181

Query: 332 SGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEE 391
           +  D+    WDL++  A      I D        + GH + +  +A++P ++ L+A+A  
Sbjct: 182 ASEDKLVKCWDLEKNMA------IRD--------YHGHLSGVYSVAIHPTLD-LIATAGR 226

Query: 392 DNIVQIWKCSSNI 404
           D++V++W   S +
Sbjct: 227 DSVVRLWDIRSRM 239

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 88/235 (37%), Gaps = 66/235 (28%)

Query: 164 SKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFE 223
           SK G      TL  H+   Y  +F+ + +Y LLS S+D  + LW                
Sbjct: 467 SKQGERTNNETLVGHSGTVYSTSFSPDNRY-LLSASEDKTVRLWST-------------- 511

Query: 224 DAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSN 283
           D +T ++N  K H+                                 P   +AFSP   +
Sbjct: 512 DTYTSLVN-YKGHN--------------------------------HPIWDVAFSPLG-H 537

Query: 284 LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
            FA A  D    L+   D   PL    GH + V  + F PN    +++  SD+   +WD 
Sbjct: 538 YFATASHDQTARLWSC-DHIYPLRIFAGHLNDVDTVSFHPNGT-YVFTGSSDKTCRMWD- 594

Query: 344 QEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
                      I  G  + + +  GH   +   AV+P+  WL ++  ED ++ +W
Sbjct: 595 -----------ITSG--DSVRLFLGHTAPVTSTAVSPDGRWL-STGSEDGVINVW 635

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 74/167 (44%), Gaps = 31/167 (18%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENG-YGLAFNAN 190
           H   +T     P D   ++T + +G I ++D    G    L  +  H +N  Y L++ + 
Sbjct: 607 HTAPVTSTAVSP-DGRWLSTGSEDGVINVWDI---GTGKRLKQMRGHGKNAVYSLSY-SK 661

Query: 191 EKYSLLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSE 248
           E + L+SG  D ++ +WD+  S  E   +P   F     D+ +             SV++
Sbjct: 662 EGHVLISGGADHSVRVWDVKKSTAEPGSEPEQPFTGYSGDVTS-------------SVNQ 708

Query: 249 DSTMKLFDKR-----SSQIIHNINTKK-PYNTLAFSPFSSNLFAAAG 289
           D  +K + +R     SS +I +  TKK P   + F+   SNL  A G
Sbjct: 709 D--IKEYGRRRTIVPSSDLIASFYTKKTPVFKVKFT--RSNLVLAGG 751

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 67/126 (53%), Gaps = 8/126 (6%)

Query: 225 AHTDIINDVKWHSSE---AHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFS 281
           AH+  I+++K  ++E   + +F S S+DS +K+FD R+S  +  ++  K    L+     
Sbjct: 53  AHSASISNLKVLNNEFTNSDLFASASKDS-VKIFDVRTSSCVATLHNDKSAPFLSLDSRH 111

Query: 282 SNLFAA---AGTDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRR 337
             L      +G D  +++YDI+ +S PL +    H D +T  +F P + G+L S  +D  
Sbjct: 112 DMLACGTELSGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGY 171

Query: 338 TIVWDL 343
             ++DL
Sbjct: 172 VNIYDL 177

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 196 LSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLF 255
           LSG D + + ++DI   +K  KP  +F D+H D I D K+H  +  +  S S D  + ++
Sbjct: 120 LSGVD-AELHIYDI---KKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIY 175

Query: 256 DKRSS 260
           D  +S
Sbjct: 176 DLTNS 180

>TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7.310
           YDL195W
          Length = 1265

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/249 (20%), Positives = 105/249 (42%), Gaps = 55/249 (22%)

Query: 125 KIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYG 184
           +++K   H G I    + P+ DN++ +  GEG I     S N  + L +           
Sbjct: 102 ELIKNNRHTGPIRSITFNPRQDNLLLS-GGEGII----NSSNSAKTLPTINNIQNTTSEI 156

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEK-NIKPTITFEDAHTDIINDVKWHSSEAHIF 243
             ++ N                 D+ N E   + P +T     T  I+ + W+ S +H+F
Sbjct: 157 FIYDLN-----------------DVDNPETLPMSPNMTMNRFET--ISSLAWNKSLSHVF 197

Query: 244 GSVSEDSTMKLFDKRSSQIIHNINTKKP-------YNTLAFSPFSSNLFAAAGTDNL--- 293
            +    S + +FD ++ + + N+N   P       ++ + + P +S   A A ++N+   
Sbjct: 198 SAAGNTSAVSIFDLKAKKEVINLNYINPTTGMKEIFSVVEWHPKNSTRIATATSNNISNP 257

Query: 294 ----------VYLYDIRDVSNPLYAMT----------GHEDAVTAIEFDPNNDGILYSSG 333
                     +Y++D+R+ + PL  ++          GH D + ++++   ++  L SSG
Sbjct: 258 LNATANAGDSIYIWDLRNSNAPLQILSPQQFENNTIVGHTDGIQSLDWCAQDETFLLSSG 317

Query: 334 SDRRTIVWD 342
            D   ++W+
Sbjct: 318 RDNSIMLWN 326

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 86/227 (37%), Gaps = 66/227 (29%)

Query: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN 231
             TL  H+   Y  +F+ + KY LLSGS+D  + LW +     +    +     H   + 
Sbjct: 522 CKTLVGHSGTVYSTSFSPDNKY-LLSGSEDKTVRLWSM-----DTHTALVSYKGHNHPVW 575

Query: 232 DVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTD 291
           DV + S   H F + S D T +L+                                    
Sbjct: 576 DVNF-SPLGHYFATASHDQTARLW------------------------------------ 598

Query: 292 NLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQT 351
           +  ++Y       PL    GH + V  + F PN    +++  SD+   +WD+       T
Sbjct: 599 SCDHIY-------PLRIFAGHLNDVDCVSFHPNG-CYVFTGSSDKTCRMWDV------ST 644

Query: 352 QDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            D +         +  GH   +  IAV+P+  WL ++  ED I+ IW
Sbjct: 645 GDSVR--------LFLGHTAPVICIAVSPDGRWL-STGSEDGIINIW 682

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 18/104 (17%)

Query: 298 DIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIE 356
           + RD       + GH   V +  F P+N  +L  SGS+ +T+ +W +    A        
Sbjct: 514 NYRDDDPTCKTLVGHSGTVYSTSFSPDNKYLL--SGSEDKTVRLWSMDTHTA-------- 563

Query: 357 DGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKC 400
                 L+ + GH   + D+  +P +    A+A  D   ++W C
Sbjct: 564 ------LVSYKGHNHPVWDVNFSP-LGHYFATASHDQTARLWSC 600

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 74/164 (45%), Gaps = 19/164 (11%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           L+S S D+   +WD+ +    +K  +    AH   + DV++ S   H+F S   D ++++
Sbjct: 262 LVSSSIDTTCIVWDLQS-PNYVKTQLI---AHDSEVYDVRFLSQSTHLFASCGGDGSVRV 317

Query: 255 FDKRS---SQIIH---------NINTKKPYNTLAFSP--FSSNLFAAAGTDNL-VYLYDI 299
           FD RS   S I++         N  T +    L   P     N+ A    D+  + + D+
Sbjct: 318 FDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILILDM 377

Query: 300 RDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
           R+  +P   + GH   V  I++ P    +L S   D + + WDL
Sbjct: 378 RNPESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 65/141 (46%), Gaps = 25/141 (17%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL-STLEYHTENGYGLAFNAN 190
           HD E+   R++ Q  ++ A+  G+G + ++D     + +L  ST+ Y    G G   +  
Sbjct: 289 HDSEVYDVRFLSQSTHLFASCGGDGSVRVFD-----LRSLAHSTIVYEPPAGEGTVNDVT 343

Query: 191 EKYSLLSG---------------SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKW 235
            + + L                 +D  +I + D+ N E    P +T +  H+ ++N +KW
Sbjct: 344 AQNNALLRLEPSLMDPNIIATLVADSKDILILDMRNPE---SPALTLK-GHSSLVNQIKW 399

Query: 236 HSSEAHIFGSVSEDSTMKLFD 256
           H ++ ++  S S+D  +  +D
Sbjct: 400 HPTKRNVLLSCSDDCQVLYWD 420

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 87/223 (39%), Gaps = 38/223 (17%)

Query: 154 GEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNAN-----EKYSL--LSGSDDSNIAL 206
           G+G  ++   +  G    +S  E    NG GL  N       E++ L  L  S+D  + +
Sbjct: 77  GKGGSYVTTGNPQGGN-FMSGQELMNSNGTGLGPNTRTCSYQEQFPLFGLDWSNDDFVCM 135

Query: 207 WDISNFEKNIKPTITFED-------AHTDI---INDVKWHSSEAHI--FGSVSEDSTMKL 254
                  +N    I   D       A  D+   I+ V+W  S  H   F + S+   +  
Sbjct: 136 SSYKEDSRNKIQVIQSPDLLSWNNVAQADVVYPISKVQWLPSHLHPRQFATASDSLRIWS 195

Query: 255 FDKRSSQIIHNINT-----KKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAM 309
            ++ ++ +   IN      KK  N  A +    NL AA G            + N   A+
Sbjct: 196 LNEDTNSLQEQINLSLCKYKKQRNNTAGNKV--NLAAAGGC-----------LKNTTTAI 242

Query: 310 TGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQ 352
            G    VT+ +++  +  +L SS  D   IVWDLQ     +TQ
Sbjct: 243 LGELPPVTSFDWNTVDTNLLVSSSIDTTCIVWDLQSPNYVKTQ 285

>KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672)
           [2658 bp, 885 aa] {ON} Anc_6.239 YGL137W
          Length = 885

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 99/217 (45%), Gaps = 36/217 (16%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++ GSDD  I +++ +  EK     + FE AH D I  +  H ++ ++  S S+D T+KL
Sbjct: 70  IIVGSDDFRIRVFNYNTGEK----VVDFE-AHPDYIRSIAVHPTKPYVL-SGSDDLTIKL 123

Query: 255 FDKRSSQIIHNINTKKPYN-------TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLY 307
           ++        N N ++ +         +AF+P   N FA+   D  V ++ +   S P +
Sbjct: 124 WNWEK-----NWNLEQTFEGHEHFVMCVAFNPKDPNTFASGCLDRTVKVWSLGQ-STPNF 177

Query: 308 AM-TGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMI 365
            M TG E  V  +++ P  D     + SD  T+ +WD Q      T +            
Sbjct: 178 TMNTGQERGVNYVDYYPLPDKPYLVTSSDDLTVKIWDYQTKSCVATLE------------ 225

Query: 366 HAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
             GH ++++    +P +  ++ S  ED  ++IW  S+
Sbjct: 226 --GHMSNVSFAVFHPTLP-IIISGSEDGTLKIWNSST 259

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 108/256 (42%), Gaps = 53/256 (20%)

Query: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN 231
            STL  H+   Y  +F+ +  Y L+SGS+D  + LW +              D HT ++N
Sbjct: 526 CSTLVGHSGTVYSTSFSPDNMY-LVSGSEDKTVKLWSM--------------DTHTALVN 570

Query: 232 ---------DVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPY----NTLAFS 278
                    DVK+ S   H F S S D T +L+   +   I+ +     +    +T++F 
Sbjct: 571 YKGHNHPVWDVKF-SPLGHYFASASHDQTARLW---ACDHIYPLRIFAGHTNDVDTVSFH 626

