Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B03553g6.7ON1021102143070.0
Kpol_1045.806.7ON101969913721e-172
NCAS0F001806.7ON101870613701e-172
KAFR0L003306.7ON102872712901e-160
KNAG0E009706.7ON100471312371e-153
ZYRO0F00440g6.7ON103970112391e-152
NDAI0K029106.7ON106373212311e-151
TDEL0G046406.7ON101770212091e-148
Suva_5.136.7ON102371611911e-146
Skud_5.346.7ON101971411721e-143
Smik_5.326.7ON102071411661e-142
YEL055C (POL5)6.7ON102271511561e-141
TPHA0J002506.7ON102470610711e-128
KLLA0D00792g6.7ON102071610451e-125
Ecym_30096.7ON10277309931e-117
TBLA0A072106.7ON10417199921e-117
ACR020C6.7ON10027149841e-116
SAKL0E00770g6.7ON10477219781e-115
KLTH0C11594g6.7ON10067229741e-115
Kwal_56.223346.7ON10087149571e-112
Kwal_33.141091.231ON12854722.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03553g
         (1021 