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRT 338
           P    +F  + +D    ++D+    + +    GH   V + +  P  DG   ++GS+   
Sbjct: 627 PNGCYVFTGS-SDKTCRMWDV-STGDSVRLFLGHTAPVLSTQVSP--DGRWLATGSEDGV 682

Query: 339 I-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGH-KTSINDIAVNPNINWLVASAEEDNIVQ 396
           I +WD+              G  + +    GH K +++ ++ N   N L+ S   D+ V+
Sbjct: 683 ICLWDI--------------GTGKRIKQMRGHGKNAVHSLSFNKEGNVLI-SGGADHSVR 727

Query: 397 IWKCSSNIPRIGGEPE 412
           +W         G EPE
Sbjct: 728 VWDVKHGTTEQGPEPE 743

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 100/254 (39%), Gaps = 29/254 (11%)

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204
           D   +A+ + +G I I+D S+      L TL  HT +   + +       L +GS D  I
Sbjct: 247 DKPRLASASKDGTIKIWDASR---RTCLYTLSGHTNSVSCVKWGGQGL--LYTGSHDKTI 301

Query: 205 ALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIH 264
            +WDI    K     I    +H   +N +   +  A   G    D         S Q   
Sbjct: 302 RVWDIKAGGK----CINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKAS----PSPQEAR 353

Query: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324
           +I  K     +  S     L   A  D  ++L++    + PL  MTGH+  V  + F P+
Sbjct: 354 DIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSPD 413

Query: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINW 384
              I+ S+  D    +WD +            DG  + +    GH  S+  +A + +   
Sbjct: 414 GRYIV-SASFDNSIKLWDGR------------DG--KFIATFRGHVASVYQVAWSSDCR- 457

Query: 385 LVASAEEDNIVQIW 398
           L+ S  +D  +++W
Sbjct: 458 LLVSCSKDTTLKVW 471

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/110 (20%), Positives = 46/110 (41%), Gaps = 15/110 (13%)

Query: 296 LYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355
           ++ +R ++    A+ GH   +    F P+    + +   D    +WD     A QT    
Sbjct: 126 VFKVRPITRSSAAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDC----ATQTP--- 178

Query: 356 EDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
                  L +  GH   +  +A +P+   L+A+   DN +++W+  +  P
Sbjct: 179 -------LSVLKGHSNWVLCVAWSPDGE-LIATGSMDNTIRLWESKAGKP 220

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 30/173 (17%)

Query: 195 LLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTM 252
           L+S S D+   +WD+  SN+ K      T   AH   + DV++ +    +F S   D ++
Sbjct: 251 LISSSIDTTCIVWDLQSSNYVK------TQLIAHDSEVFDVRFLTQSTQLFASCGGDGSV 304

Query: 253 KLFDKRS---SQIIHNINTKKPYN------------------TLAFSPFSSNLFAA-AGT 290
           ++FD R    S II+     +P                     L  SP   N+ A  A  
Sbjct: 305 RVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIA 364

Query: 291 DNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343
            N + + D+R+  +PL  + GH  ++  I++ P     L S   D + + WD+
Sbjct: 365 SNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDI 417

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 66/149 (44%), Gaps = 14/149 (9%)

Query: 122 SNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALL---STLEYH 178
           SN    +   HD E+   R++ Q   + A+  G+G + ++D        ++      E  
Sbjct: 268 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPG 327

Query: 179 TENGYGLAFNANE-KYSLL----SGSDDSNIALWDISNFE------KNIKPTITFEDAHT 227
           T N    + + +E  ++LL    S  D + +A + I++ E      +N    +   + H+
Sbjct: 328 TGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNGHS 387

Query: 228 DIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
             IN +KWH ++ +   S S+D  +  +D
Sbjct: 388 ASINQIKWHPTKKNTLISCSDDCQVLFWD 416

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 110/280 (39%), Gaps = 32/280 (11%)

Query: 136 ITRARYMPQ--DDNIIATINGEGKIFIYDRSKNGVEALL--STLEYHTENGYGLAFNANE 191
           ++  ++MP       IAT +   +I+  +  +N +E  L  S  ++H ++    AF    
Sbjct: 159 VSNIQWMPSAFRSRKIATASDSLRIWSLNTEENKLEEQLNLSLCKFHKQHPNNKAF---- 214

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
                       + L  I     ++ P++  E      I    W+  + +I  S S D+T
Sbjct: 215 ------------VGLSQIPTKTSDVNPSVLGE---FPPITSFHWNPVDTNILISSSIDTT 259

Query: 252 MKLFDKRSSQIIHN--INTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNP--LY 307
             ++D +SS  +    I        + F   S+ LFA+ G D  V ++D+R +++   +Y
Sbjct: 260 CIVWDLQSSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIY 319

Query: 308 AMTGHE-----DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEV 362
                E     ++  +   D N+  +L    S     V     I + +        P   
Sbjct: 320 EPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSP 379

Query: 363 LMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           L++  GH  SIN I  +P     + S  +D  V  W  SS
Sbjct: 380 LVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDISS 419

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 3/78 (3%)

Query: 136 ITRARYMPQDDNIIATIN-GEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYS 194
           + R    P D N++AT      +I I D      ++ L  L  H+ +   + ++  +K +
Sbjct: 345 LLRLEPSPHDPNVLATFAIASNEILILDM--RNPDSPLVVLNGHSASINQIKWHPTKKNT 402

Query: 195 LLSGSDDSNIALWDISNF 212
           L+S SDD  +  WDIS++
Sbjct: 403 LISCSDDCQVLFWDISSY 420

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 123/286 (43%), Gaps = 51/286 (17%)

Query: 138 RARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGL-AFNANEKYSLL 196
           R+     D   +AT   +  I I+D ++   + ++  L+ H ++ Y L  F + +K  L+
Sbjct: 466 RSVCFSPDGKFLATGAEDRLIRIWDIAQ---KKIVMVLQGHEQDIYSLDYFPSGDK--LV 520

Query: 197 SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           SGS D  + +WD+ N + ++  T++ ED     +  V     +     + S D  ++++D
Sbjct: 521 SGSGDRTVRIWDLRNGQCSL--TLSIEDG----VTTVAVSPGDGKYIAAGSLDRAVRVWD 574

Query: 257 KRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT-------DNLVYLYDIRDVSNP---- 305
             +  ++  ++++    T       S +F   G        D  V L+++R  +N     
Sbjct: 575 SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKP 634

Query: 306 ------LYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGP 359
                     TGH+D V ++    N++ IL S   DR  + WD             + G 
Sbjct: 635 NVPGTCEVTYTGHKDFVLSVATTQNDEYIL-SGSKDRGVLFWD------------TKSGN 681

Query: 360 PEVLMIHAGHKTSINDIAV------NPNINWLVASAEEDNIVQIWK 399
           P  L++  GH+ S+  +AV       PN+  + A+   D   +IWK
Sbjct: 682 P--LLMLQGHRNSVISVAVANGFPLGPNVG-VFATGSGDCKARIWK 724

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 100/246 (40%), Gaps = 35/246 (14%)

Query: 173 STLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIND 232
           S L  H+   Y  +F+ + K+ LLSGS+D  + LW +     +   T+     H   + D
Sbjct: 535 SLLIGHSGAVYSTSFSPDNKF-LLSGSEDKTVRLWSM-----DTHTTLVSYKGHNHPVWD 588

Query: 233 VKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPY----NTLAFSPFSSNLFAAA 288
           VK+ S   H F + S D T +L+   S   I+ +     +     T++F P    +F  +
Sbjct: 589 VKF-SPMGHYFATASHDQTARLW---SCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGS 644

Query: 289 GTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGI-LYSSGSDRRTIVWDLQEIG 347
             D    ++DI    + +    GH   V      P  DG  L + G D    VWD+    
Sbjct: 645 A-DKTCRMWDI-STGDSVRLFLGHTAPVLTTAVTP--DGRWLCTGGEDGVINVWDI---- 696

Query: 348 AEQTQDEIEDGPPEVLMIHAGH-KTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPR 406
                     G  + L    GH K +I+  + N   N L+ S   D+ V++W      P 
Sbjct: 697 ----------GTGKRLKQMRGHGKNAIHSFSFNKEGNILI-SGGADHSVRVWDLKKATPE 745

Query: 407 IGGEPE 412
              EPE
Sbjct: 746 PSAEPE 751

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 102/257 (39%), Gaps = 31/257 (12%)

Query: 143 PQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202
           P D   +AT + +G I I+D ++      L TL  HT +   + +    K  L SGS D 
Sbjct: 245 PGDKPRLATASKDGTIKIWDTTR---RVCLLTLCGHTSSVSCVKWGG--KNVLYSGSHDK 299

Query: 203 NIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQI 262
            I  WD++   K     I    +H   +N +   +  A   G+           + + Q 
Sbjct: 300 TIRCWDMNLNGK----CINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQ- 354

Query: 263 IHNINTKKPYNTLAFSPFS-SNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF 321
                  K Y  +A        L   A  D  +YL++    + P+  MTGH+  V  + F
Sbjct: 355 ----KALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAF 410

Query: 322 DPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPN 381
            P+   I+ S+  D    +WD +            DG  + L    GH  S+  +A + +
Sbjct: 411 SPDGRYIV-SASFDNSIKLWDGR------------DG--KFLSTFRGHVASVYQVAWSSD 455

Query: 382 INWLVASAEEDNIVQIW 398
              L+ S  +D  +++W
Sbjct: 456 CR-LLVSCSKDTTLKVW 471

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 47/117 (40%), Gaps = 19/117 (16%)

Query: 293 LVY----LYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGA 348
           LVY    ++ ++ V+    A+ GH   +    F PN    + +   D    +WD      
Sbjct: 119 LVYTPRAIFKVKPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCD---- 174

Query: 349 EQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
            QT+          +    GH   +   + +P+   L+A+   DN +++W+ S   P
Sbjct: 175 TQTR----------MCTLQGHHNWVLCCSWSPDGE-LIATGSMDNTIRLWESSKGKP 220

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/248 (20%), Positives = 108/248 (43%), Gaps = 26/248 (10%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           +L+  E  +    G+AF+ +  + L++    S I LWD     +       FED H   +
Sbjct: 3   MLTKFESKSTRAKGIAFHPSRPWVLVALFS-STIQLWDY----RMGTLLHRFED-HEGPV 56

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT 290
             + +H ++  +F S  +D T+K++   + + +  +N    Y    F         +   
Sbjct: 57  RGIDFHPTQP-LFVSAGDDYTIKVWSLETKKCLFTLNGHLDYVRTVFFHHELPWIISCSD 115

Query: 291 DNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQ 350
           D  + +++ ++    +  +TGH   V   +F P+ D ++ S+  D    VWD+  +  + 
Sbjct: 116 DQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPSED-LVVSASLDETVRVWDISGLRKKH 173

Query: 351 T--------------QDEIEDGPPEVLM--IHAGHKTSINDIAVNPNINWLVASAEEDNI 394
           +              Q+ ++ G  E ++  I  GH   +N  + +P +  L+ S  +D  
Sbjct: 174 SAPGASSFEEQMIAQQNLLDGGFGECVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQ 232

Query: 395 VQIWKCSS 402
           V+IW+ S+
Sbjct: 233 VKIWRMSA 240

>TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7.322
           YDL145C
          Length = 1208

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 107/252 (42%), Gaps = 30/252 (11%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           LL+  E  +    G+AF+ +  + L++    S I LWD     +       FED H   +
Sbjct: 3   LLTKFESKSTRAKGIAFHPSRPWVLVALFS-STIQLWDY----RMGTLLHRFED-HDGPV 56

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGT 290
             + +H ++  +F S  +D T+K++   +++ ++ +     Y    F         +A  
Sbjct: 57  RGIDFHPTQP-LFVSAGDDYTIKVWSLETNKCLYTLEGHLDYVRTVFFHRELPWIISASD 115

Query: 291 DNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL------- 343
           D  + +++ ++    +  +TGH   V   +F P  D ++ S+  D    VWD+       
Sbjct: 116 DQTIRIWNWQN-RKEIACITGHNHFVMCAQFHPTED-LIVSASLDETVRVWDISKLREKH 173

Query: 344 -------------QEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAE 390
                        ++I A+Q   +   G   V  I  GH   +N  + +P +  L+ S  
Sbjct: 174 SAPGGANIPSTFEEKIAAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLP-LIVSGG 232

Query: 391 EDNIVQIWKCSS 402
           +D  V++WK S+
Sbjct: 233 DDRQVKLWKMSA 244

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 102/269 (37%), Gaps = 56/269 (20%)

Query: 171 LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDII 230
           LL   E H     G+ F+  +    +S  DD  I +W +   E N K   T E  H D +
Sbjct: 45  LLHRFEDHDGPVRGIDFHPTQPL-FVSAGDDYTIKVWSL---ETN-KCLYTLE-GHLDYV 98

Query: 231 NDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLA-FSPFSSNLFAAAG 289
             V +H     I  S S+D T+++++ ++ + I  I     +   A F P + +L  +A 
Sbjct: 99  RTVFFHRELPWII-SASDDQTIRIWNWQNRKEIACITGHNHFVMCAQFHP-TEDLIVSAS 156

Query: 290 TDNLVYLYDIRDV----SNP-----------------------------LYAMTGHEDAV 316
            D  V ++DI  +    S P                              + + GH   V
Sbjct: 157 LDETVRVWDISKLREKHSAPGGANIPSTFEEKIAAQQNLLDGGFGDCTVKFILEGHTRGV 216

Query: 317 TAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDI 376
               F P    ++ S G DR+  +W +    A +            L    GH  +++ +
Sbjct: 217 NWASFHPTLP-LIVSGGDDRQVKLWKMSATKAWE------------LDSCRGHTNNVDSV 263

Query: 377 AVNPNINWLVASAEEDNIVQIWKCSSNIP 405
             +P  N L+ S  ED  ++IW     +P
Sbjct: 264 IFHPTQN-LIISVGEDKTLRIWDLDKRVP 291

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 77/186 (41%), Gaps = 52/186 (27%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFE----DAHTDIINDVKWHSSEAHIFGSVSEDS 250
           ++SG DD  + LW +S        T  +E      HT+ ++ V +H ++  I  SV ED 
Sbjct: 228 IVSGGDDRQVKLWKMS-------ATKAWELDSCRGHTNNVDSVIFHPTQNLII-SVGEDK 279

Query: 251 TMKL--FDKR------------------------------SSQIIHNINTKKPYNTLAFS 278
           T+++   DKR                              S  +I  ++ ++P    AF+
Sbjct: 280 TLRIWDLDKRVPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERP----AFN 335

Query: 279 PFSSNLFAAAGTDNL-VYLYDIRDVSNPLYAMTGHED---AVTAIEFDPNNDGILYSSGS 334
            + +NLF       L  + Y+ +  S P  ++    +   A  +I ++P+   +L + G 
Sbjct: 336 IYQNNLFYVNNEKQLQTFDYNNKVSSLPYVSLKKLGETWVAFRSISYNPSQHSVLVNQGD 395

Query: 335 DRRTIV 340
           D  ++V
Sbjct: 396 DHYSLV 401

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 95/205 (46%), Gaps = 18/205 (8%)

Query: 125 KIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYG 184
           +++K F    ++  +     D  ++   +  G + +YD S N    LLS +   T   + 
Sbjct: 72  QVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYD-SYNPRTILLS-MNASTHPTHV 129

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
             F+  +   L + SDD    LWDISN     +P +    A TD +  + +  +  H+  
Sbjct: 130 TKFHTQDSKILATASDDRVTRLWDISN---AYEPQLELTGA-TDYVRTLSFIPAAPHLIA 185

Query: 245 SVSEDSTMKLFDKRS--SQIIHNINTKKPY-NTLAFSPFSSNLFAAAGTDNLVYLYDIRD 301
           + S D  ++L+D RS  S  I+++N  +P  N +A SP  + + +  G++     + + D
Sbjct: 186 TGSYDGLVRLYDTRSSGSTPIYSLNHDQPIENVIAVSP--TQIVSCGGSN-----FKVWD 238

Query: 302 VSN--PLYAMTGHEDAVTAIEFDPN 324
           +++   LY       AVT +++  N
Sbjct: 239 LTSNKKLYERGNFNKAVTCLDYIEN 263

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 76/181 (41%), Gaps = 25/181 (13%)

Query: 233 VKWHSSEAHI-FG-------SVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSN- 283
           VK H+S  HI F        +V+  + +++F  R+ Q+I   +  K  + +  + F S+ 
Sbjct: 36  VKEHNSVTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFK--DVVYSASFRSDG 93

Query: 284 -LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWD 342
            L  A     LV +YD  +    L +M          +F   +  IL ++  DR T +WD
Sbjct: 94  KLLCAGDATGLVSVYDSYNPRTILLSMNASTHPTHVTKFHTQDSKILATASDDRVTRLWD 153

Query: 343 LQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +    A + Q E+            G    +  ++  P    L+A+   D +V+++   S
Sbjct: 154 IS--NAYEPQLEL-----------TGATDYVRTLSFIPAAPHLIATGSYDGLVRLYDTRS 200

Query: 403 N 403
           +
Sbjct: 201 S 201

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 51/133 (38%), Gaps = 16/133 (12%)

Query: 271 PYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILY 330
           P +   F    S + A A  D +  L+DI +   P   +TG  D V  + F P    ++ 
Sbjct: 126 PTHVTKFHTQDSKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLIA 185

Query: 331 SSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAE 390
           +   D    ++D +  G+        D P E            N IAV+P     + S  
Sbjct: 186 TGSYDGLVRLYDTRSSGSTPIYSLNHDQPIE------------NVIAVSPT---QIVSCG 230

Query: 391 EDNIVQIWKCSSN 403
             N  ++W  +SN
Sbjct: 231 GSNF-KVWDLTSN 242

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 85/211 (40%), Gaps = 57/211 (27%)

Query: 187 FNANEKYSLLSGSDDSNIALWDI--SNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
           +NA +   +L  S D+   +WD+  SN+ K      T   AH   + D K+ +  +++F 
Sbjct: 172 WNALDTNLILFSSIDTTCTVWDLQASNYVK------TQLIAHDSEVFDAKFLTQSSNLFA 225

Query: 245 SVSEDSTMKLFDKRS---SQIIH----NINTKKPYNT----------------------- 274
           S   D ++++FD R    S II+     +  + P  T                       
Sbjct: 226 SCGGDGSVRVFDLRCLAHSTIIYEPQQQVQGQTPSQTQVHTLAAHEQDGQLQKNSQSSAL 285

Query: 275 ------------------LAFSPFSSNLFAAAGTD-NLVYLYDIRDVSNPLYAMTGHEDA 315
                             L  SPF  N+ A    D N+V + D+R   +P+  + GH   
Sbjct: 286 SSSASSSLGALDNCALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPMLLLEGHAAP 345

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEI 346
           V  +++ P+   +L + G D + + WDL E+
Sbjct: 346 VNQLKWHPSKPNVLATCGDDCQILYWDLLEL 376

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 84/212 (39%), Gaps = 45/212 (21%)

Query: 122 SNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYD-----------------RS 164
           SN    +   HD E+  A+++ Q  N+ A+  G+G + ++D                 + 
Sbjct: 197 SNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQQQVQG 256

Query: 165 KNGVEALLSTLEYHTENG-----YGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPT 219
           +   +  + TL  H ++G        +  ++   S L   D+  +   + S F+ NI  T
Sbjct: 257 QTPSQTQVHTLAAHEQDGQLQKNSQSSALSSSASSSLGALDNCALLRLEPSPFDPNILAT 316

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSP 279
           I  +D++  II D+++              S M L +  ++          P N L + P
Sbjct: 317 IQ-QDSNVVIILDMRY------------PGSPMLLLEGHAA----------PVNQLKWHP 353

Query: 280 FSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTG 311
              N+ A  G D  +  +D+ ++ +     TG
Sbjct: 354 SKPNVLATCGDDCQILYWDLLELLSASQVWTG 385

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 80/171 (46%), Gaps = 19/171 (11%)

Query: 186 AFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGS 245
           AF  +    +++G+ D+   +WD         P  T +  H + +  V W S +  +  +
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDTQT----PMHTLK-GHYNWVLCVSW-SPDGEVIAT 203

Query: 246 VSEDSTMKLFDKRSSQIIHNI--NTKKPYNTLAFSPF------SSNLFAAAGTDNLVYLY 297
            S D+T++L+D ++ + + +      K   +L++ P       S    A++  D  + ++
Sbjct: 204 GSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 263

Query: 298 D-IRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIG 347
           D +  V    Y M+GH ++V+ +++     G+LYS   DR   VWD+   G
Sbjct: 264 DTVSRVCQ--YTMSGHTNSVSCVKW--GGQGLLYSGSHDRTVRVWDINSQG 310

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 101/265 (38%), Gaps = 47/265 (17%)

Query: 143 PQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202
           P     +A+ + +G I I+D      +    T+  HT +   + +       L SGS D 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQY---TMSGHTNSVSCVKWGGQGL--LYSGSHDR 299

Query: 203 NIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG---------SVSEDSTMK 253
            + +WDI++  +     I    +H   +N +   +  A   G         S  ED+  K
Sbjct: 300 TVRVWDINSQGR----CINILKSHAHWVNHLSLSTDYALRVGAFDHTGKRPSTPEDAQKK 355

Query: 254 LFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHE 313
             +        N N             S  +   A  D  ++L++    + P+  MTGH+
Sbjct: 356 ALENYEKICKKNGN-------------SEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQ 402

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSI 373
             V  + F P+   I+ S+  D    +WD +            DG  + +    GH  S+
Sbjct: 403 KLVNHVAFSPDGRYIV-SASFDNSIKLWDGR------------DG--KFISTFRGHVASV 447

Query: 374 NDIAVNPNINWLVASAEEDNIVQIW 398
             +A + +   L+ S  +D  +++W
Sbjct: 448 YQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 69/155 (44%), Gaps = 9/155 (5%)

Query: 188 NANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVS 247
           N N +  +++ SDD  + LW   N  K+ KP +     H  ++N V + S +     S S
Sbjct: 367 NGNSEEMMVTASDDFTMFLW---NPLKSTKP-VARMTGHQKLVNHVAF-SPDGRYIVSAS 421

Query: 248 EDSTMKLFDKRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
            D+++KL+D R  + I            +A+S     L  +   D  + ++D+R      
Sbjct: 422 FDNSIKLWDGRDGKFISTFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVR-TRKLS 479

Query: 307 YAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVW 341
             + GH+D V  +++  +   +  S G D+   +W
Sbjct: 480 VDLPGHKDEVYTVDWSVDGKRVC-SGGKDKMVRLW 513

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
           +AF+ + +Y ++S S D++I LWD     ++ K   TF   H   +  V W SS+  +  
Sbjct: 408 VAFSPDGRY-IVSASFDNSIKLWD----GRDGKFISTFR-GHVASVYQVAW-SSDCRLLV 460

Query: 245 SVSEDSTMKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLY 297
           S S+D+T+K++D R+ ++  ++   K    T+ +S        + G D +V L+
Sbjct: 461 SCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWS-VDGKRVCSGGKDKMVRLW 513

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 113/301 (37%), Gaps = 73/301 (24%)

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAF------NANEKYSLLSG 198
           D  +IAT + +  I ++D  K   ++L   L  HT+    L++         EK  L S 
Sbjct: 195 DGEVIATGSMDATIRLWDSEKG--QSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASA 252

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD-- 256
           S D  I +WD +      +  I     HT  ++ +KW     ++  S S D T++ +D  
Sbjct: 253 SKDGTIKIWDTTR-----RVCIYTLSGHTSSVSCIKWGGR--NVLYSASHDRTVRCWDMA 305

Query: 257 ---------KRSSQIIHNINTKKPYNTLAFSPFSSN------------------------ 283
                    K  +  +++++    Y  L   PF                           
Sbjct: 306 AGGKCINILKSHAHWVNHLSLSTDY-ALRMGPFDHTGTKPASPEDAQARALRNYEKVAKK 364

Query: 284 ------LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRR 337
                 L      D  +YL++    S P+  MTGH+  V  + F P+   I+ S+  D  
Sbjct: 365 NGTMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIV-SASFDNS 423

Query: 338 TIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQI 397
             +WD +            DG  + +    GH  S+  +A + +   LV S  +D  +++
Sbjct: 424 IKLWDGR------------DG--KFIATFRGHVASVYQVAWSSDCRLLV-SCSKDTTLKV 468

Query: 398 W 398
           W
Sbjct: 469 W 469

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 46/78 (58%), Gaps = 7/78 (8%)

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
           +AF+ + +Y ++S S D++I LWD     ++ K   TF   H   +  V W SS+  +  
Sbjct: 406 VAFSPDGRY-IVSASFDNSIKLWD----GRDGKFIATFR-GHVASVYQVAW-SSDCRLLV 458

Query: 245 SVSEDSTMKLFDKRSSQI 262
           S S+D+T+K++D ++ ++
Sbjct: 459 SCSKDTTLKVWDVKTRKL 476

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 80/171 (46%), Gaps = 19/171 (11%)

Query: 186 AFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGS 245
           AF  +    +++G+ D+   +WD         P  T +  H + +  V W S +  +  +
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDTQT----PMHTLK-GHFNWVLCVAW-SPDGEVIAT 203

Query: 246 VSEDSTMKLFDKRSSQIIHNI--NTKKPYNTLAFSPF------SSNLFAAAGTDNLVYLY 297
            S D+T++L+D ++ + + +      K   +L++ P       S    A++  D  + ++
Sbjct: 204 GSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIW 263

Query: 298 D-IRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIG 347
           D +  V    Y M+GH ++V+ +++     G+LYS   DR   VWD+   G
Sbjct: 264 DTVSRVCQ--YTMSGHTNSVSCVKW--GGQGLLYSGSHDRTVRVWDMNSQG 310

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 69/155 (44%), Gaps = 9/155 (5%)

Query: 188 NANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVS 247
           N N +  +++ SDD  I LW   N  K+ KP I     H  ++N V + S +     S S
Sbjct: 367 NGNSEEMMVTASDDFTIFLW---NPLKSTKP-IARMTGHQKLVNHVAF-SPDGRYIVSAS 421

Query: 248 EDSTMKLFDKRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
            D+++KL+D R  + I            +A+S     L  +   D  + ++D+R      
Sbjct: 422 FDNSIKLWDGRDGKFISTFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVR-TGKLS 479

Query: 307 YAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVW 341
             + GH+D V  +++  +   +  S G D+   +W
Sbjct: 480 VDLPGHQDEVYTVDWSVDGKRVC-SGGRDKMVRLW 513

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 115/300 (38%), Gaps = 71/300 (23%)

Query: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAF------NANEKYSLLSG 198
           D  +IAT + +  I ++D  K G E L   L  H++    L++          K  L S 
Sbjct: 197 DGEVIATGSMDNTIRLWD-PKTG-ECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASS 254

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR 258
           S D  I +WD     +  + T++    HT+ ++ VKW      +  S S D T++++D  
Sbjct: 255 SKDGTIKIWD--TVSRVCQYTMS---GHTNSVSCVKWGGQG--LLYSGSHDRTVRVWDMN 307

Query: 259 SSQIIHNI-------------NTKKPYNTLAF--------SP------------------ 279
           S     NI             +T       AF        SP                  
Sbjct: 308 SQGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGQKPTSPEDAQKKALANYEKICKKN 367

Query: 280 -FSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRT 338
             S  +   A  D  ++L++    + P+  MTGH+  V  + F P+   I+ S+  D   
Sbjct: 368 GNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIV-SASFDNSI 426

Query: 339 IVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
            +WD +            DG  + +    GH  S+  +A + +   LV S  +D  +++W
Sbjct: 427 KLWDGR------------DG--KFISTFRGHVASVYQVAWSSDCRLLV-SCSKDTTLKVW 471

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 93/201 (46%), Gaps = 18/201 (8%)

Query: 125 KIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYG 184
           ++VK F    ++        D  ++   +  G + +YD S N    L+S ++  T   + 
Sbjct: 72  QVVKTFSRFKDVVYCANFRADGKLLVAGDATGLVSVYD-SYNPRNVLVS-IQASTHPTHV 129

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
             F+  +  +L++ SDD    LWDIS+     +PT+    A TD +  +    S  H+  
Sbjct: 130 TKFHPMDSKTLITSSDDRVTRLWDISH---AYEPTLELGGA-TDYVRSLTCVPSAPHLVA 185

Query: 245 SVSEDSTMKLFDKR--SSQIIHNINTKKPY-NTLAFSPFSSNLFAAAGTDNLVYLYDIRD 301
           + S D  ++++D R  SS  I+++N  +P  N +A SP  + L +  G +     + + D
Sbjct: 186 TGSYDGLVRMYDTRTQSSDPIYSLNHDQPVENVIAISP--TQLVSCGGPN-----FKVWD 238

Query: 302 VSN--PLYAMTGHEDAVTAIE 320
           ++N   LY        VT ++
Sbjct: 239 LTNNKQLYERGNFNKTVTCLD 259

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 62/154 (40%), Gaps = 13/154 (8%)

Query: 245 SVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSN 304
           +V+  + +++F  R+ Q++   +  K     A       L  A     LV +YD  +  N
Sbjct: 56  AVTSSTRVQIFSSRTRQVVKTFSRFKDVVYCANFRADGKLLVAGDATGLVSVYDSYNPRN 115

Query: 305 PLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLM 364
            L ++          +F P +   L +S  DR T +WD+    +   +  +E G      
Sbjct: 116 VLVSIQASTHPTHVTKFHPMDSKTLITSSDDRVTRLWDI----SHAYEPTLELG------ 165

Query: 365 IHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
              G    +  +   P+   LVA+   D +V+++
Sbjct: 166 ---GATDYVRSLTCVPSAPHLVATGSYDGLVRMY 196

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 7/138 (5%)

Query: 202 SNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQ 261
           + I LWD S      K T        D I  VK++ ++++I  S   D+++ L+D R++ 
Sbjct: 192 AQIQLWDTSR----SKSTSNLSWG-ADNITSVKFNQNDSNILASTGSDNSIVLYDLRTNS 246

Query: 262 IIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF 321
               I  +   N+L ++P     F     D+  Y YD+R ++  L     H  AV  ++F
Sbjct: 247 PTQKIVQQMRTNSLCWNPMEPFNFVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDF 306

Query: 322 DPNNDGILYSSGSDRRTI 339
            P  D I+  +GS  +TI
Sbjct: 307 APTGDEIV--TGSYDKTI 322

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/158 (19%), Positives = 72/158 (45%), Gaps = 11/158 (6%)

Query: 136 ITRARYMPQDDNIIATINGEGKIFIYD-RSKNGVEALLSTLEYHTENGYGLAFNANEKYS 194
           IT  ++   D NI+A+   +  I +YD R+ +  + ++  +  ++     L +N  E ++
Sbjct: 215 ITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPTQKIVQQMRTNS-----LCWNPMEPFN 269

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            ++G++D N   +D+    + +     F+D H   + DV +  +   I  + S D T+++
Sbjct: 270 FVTGNEDHNAYYYDMRKMNRALN---VFKD-HVSAVMDVDFAPTGDEIV-TGSYDKTIRI 324

Query: 255 FDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDN 292
           F           +TK+  +         + +  +G+D+
Sbjct: 325 FKTNHGHSREVYHTKRMQHVFQVKYSMDSKYIVSGSDD 362

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 87/197 (44%), Gaps = 28/197 (14%)

Query: 168 VEALLSTLEY-HTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAH 226
            +  +  L Y H +  Y +A + ++   + +GS D  +  W++S+ E+      +F+ AH
Sbjct: 55  AQPFVGQLGYGHRDGVYAVAKHYHDLNKMATGSGDGVVKFWNMSSSEE----LCSFK-AH 109

Query: 227 TDIINDV------KWHSSEAHIFGSVSEDSTMKLF-----DKRSSQIIHNINT----KKP 271
             I+  +         +       S  +D T+KL+     D    +   N+NT    K  
Sbjct: 110 YGIVTGLCVSPVLASKNKNLQYMLSCGDDKTVKLWSVDTDDYADVKDDQNLNTRGLLKTF 169

Query: 272 YNTLAFSPF----SSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDG 327
           Y   +F       S++ F   G    + L+D    S     ++   D +T+++F+ N+  
Sbjct: 170 YGDHSFQGIDHHRSNSAFVTGGAQ--IQLWDT-SRSKSTSNLSWGADNITSVKFNQNDSN 226

Query: 328 ILYSSGSDRRTIVWDLQ 344
           IL S+GSD   +++DL+
Sbjct: 227 ILASTGSDNSIVLYDLR 243

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 96/203 (47%), Gaps = 26/203 (12%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           + +G ++ ++ L+    ++ N    +   + H + + D K+H S      S S D T +L
Sbjct: 238 ITAGGEEGSVKLF---GYKSNTLEEMATLNGHENRVTDSKFHPS-GRFIASASFDMTWRL 293

Query: 255 FDKRSSQ--IIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH 312
           +D  + +  ++   + K+ Y +L F    S L  + G D    ++DIR     + +++GH
Sbjct: 294 WDVETQEELLLQEGHGKELY-SLGFQCDGS-LVCSGGIDCKGLVWDIRSGKRAM-SLSGH 350

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKT 371
              + ++++ PN  G   ++GS   TI +WDL++             P E   I A HK+
Sbjct: 351 TKPIYSLDWSPN--GYQVATGSGDGTIRIWDLRK-------------PEEYQTILA-HKS 394

Query: 372 SINDIAVNPNINWLVASAEEDNI 394
            +  +A   N N LV+S  + +I
Sbjct: 395 IVTKVAFEKNGNCLVSSGYDKSI 417

>CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364c CDC40
          Length = 441

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 83/178 (46%), Gaps = 10/178 (5%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           +LSG +D+ + LWD  +  K ++  +     H+  I  + + +S++  F S S D  +K+
Sbjct: 164 ILSGGNDNTVKLWDFYHDRKCLRDFV----GHSKPIKTLDF-TSDSSQFLSGSYDQQVKI 218

Query: 255 FDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIR--DVSNPLYAMTGH 312
           +D  + ++   +NT    N+  F P S N F    + + +  YD R  +    +     H
Sbjct: 219 WDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQVYDHH 278

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ-EIGAEQTQDEIEDGPPEVLMIHAGH 369
             ++ AI++ P+    + SS  D+   +W+ Q  I  +Q  D  +   P  + IH  H
Sbjct: 279 LSSILAIKYFPDGSKFI-SSSEDKTLRIWNNQVNIPIKQISDTTQHSMP-YIGIHPEH 334

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 64/164 (39%), Gaps = 35/164 (21%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
           +L   P + +L  + G DN V L+D       L    GH   +  ++F   +D   + SG
Sbjct: 153 SLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDF--TSDSSQFLSG 210

Query: 334 S-DRRTIVWDLQ------EIGAEQTQDEIEDGPPE------------------------- 361
           S D++  +WD +       +    T +  E  P                           
Sbjct: 211 SYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDG 270

Query: 362 VLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
           ++ ++  H +SI  I   P+ +  ++S+ ED  ++IW    NIP
Sbjct: 271 LVQVYDHHLSSILAIKYFPDGSKFISSS-EDKTLRIWNNQVNIP 313

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 16/115 (13%)

Query: 251 TMKLFDKRSSQIIHNINTKKPYNTLAFSPFSS-----NLFAA----AGTDNLVYLYDIRD 301
           ++K++D +S+  I  I  +K       SPF S     N+ A     +G D  +Y+YDIR 
Sbjct: 81  SVKIYDLKSNDCIKTITNEKN------SPFLSLDSLHNMMACGTELSGVDAELYIYDIRS 134

Query: 302 VSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355
              P+ +    H D +T I+F PN+  +L S  +D  T ++DL E   E +  ++
Sbjct: 135 WDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQV 189

>SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963
           bp, 320 aa] {ON} highly similar to with YMR116C
           uniprot|P38011 Saccharomyces cerevisiae YMR116C ASC1 WD
           repeat protein (G- beta like protein) involved in
           translation regulation required for repression of Gcn4p
           activity in the absence of amino-acid starvation core
           component of the ribosome ortholog of mammalian RACK1
          Length = 320

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 105/239 (43%), Gaps = 29/239 (12%)

Query: 168 VEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           V  L  TLE H  NG+   LA +  +   LLS S D  +  W ++  ++     +     
Sbjct: 7   VLVLRGTLEGH--NGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKG 64

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPFSSNL 284
           H+ II D    +++     S S D T++L++  + + +   +  K    ++A    ++ +
Sbjct: 65  HSHIIQDCT-VTADGEYALSASWDKTIRLWELATGKCVKRFVGHKSDVLSVAIDRRATQI 123

Query: 285 FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDG-----ILYSSGSDRRTI 339
            +A+  D  V +++   +   +  + GH D V+ +   PN D       + S+G D+   
Sbjct: 124 VSAS-RDKTVKVWNT--LGECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVISAGMDKVVK 180

Query: 340 VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
           VW+L     E   D I            GH   +N +  +P+ + LVASA +D  + +W
Sbjct: 181 VWNLHSFQIE--ADFI------------GHNNYVNTVTASPDGS-LVASAGKDGQIMLW 224

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 105/246 (42%), Gaps = 35/246 (14%)

Query: 173 STLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIND 232
           +TL  H+   Y  +F+ + +Y LLSGS+D  + LW    +      ++     H   + D
Sbjct: 543 TTLIGHSGAVYSTSFSPDNRY-LLSGSEDKTVRLWSTDTYT-----SLVSYKGHNHPVWD 596

Query: 233 VKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPY----NTLAFSPFSSNLFAAA 288
           V++ S   H F + S D T +L+   S   I+ +     +    + ++F P    +F  +
Sbjct: 597 VQF-SPLGHYFATASHDQTARLW---SCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGS 652

Query: 289 GTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIG 347
            +D    ++DI    + +    GH   V      P  DG   ++GS+   I +WD+    
Sbjct: 653 -SDKTCRMWDI-STGDSVRLFLGHTAPVLCTAVSP--DGRWLATGSEDGIINLWDI---- 704

Query: 348 AEQTQDEIEDGPPEVLMIHAGH-KTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPR 406
                     G  + L +  GH K +I+ ++     N LV S   D+ V++W    +   
Sbjct: 705 ----------GTAKRLKVMRGHGKNAIHSLSYCKEGNVLV-SGGADHSVRVWDLKKSTAE 753

Query: 407 IGGEPE 412
            G EPE
Sbjct: 754 PGPEPE 759

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 79/178 (44%), Gaps = 10/178 (5%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            LSG +D+ + LWD+ +  + ++        H+  + DV + S     F SVS D  MK+
Sbjct: 185 FLSGGNDNKVKLWDVYHKRELLRDYC----GHSKAVRDVSF-SGSGTSFLSVSYDQHMKI 239

Query: 255 FDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNP--LYAMTGH 312
           ++  +  I H        N   FSP +SN      +++ V  YD+R       +     H
Sbjct: 240 WNTETGDIEHRYKFPAVPNCAEFSPANSNELIVGLSNSEVRHYDLRVAHKDGLVQVYDHH 299

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ-EIGAEQTQDEIEDGPPEVLMIHAGH 369
             ++ A+++ P+    + SS  D+   +WD Q  I  +Q  D  +   P  + IH  H
Sbjct: 300 LSSIIALKYFPDGSKFI-SSSEDKSMRIWDNQVNIPIKQISDTAQYSMP-FIDIHPEH 355

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 1/71 (1%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
           T+   P S +LF + G DN V L+D+      L    GH  AV  + F  +    L S  
Sbjct: 174 TIKMLPKSGHLFLSGGNDNKVKLWDVYHKRELLRDYCGHSKAVRDVSFSGSGTSFL-SVS 232

Query: 334 SDRRTIVWDLQ 344
            D+   +W+ +
Sbjct: 233 YDQHMKIWNTE 243

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 41/93 (44%), Gaps = 14/93 (15%)

Query: 306 LYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMI 365
           +++  GH +  T I+  P +  +  S G+D +  +WD+                 E+L  
Sbjct: 162 IHSYRGHHNGTTTIKMLPKSGHLFLSGGNDNKVKLWDVYH-------------KRELLRD 208

Query: 366 HAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
           + GH  ++ D++ + +    + S   D  ++IW
Sbjct: 209 YCGHSKAVRDVSFSGSGTSFL-SVSYDQHMKIW 240

>KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly
           similar to uniprot|Q12021 Saccharomyces cerevisiae
           YDR030C RAD28 Protein involved in transcription- coupled
           repair nucleotide excision repair of UV-induced DNA
           lesions homolog of human CSA protein
          Length = 425

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 70/171 (40%), Gaps = 25/171 (14%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
             +GS+D  + +WD + F+      I    A  D + D         +    SEDS  +L
Sbjct: 158 FFTGSNDHKVKIWDTNTFQVASSIDIAHRVAQLDTLGD---------LLAVASEDSHPRL 208

Query: 255 FDKRSSQIIHNINTKKP-----YNTLAFSPFSSN----LFAAAGTDNLVYLYDIRDVSNP 305
            D RS     ++  K+       N   FS  SS     L A    D  V ++D+R  +  
Sbjct: 209 IDLRSMSAAISLGVKRSDMRHGINAAKFSHTSSGAKPLLLATGDDDGNVRVWDLRMGNRW 268

Query: 306 LYAMT-------GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAE 349
           L  +T        H      + +DP+    L ++G+D +  +WDL E GA+
Sbjct: 269 LCDLTEADTLSKSHARCCNDLCWDPSGSLKLVTTGNDGKCKMWDLHEGGAK 319

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 84/195 (43%), Gaps = 22/195 (11%)

Query: 177 YHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWH 236
           +HT+    LA N   +  L S S DS + LWD+++           +  H   ++  +WH
Sbjct: 291 HHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNS---GTAARSLNQVHHGSRVSSSQWH 347

Query: 237 SSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLA-----FSPFSSNLFAAAGTD 291
            ++  I  +   DS + L D R   I    N  K +N ++      + F ++    AGTD
Sbjct: 348 QTDGSILLTAGYDSKIALTDVR---ISDEKNMSKYWNVMSGEEIETASFINDYTVLAGTD 404

Query: 292 NL-VYLYDIRDV-SNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGA 348
           N  VY +D+R V S PL+ +  H+  +  +    N  G+L +     + I +W      A
Sbjct: 405 NGNVYSFDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLWKFDPSNA 464

Query: 349 EQTQDEIEDGPPEVL 363
           +        GP  VL
Sbjct: 465 K--------GPSMVL 471

>Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]
           {ON} YJL112W (MDV1) - Involved in mitochondrial division
           [contig 260] FULL
          Length = 721

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 80/192 (41%), Gaps = 48/192 (25%)

Query: 191 EKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHI-------- 242
           + +SL++G  D+ + LWDI   E+       + D  T+   ++  H+ +AH+        
Sbjct: 457 DSHSLITGGRDALLKLWDIEKAEE------LYNDGATEGEEELCVHTFDAHVDEITALHF 510

Query: 243 ----FGSVSEDSTMKLFDKRSSQIIH--NINTKKPYNTLAFSPFSSN------------- 283
                 S S+D T++ +D  + + +   +IN      +  FS  SSN             
Sbjct: 511 EGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSILLTHNDP 570

Query: 284 -----------LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSS 332
                        A    D LV L+D+R     +  + GH DAVT ++FD  N   L + 
Sbjct: 571 PVIGALQCYDAAMATGTKDGLVRLWDLRS-GQVIRTLEGHTDAVTGLQFDSVN---LVTG 626

Query: 333 GSDRRTIVWDLQ 344
             DR   +WDL+
Sbjct: 627 SLDRSIRIWDLR 638

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 228 DIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAA 287
           D + +VK++ +E  I  S   D+++ L+D R++     I      N+L ++P  +  F  
Sbjct: 213 DNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNSLCWNPMEAFNFVT 272

Query: 288 AGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI 339
           A  D   Y YD+R +S  L     H  AV  ++F P    I+  +GS  +TI
Sbjct: 273 ANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFSPTGQEIV--TGSYDKTI 322

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 99/236 (41%), Gaps = 23/236 (9%)

Query: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN 231
           +S L +  +N   + FN NE   L S   D++I L+D+    +   PT       T   N
Sbjct: 205 ISNLSWGADNVTNVKFNQNEHDILASTGSDNSIVLYDL----RTNSPTQKI--VQTMRTN 258

Query: 232 DVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNT----LAFSPFSSNLFAA 287
            + W+  EA  F + +ED     +D R   +   +N  K + +    + FSP    +   
Sbjct: 259 SLCWNPMEAFNFVTANEDQNSYYYDMR--YMSRALNVFKDHVSAVMDVDFSPTGQEIVTG 316

Query: 288 AGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDR------RTIVW 341
           +  D  + +Y+I+   +     T     V  ++F  ++  I+  SGSD       R+  W
Sbjct: 317 S-YDKTIRIYNIKHGHSREIYHTRRMQHVFQVKFSMDSKYII--SGSDDGNVRLWRSKAW 373

Query: 342 DLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQI 397
           +   +   + ++++E    E L     H   I  I  + ++  ++  A+E   ++I
Sbjct: 374 ERSNVKTTREKNKLE--YDEKLKERFKHMPEIKRINRHRHLPQVIKKAQEIKKIEI 427

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%)

Query: 303 SNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
           SNP+  ++   D VT ++F+ N   IL S+GSD   +++DL+
Sbjct: 202 SNPISNLSWGADNVTNVKFNQNEHDILASTGSDNSIVLYDLR 243

>AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL137W
           (SEC27); 1-intron
          Length = 832

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 98/209 (46%), Gaps = 28/209 (13%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++ GSDD  I +++ +  EK     + FE AH D I  +  H + +++  S S+D T+KL
Sbjct: 70  IIVGSDDFKIRVFNYNTGEK----VVDFE-AHPDYIRALAVHPTRSYVL-SASDDLTVKL 123

Query: 255 FDKRSSQIIHNINTKKPYNTLA--FSPFSSNLFAAAGTDNLVYLYDI-RDVSNPLYAMTG 311
           ++   +  +        +  ++  F+P   N FA A  D+ V ++ + ++ SN  + +  
Sbjct: 124 WNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSN--FTLRA 181

Query: 312 H-EDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGH 369
           H E  V  +++ P  D     + SD RT+ VWD Q      T +              GH
Sbjct: 182 HLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLE--------------GH 227

Query: 370 KTSINDIAVNPNINWLVASAEEDNIVQIW 398
            ++++    +P +  ++ S  ED  V+IW
Sbjct: 228 LSNVSYAVYHPMLP-IIISGSEDGTVKIW 255

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 68/164 (41%), Gaps = 12/164 (7%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLA--FNA 189
           H+  +    + P+D N  AT   +  + I+     G E    TL  H E G      +  
Sbjct: 139 HEHFVMSVTFNPKDPNTFATACLDHTVKIWSL---GQETSNFTLRAHLEKGVNFVDYYPF 195

Query: 190 NEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED 249
            +K  L++ SDD  + +WD        K  +   + H   ++   +H     I  S SED
Sbjct: 196 QDKPYLITSSDDRTVKVWDYQT-----KSCVATLEGHLSNVSYAVYHPMLPIII-SGSED 249

Query: 250 STMKLFDKRSSQIIHNINTKKPYN-TLAFSPFSSNLFAAAGTDN 292
            T+K+++  + ++   +N     +  +A  P     F AAG DN
Sbjct: 250 GTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFDN 293

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 68/140 (48%), Gaps = 21/140 (15%)

Query: 266 INTKKPYNT-LAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324
           +NTK    T L + P  S+L A    D  + ++D+      L  + GH+ ++T ++FD N
Sbjct: 75  VNTKPAEVTFLQYHP-DSSLLAVGYRDGNIKVWDLVS-KTVLINLNGHKSSITVLKFDVN 132

Query: 325 NDGILYSSGSDRRTIVWDL-QEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNIN 383
               L S  SD   I+WDL  E+G  + +                HK  I+D+ V+ + N
Sbjct: 133 CTR-LVSGSSDSNIIIWDLVSEVGICKLR---------------SHKDRISDLYVDDDFN 176

Query: 384 WLVASAEEDNIVQIWKCSSN 403
           WL+ S  +D ++++W   +N
Sbjct: 177 WLL-SVSKDGLIKVWDLKTN 195

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 11/130 (8%)

Query: 134 GEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKY 193
            E+T  +Y P D +++A    +G I ++D     V   L  L  H  +   L F+ N   
Sbjct: 80  AEVTFLQYHP-DSSLLAVGYRDGNIKVWDLVSKTV---LINLNGHKSSITVLKFDVNCT- 134

Query: 194 SLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMK 253
            L+SGS DSNI +WD+ +     +  I    +H D I+D+ +   + +   SVS+D  +K
Sbjct: 135 RLVSGSSDSNIIIWDLVS-----EVGICKLRSHKDRISDL-YVDDDFNWLLSVSKDGLIK 188

Query: 254 LFDKRSSQII 263
           ++D +++Q +
Sbjct: 189 VWDLKTNQCV 198

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 90/197 (45%), Gaps = 22/197 (11%)

Query: 177 YHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHT-DIINDVKW 235
           +HT+    LA N + +  L S S D  + LWD+++     +   + +  H+   ++  +W
Sbjct: 269 HHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHG----RAARSLDAVHSATAVSSSQW 324

Query: 236 HSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAA-----AGT 290
           H S+  I  +   DS + L D R   I ++    K +  +      S  F +     AGT
Sbjct: 325 HPSDGSILLTAGYDSRVALSDVR---IANDAGMSKYWKVMKGEEIESATFVSETVFLAGT 381

Query: 291 DNL-VYLYDIRDV--SNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEI 346
           D+  VY +D+R+   S PL+ +  H+  ++++   P+   +L +S    + I +W     
Sbjct: 382 DSGNVYSFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAE 441

Query: 347 GAEQTQDEIEDGPPEVL 363
           GA       ++GP  VL
Sbjct: 442 GA-----SAQEGPRMVL 453

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/303 (21%), Positives = 127/303 (41%), Gaps = 53/303 (17%)

Query: 140 RYMPQDDNIIAT-------INGEGKIFIYDRSKNGVEALLSTLEYHTENG-YGLAFNANE 191
           +Y P  DN +A        + G GK+FI D +  G   ++ +  + T++G + +A+N   
Sbjct: 16  QYSPFFDNKLAVATGSNFGLVGNGKLFILDITPQG--KIVESNSFLTKDGLFDVAWNELH 73

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
           +  +L+   D ++ L+DI N +K   P   F++   ++ +   W+  +   F S S D T
Sbjct: 74  ENQVLAAQGDGSLRLFDI-NLQK--YPVAIFQEHEREVFS-CNWNLIDKQTFLSSSWDGT 129

Query: 252 MKLFDKRSSQIIHNI--------------------------------NTKKPYNTLAFSP 279
           +K++     Q +  +                                N K       +SP
Sbjct: 130 VKIWSPARKQSLRTLLPTPTNNTVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSP 189

Query: 280 FSSNLFAAAGTDNLVYLYDIRD-VSNPLYAMTGHE--DAVTAIEFDPNNDGILYSSGSDR 336
             SNL  +   ++ V ++DIR  V+    +   H   +A+T  +F+     I+ + G D+
Sbjct: 190 HDSNLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTC-DFNKYRPHIVATGGVDK 248

Query: 337 RTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQ 396
              VWDL+ +   Q+       P  +  +  GH  ++  +  +P+ + ++ S   D   +
Sbjct: 249 LIKVWDLRMV--RQSLLHTRSSPVSINEMQ-GHSLAVRRVFWSPHHSDMLLSTSYDMTCR 305

Query: 397 IWK 399
            W+
Sbjct: 306 TWQ 308

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 49/124 (39%), Gaps = 6/124 (4%)

Query: 136 ITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSL 195
           I +A Y P D N++ + +G   + I+D  +       S + +         FN    + +
Sbjct: 182 IYQALYSPHDSNLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTCDFNKYRPHIV 241

Query: 196 LSGSDDSNIALWDISNFEKNIKPT------ITFEDAHTDIINDVKWHSSEAHIFGSVSED 249
            +G  D  I +WD+    +++  T      I     H+  +  V W    + +  S S D
Sbjct: 242 ATGGVDKLIKVWDLRMVRQSLLHTRSSPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYD 301

Query: 250 STMK 253
            T +
Sbjct: 302 MTCR 305

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 111/257 (43%), Gaps = 41/257 (15%)

Query: 149 IATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWD 208
           +A+ + +G I I+D ++      L TL  H+ +   + +       L SGS D  + +WD
Sbjct: 253 LASASKDGTIKIWDTAR---RVCLYTLSGHSNSVACVKWGGEGL--LYSGSHDKTVRVWD 307

Query: 209 ISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL--FD----KRSSQI 262
           +++    +   I+    H   +N +           S+S D  +++  FD    K S+  
Sbjct: 308 MNS--ATVGKCISILKNHAHWVNHL-----------SLSTDYALRIGPFDHTGVKPSTPA 354

Query: 263 IHNINTKKPYNTLAFSPFSSN-LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF 321
                 +  Y+ +A    S+  L   A  D  ++L++ + ++ PL  MTGH+  V  + F
Sbjct: 355 EAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAF 414

Query: 322 DPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPN 381
            P+   I+ S+  D    +WD +            DG  + L    GH  S+  +A + +
Sbjct: 415 SPDGRYIV-SASFDNSIKLWDGR------------DG--KFLSTFRGHVASVYQVAWSSD 459

Query: 382 INWLVASAEEDNIVQIW 398
              LV S  +D  +++W
Sbjct: 460 CRLLV-SCSKDTTLKVW 475

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/114 (18%), Positives = 46/114 (40%), Gaps = 15/114 (13%)

Query: 296 LYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355
           ++ ++ V+    A+ GH   +    F P+    + +   D    +WD       QT    
Sbjct: 122 IFKVKPVTRSASAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCD----TQTP--- 174

Query: 356 EDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGG 409
                  L    GH   +  ++ +P+   ++A+   D+ +++W+ +   P  GG
Sbjct: 175 -------LATLEGHSNWVLCVSWSPDGE-VIATGSMDSTIRLWESTKGKPVGGG 220

>Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa]
           {ON} YGL137W (REAL)
          Length = 887

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 94/211 (44%), Gaps = 24/211 (11%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++ GSDD  I +++ +  EK     + FE AH D I  +  H ++ ++  S S+D T+KL
Sbjct: 64  IIVGSDDFRIRVFNYNTGEK----VVDFE-AHPDYIRSIAVHPTKPYVL-SGSDDLTVKL 117

Query: 255 FDKRSSQIIHNINTKKPYNTL--AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH 312
           ++  ++  +        +  +  AF+P     FA+   D  V ++ +   +      TG 
Sbjct: 118 WNWENNWALEQTFEGHEHFVMCVAFNPKDPTTFASGCLDRTVKVWSLGQSTPNFTLTTGQ 177

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKT 371
           E  V  +++ P  D     + SD  TI +WD Q      T +              GH +
Sbjct: 178 ERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLE--------------GHMS 223

Query: 372 SINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +++    +P +  ++ S  ED  ++IW  S+
Sbjct: 224 NVSFAVFHPTLP-IIISGSEDGTLKIWNSST 253

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 126/301 (41%), Gaps = 52/301 (17%)

Query: 139 ARYMPQDDNIIAT-------INGEGKIFIYDRSKNGVEALLSTLEYHTENG-YGLAFNAN 190
            +Y P  DN +A        + G GK+FI D   +G   ++ +  + T++G + +A+N  
Sbjct: 14  VQYSPFYDNKLAVATGSNFGLVGNGKLFILDIDPHG--RMVESNSFLTQDGLFDVAWNEG 71

Query: 191 EKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDS 250
               +L+   D ++ L+DI N  +   P   F++   ++ +   W+      F S S D 
Sbjct: 72  HANQVLAAQGDGSLRLFDI-NLPQ--YPISIFQEHQKEVFS-CNWNLVNKQTFVSSSWDG 127

Query: 251 TMKLFDKR----------------------------SSQIIHNI--NTKKPYNTLAFSPF 280
           T+K++                               S+Q  H+I    K       FSP 
Sbjct: 128 TVKIWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPH 187

Query: 281 SSNLFAAAGTDNLVYLYDIRDVSNPL---YAMTGHEDAVTAIEFDPNNDGILYSSGSDRR 337
             NL      ++ V L+D+R  +N     +   G  + +T  +F+     I+ + G D+ 
Sbjct: 188 DPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTC-DFNKYRPHIVATGGVDKL 246

Query: 338 TIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQI 397
             +WDL+ +   +  + ++   P  +    GH+ +I  ++ +P+ + LV S   D   ++
Sbjct: 247 VKIWDLRMV--RKFSNPLQQ--PMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRV 302

Query: 398 W 398
           W
Sbjct: 303 W 303

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/260 (20%), Positives = 103/260 (39%), Gaps = 50/260 (19%)

Query: 131 PHDGEITRARYMPQDD-----------NIIATINGEGKIFIYDRSKNGVEALLSTLEYHT 179
           PH   +    ++ QD            N +    G+G + ++D   N  +  +S  + H 
Sbjct: 47  PHGRMVESNSFLTQDGLFDVAWNEGHANQVLAAQGDGSLRLFD--INLPQYPISIFQEHQ 104

Query: 180 ENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEK--NIKPT----------------IT 221
           +  +   +N   K + +S S D  + +W     E    + P                 ++
Sbjct: 105 KEVFSCNWNLVNKQTFVSSSWDGTVKIWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLS 164

Query: 222 FEDAHT------DIINDVKWHSSEAHIFGSVSEDSTMKLFDKR--SSQIIHNINTKKPYN 273
            +  H+      D I   ++   + ++    + +S + LFD R  ++    N  +     
Sbjct: 165 NQQNHSIISKNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLE 224

Query: 274 TLA--FSPFSSNLFAAAGTDNLVYLYDIRDV---SNPLYA------MTGHEDAVTAIEFD 322
           TL   F+ +  ++ A  G D LV ++D+R V   SNPL        + GHE A+  + + 
Sbjct: 225 TLTCDFNKYRPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWS 284

Query: 323 PNNDGILYSSGSDRRTIVWD 342
           P++  ++ S+  D    VWD
Sbjct: 285 PHHSNLVLSTSYDMTCRVWD 304

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 51/129 (39%), Gaps = 5/129 (3%)

Query: 136 ITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSL 195
           I +A++ P D N+I    G   + ++D  +       + + +         FN    + +
Sbjct: 179 IYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIV 238

Query: 196 LSGSDDSNIALWDISNFEKNIKP-----TITFEDAHTDIINDVKWHSSEAHIFGSVSEDS 250
            +G  D  + +WD+    K   P     +I     H   I  V W    +++  S S D 
Sbjct: 239 ATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDM 298

Query: 251 TMKLFDKRS 259
           T +++D  S
Sbjct: 299 TCRVWDDLS 307

>KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.247
           YKR036C
          Length = 653

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 74/171 (43%), Gaps = 26/171 (15%)

Query: 196 LSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSE-------AHIFGSVSE 248
           +SGS D+ + LW+I    +  K  +   ++ T  ++    H  E            S S 
Sbjct: 408 VSGSKDATLKLWNIDLATEKAKKLLPELESRTACLHSFTSHKGEIVALSLSGESLVSASR 467

Query: 249 DSTMKLFDKRSSQIIHNINTKKPYNTLA-----FSPFS----------SNLFAAAGTDNL 293
           D T++ +D +S + + +++   P   LA     +S  +           N  A    D L
Sbjct: 468 DKTIRQWDLKSGKCVQSLDVAFPSRDLAGLDASYSMLNPPVVGTLQSYENALATGSRDGL 527

Query: 294 VYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
           + L+D+R +   +  +  H  AVTA++FD  +   L +   DR   +WDL+
Sbjct: 528 IRLWDLR-IGKVVRTIPAHNSAVTALKFDTTH---LITGSFDRTAFIWDLR 574

>Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa]
           {ON} YGL137W (REAL)
          Length = 891

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 94/211 (44%), Gaps = 24/211 (11%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++ GSDD  I +++ +  EK     + FE AH D I  +  H ++ ++  S S+D T+KL
Sbjct: 64  IIVGSDDFRIRVFNYNTGEK----VVDFE-AHPDYIRSIAVHPTKPYVL-SGSDDLTVKL 117

Query: 255 FDKRSSQIIHNINTKKPYNTL--AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH 312
           ++  ++  +        +  +  AF+P     FA+   D  V ++ +   +      TG 
Sbjct: 118 WNWENNWALEQTFEGHEHFVMCVAFNPKDPTTFASGCLDRTVKVWSLGQSTPNFTLTTGQ 177

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKT 371
           E  V  +++ P  D     + SD  TI +WD Q      T +              GH +
Sbjct: 178 ERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLE--------------GHMS 223

Query: 372 SINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +++    +P +  ++ S  ED  ++IW  S+
Sbjct: 224 NVSFAVFHPTLP-IIISGSEDGTLKIWNSST 253

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 95/224 (42%), Gaps = 55/224 (24%)

Query: 132 HDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANE 191
           H   +   ++  + DN++ + +  G+IFI+D +K             T +GY + F+   
Sbjct: 103 HTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINK------------ITSSGY-VPFSP-- 147

Query: 192 KYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDST 251
                       +A+  I                  D +  + W+ S AH+F S      
Sbjct: 148 -----------GVAMTPI------------------DEVYSLAWNQSLAHVFASAGSSGY 178

Query: 252 MKLFD-KRSSQIIH------NINTKKPYNTLAFSPFSSNLFA-AAGTDN--LVYLYDIRD 301
             ++D K   +++H      +   K   + + + P +S   A A G DN  ++ ++D+R+
Sbjct: 179 TSIWDLKAKKEVLHLSYTSPSTGAKNHLSVVEWHPSNSTKIATATGNDNDPVILVWDLRN 238

Query: 302 VSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
              PL AM+ GH   + ++++   ++ +L SSG D    +W+ Q
Sbjct: 239 AKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQ 282

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 70/148 (47%), Gaps = 13/148 (8%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD-DSNIALWDISNFEKNIKPT 219
           Y     G +  LS +E+H  N        + K +  +G+D D  I +WD+ N +    P 
Sbjct: 195 YTSPSTGAKNHLSVVEWHPSN--------STKIATATGNDNDPVILVWDLRNAKA---PL 243

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYN-TLAFS 278
                 H+  I  + W   + ++  S   D+T  L++ +++Q +    T+  +     F+
Sbjct: 244 QAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQFPTRGNWCFKTKFA 303

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
           P + +LFA+A  DN + +  +++++N L
Sbjct: 304 PEAPDLFASASLDNKIQVQTLQNLTNKL 331

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 106/263 (40%), Gaps = 43/263 (16%)

Query: 143 PQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202
           P +   +AT + +G I I+D ++        TL  HT +   + +       L SGS D 
Sbjct: 242 PGERPRLATSSKDGTIKIWDTTR---RVCTMTLSGHTSSVSCVKWGGQN--FLYSGSHDK 296

Query: 203 NIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL--FDKRSS 260
            + +WD+    KN    I     H   +N +           S+S D  +++  FD    
Sbjct: 297 TVRVWDM----KNSGRCINILKNHAHWVNHL-----------SLSTDYALRVGPFDYTGE 341

Query: 261 QI----IHNINTKKPYNTLA-FSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDA 315
           Q     I      K Y  +A  +   + L   A  D  ++L+D    + P+  MTGH+  
Sbjct: 342 QPATPEIAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKL 401

Query: 316 VTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSIND 375
           V  + F P+   I+ S+  D    +WD +            DG  + +    GH  S+  
Sbjct: 402 VNHVAFSPDGRHIV-SASFDNSIKLWDSR------------DG--KFITTFRGHVASVYQ 446

Query: 376 IAVNPNINWLVASAEEDNIVQIW 398
           +A + +   LV S  +D  +++W
Sbjct: 447 VAWSSDCRLLV-SCSKDTTLKVW 468

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 66/124 (53%), Gaps = 9/124 (7%)

Query: 139 ARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSG 198
           A+   ++  ++ T + +  +F++D  +      ++ +  H +    +AF+ + ++ ++S 
Sbjct: 361 AKRNGKETELMVTASDDFTMFLWDPLRT--TKPIARMTGHQKLVNHVAFSPDGRH-IVSA 417

Query: 199 SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR 258
           S D++I LWD     ++ K   TF   H   +  V W SS+  +  S S+D+T+K++D R
Sbjct: 418 SFDNSIKLWD----SRDGKFITTFR-GHVASVYQVAW-SSDCRLLVSCSKDTTLKVWDIR 471

Query: 259 SSQI 262
           + ++
Sbjct: 472 TRKL 475

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 63/160 (39%), Gaps = 30/160 (18%)

Query: 247 SEDSTMKLFDKRSSQIIH-NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNP 305
           S D ++ + D   S ++    NT +   TL F+P +              ++ ++ V+  
Sbjct: 87  SADKSVDIIDNLYSTLLKPGYNTTEDIITLVFTPRA--------------VFKVKPVTRS 132

Query: 306 LYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMI 365
             A+ GH   +    F P+    + +   D    +WD       QT       P   L  
Sbjct: 133 SSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD----TQT-------PMATL-- 179

Query: 366 HAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIP 405
             GH   +  ++ +P+   L+A+   DN V++W+  +  P
Sbjct: 180 -TGHHNWVLCVSWSPDGE-LIATGSMDNTVRLWESKTGKP 217

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 103/239 (43%), Gaps = 29/239 (12%)

Query: 168 VEALLSTLEYHTENGY--GLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDA 225
           V  L  TLE H  NG+   LA +  +   LLSGS D ++  W ++  ++     +     
Sbjct: 6   VLVLRGTLEGH--NGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRG 63

Query: 226 HTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHN-INTKKPYNTLAFSPFSSNL 284
           H+ I+ D    + +     S S D T++L++  S + I   +  K    ++     +S +
Sbjct: 64  HSHIVQDCT-VTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQI 122

Query: 285 FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDG-----ILYSSGSDRRTI 339
            +A+  D  V +++   +   +  + GH D V+ +   PN         + S+G D+   
Sbjct: 123 VSAS-RDKTVKVWNT--LGECMVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVK 179

Query: 340 VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
           VW+L     E   D I            GH   +N +  +P+   LVASA +D  + +W
Sbjct: 180 VWNLHSFQIE--ADFI------------GHNNYVNTVTASPDGT-LVASAGKDGQIMLW 223

>NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672
          Length = 434

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 99/206 (48%), Gaps = 26/206 (12%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
            ++GS+D+ I +WD++  + ++K T+     H   + D+       ++F S SED  +K 
Sbjct: 138 FVTGSNDATIKIWDLA--KGHLKLTLA---GHAMTVRDIAISERHPYMF-SASEDKLVKC 191

Query: 255 FDKRSSQIIHNINTK-KPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHE 313
           +D   +  I + +      +++   P + +L A AG D++V L+DIR     +  + GH+
Sbjct: 192 WDLEKNTAIRDYHGHLSGVHSVDIHP-TLDLIATAGRDSVVRLWDIR-ARVSVMTLIGHK 249

Query: 314 DAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSI 373
             +  +   P +  I+ S  +D    +WD            I  G    ++ H  HK S+
Sbjct: 250 SPINKVHCLPVDPQIV-SCSTDATIRLWD------------IIAGKSRKVLTH--HKKSV 294

Query: 374 NDIAVNPNINWLVASAEEDNIVQIWK 399
            D++ +P    +V+++ +D  ++ W+
Sbjct: 295 RDMSFHPREFSMVSASTDD--IRSWR 318

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 58/131 (44%), Gaps = 17/131 (12%)

Query: 274 TLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSG 333
            +A  P  +  F     D  + ++D+      L  + GH   V  I     +   ++S+ 
Sbjct: 127 CVAVDPIDNEWFVTGSNDATIKIWDLAKGHLKL-TLAGHAMTVRDIAISERHP-YMFSAS 184

Query: 334 SDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDN 393
            D+    WDL++  A      I D        + GH + ++ + ++P ++ L+A+A  D+
Sbjct: 185 EDKLVKCWDLEKNTA------IRD--------YHGHLSGVHSVDIHPTLD-LIATAGRDS 229

Query: 394 IVQIWKCSSNI 404
           +V++W   + +
Sbjct: 230 VVRLWDIRARV 240

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 40/95 (42%), Gaps = 15/95 (15%)

Query: 309 MTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAG 368
           + GH   V  +  DP ++    +  +D    +WDL +                + +  AG
Sbjct: 118 INGHLGWVRCVAVDPIDNEWFVTGSNDATIKIWDLAK--------------GHLKLTLAG 163

Query: 369 HKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSN 403
           H  ++ DIA++    ++  SA ED +V+ W    N
Sbjct: 164 HAMTVRDIAISERHPYMF-SASEDKLVKCWDLEKN 197

>NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7.310
           YDL195W
          Length = 1289

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 99/228 (43%), Gaps = 25/228 (10%)

Query: 146 DNIIATINGEGKIFIYDRSKNG-VEALLSTLEYHTENGYGLAFNANEKYSLL---SGSDD 201
           ++ IA     GKI ++   KN  + +L S  ++    G       N K + L    GS++
Sbjct: 74  NDFIAGALDNGKIELFSFEKNSDIPSLKSISQFAKHTGATKVVRFNPKQTNLFASGGSNN 133

Query: 202 SNIALWDISNFEKNIK------PTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLF 255
             I +WD++      K      P +    +    I  + W+ S AH+F S    +   ++
Sbjct: 134 GEIFIWDVTKLTPTTKEYTPQAPGVPL--SQIAEITSLAWNKSLAHVFASAGSTTHASIW 191

Query: 256 DKRSSQIIHNINTKKPYNTLA-------FSPFSSNLFA---AAGTDNLVYLYDIRDVSNP 305
           D ++ + + ++N   P   L        + P +S   A    A  D  + ++D+R+ + P
Sbjct: 192 DLKAKKEVIHLNYTSPTTGLKPQLSVVEWHPMNSTRVATATGADKDPSILVWDLRNSNIP 251

Query: 306 LYAM--TGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQT 351
           L  M  T  +  + ++++   ++ ++ +SG D    +W+  E G + T
Sbjct: 252 LQVMSQTQTQGGILSLDWCSQDESLMLASGRDNTVTLWN-PETGKQLT 298

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 70/148 (47%), Gaps = 12/148 (8%)

Query: 161 YDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD-DSNIALWDISNFEKNIKPT 219
           Y     G++  LS +E+H  N   +A          +G+D D +I +WD+ N   NI   
Sbjct: 204 YTSPTTGLKPQLSVVEWHPMNSTRVA--------TATGADKDPSILVWDLRN--SNIPLQ 253

Query: 220 ITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYN-TLAFS 278
           +  +      I  + W S +  +  +   D+T+ L++  + + +    ++  +     F+
Sbjct: 254 VMSQTQTQGGILSLDWCSQDESLMLASGRDNTVTLWNPETGKQLTTYPSRTNWCFKTQFA 313

Query: 279 PFSSNLFAAAGTDNLVYLYDIRDVSNPL 306
           P S ++FA+A  D+ + +  ++D++N L
Sbjct: 314 PESPDIFASASFDSKIEVVTLQDLTNEL 341

>YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {ON}
            SEC27Essential beta'-coat protein of the COPI coatomer,
           involved in ER-to-Golgi and Golgi-to-ER transport;
           contains WD40 domains that mediate cargo selective
           interactions; 45% sequence identity to mammalian
           beta'-COP
          Length = 889

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 95/211 (45%), Gaps = 24/211 (11%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++ GSDD  I +++ +  EK     + FE AH D I  +  H ++ ++  S S+D T+KL
Sbjct: 70  IIVGSDDFRIRVFNYNTGEK----VVDFE-AHPDYIRSIAVHPTKPYVL-SGSDDLTVKL 123

Query: 255 FDKRSSQIIHNINTKKPYNTL--AFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH 312
           ++  ++  +        +  +  AF+P   + FA+   D  V ++ +   +      TG 
Sbjct: 124 WNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQ 183

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKT 371
           E  V  +++ P  D     + SD  TI +WD Q      T +              GH +
Sbjct: 184 ERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLE--------------GHMS 229

Query: 372 SINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +++    +P +  ++ S  ED  ++IW  S+
Sbjct: 230 NVSFAVFHPTLP-IIISGSEDGTLKIWNSST 259

>KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.239
           YGL137W
          Length = 911

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 94/211 (44%), Gaps = 24/211 (11%)

Query: 195 LLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKL 254
           ++ GSDD  + +++ +  EK     I+  +AH D I  +  H ++ ++  + S+D T+KL
Sbjct: 70  IVVGSDDFRLRIFNYNTGEK-----ISDFEAHPDYIRSIAVHPTKPYVI-TGSDDLTVKL 123

Query: 255 FDKRSSQIIHNINTKKPY--NTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGH 312
           ++   +  +        +   ++AF+P   N FA+   D  V ++ +         +TG 
Sbjct: 124 WNWEKNWALEQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSLGQSQPNFTLVTGQ 183

Query: 313 EDAVTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKT 371
           E  V  +++ P  D     + SD  T+ +WD Q      T +              GH  
Sbjct: 184 EKGVNYVDYYPLPDKPYLLTASDDMTVKIWDYQTKSCVATLE--------------GHMA 229

Query: 372 SINDIAVNPNINWLVASAEEDNIVQIWKCSS 402
           +++    +P +  ++ S  ED  V+IW  S+
Sbjct: 230 NVSFAIFHPTLP-IIISGSEDGTVKIWNSST 259

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 68/135 (50%), Gaps = 12/135 (8%)

Query: 230 INDVKW--HSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSS--NLF 285
           IND++   H+  +    + +  +++K+FD  S++ +  I+++     + F    S   L 
Sbjct: 62  INDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQ---GNVPFPSLDSRHGLL 118

Query: 286 AAA----GTDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIV 340
           A      G D  +Y+YDIR    P+ ++   H D VT +++ PN+  IL S  +D  T V
Sbjct: 119 ACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNV 178

Query: 341 WDLQEIGAEQTQDEI 355
           +DL E   E +  ++
Sbjct: 179 YDLSEAEEEDSLHQV 193

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256
           D+ I ++DI  +++   P  +  D+H D +  +KWH ++ +I  S S D    ++D
Sbjct: 128 DAAIYIYDIRKWDQ---PVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 81/197 (41%), Gaps = 29/197 (14%)

Query: 147 NIIATINGEGKIFIYD--RSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204
           N IA       + IYD  R+      L++TL  H+ +   + FN  + + L+SG  D  I
Sbjct: 197 NYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCI 256

Query: 205 ALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIH 264
            +WD+ +    +  +    ++ +D + DVKW  +  + F S+  D+++            
Sbjct: 257 KVWDLRSHSYKVNRSDLNFNSGSDSVRDVKWMPT--YDFASLGADTSL------------ 302

Query: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324
                        S   SN FA+     L+  +D+R  +     +  H      + + P+
Sbjct: 303 ------------CSSGRSNKFASVHDSGLLLTFDMRQPNQVERKINAHSGPGLCMHWHPH 350

Query: 325 NDGILYSSGSDRRTIVW 341
            D I+ S G D +  +W
Sbjct: 351 MDYII-SGGRDGKCALW 366

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 283 NLFAAAGTDNLVYLYDIRDVS---NPLYA-MTGHEDAVTAIEFDPNNDGILYSSGSDRRT 338
           N  A  GT   V +YDI   S   +PL   ++ H  ++ +++F+     +L S G D   
Sbjct: 197 NYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCI 256

Query: 339 IVWDLQ 344
            VWDL+
Sbjct: 257 KVWDLR 262

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 104/257 (40%), Gaps = 31/257 (12%)

Query: 143 PQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202
           P D   +A+ + +G I I+D ++      L TL  HT +   + +    +  L SGS D 
Sbjct: 244 PGDKPRLASASKDGTIKIWDTAR---RVCLFTLSGHTNSVSCVKWGG--RGVLYSGSHDK 298

Query: 203 NIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQI 262
            I  WD++   K     I    +H   IN +   +  A   G+   D T K   K SS  
Sbjct: 299 TIRAWDMNAGGK----CINILKSHAHWINHLSLSTDYALRVGAF--DHTGK---KPSSPE 349

Query: 263 IHNINTKKPYNTLAFSPFS-SNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF 321
                  + Y  +A        L   A  D  +YL+D    + P+  MTGH+  V  + F
Sbjct: 350 EARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNHVAF 409

Query: 322 DPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPN 381
            P+   I+ S+  D    +WD +            DG    +    GH  S+  +A + +
Sbjct: 410 SPDGRYIV-SASFDNSIKLWDGR------------DG--TFIATFRGHVASVYQVAWSSD 454

Query: 382 INWLVASAEEDNIVQIW 398
              L+ S  +D  +++W
Sbjct: 455 CR-LLVSCSKDTTLKVW 470

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 185 LAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFG 244
           +AF+ + +Y ++S S D++I LWD     ++     TF   H   +  V W SS+  +  
Sbjct: 407 VAFSPDGRY-IVSASFDNSIKLWD----GRDGTFIATFR-GHVASVYQVAW-SSDCRLLV 459

Query: 245 SVSEDSTMKLFDKRSSQIIHNI-NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLY 297
           S S+D+T+K++D R+ ++  ++   K    T+ +S        +AG D +V ++
Sbjct: 460 SCSKDTTLKVWDVRTKKLSVDLPGHKDEVYTVDWS-VDGKRVCSAGKDKMVRIW 512

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/104 (20%), Positives = 41/104 (39%), Gaps = 15/104 (14%)

Query: 296 LYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355
           ++ +R V+    A+ GH   +    F P+    + +   D    +WD       QT    
Sbjct: 125 VFKVRPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCNTNTPMQTLK-- 182

Query: 356 EDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWK 399
                       GH   +  +A +P+   L+A+   DN +++W+
Sbjct: 183 ------------GHFNWVLCVAWSPDGE-LIATGSMDNTIRLWQ 213

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 61/128 (47%), Gaps = 19/128 (14%)

Query: 225 AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPY----------NT 274
            H   I D+ +H     I  + S D+ +  +D RS Q        +PY          + 
Sbjct: 112 GHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQ--------RPYYSTSEWRAGASQ 163

Query: 275 LAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGS 334
           + ++  +SN+ A++ +D+ V ++D+R    PLY + GHE +V  I+F+   +  + SS +
Sbjct: 164 VKWNFRNSNIMASSHSDH-VCIWDLRKGCTPLYTLQGHEGSVNNIDFNKAKETEIMSSSN 222

Query: 335 DRRTIVWD 342
           D     WD
Sbjct: 223 DGTVKFWD 230

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 68/174 (39%), Gaps = 19/174 (10%)

Query: 230 INDVKWHSSEAHIFGSVSEDSTMKL---FDKRSSQIIHNI--NTKKPYNTLAFSPFSSNL 284
           + DV+W    A  +  VS  +   +     + S+  I +I     +    + F P    +
Sbjct: 70  VADVQWSPHPAKPYWVVSTSNQKAMVWNLSRNSTNAIEHILHGHFRAITDINFHPHHPEI 129

Query: 285 FAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQ 344
            A    D  V  +D+R    P Y+ +      + ++++  N  I+ SS SD    +WDL+
Sbjct: 130 LATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWNFRNSNIMASSHSDH-VCIWDLR 188

Query: 345 EIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398
           +                 L    GH+ S+N+I  N      + S+  D  V+ W
Sbjct: 189 KGCTP-------------LYTLQGHEGSVNNIDFNKAKETEIMSSSNDGTVKFW 229

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,095,080
Number of extensions: 2164130
Number of successful extensions: 10805
Number of sequences better than 10.0: 1147
Number of HSP's gapped: 8942
Number of HSP's successfully gapped: 2082
Length of query: 419
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 307
Effective length of database: 40,638,807
Effective search space: 12476113749
Effective search space used: 12476113749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)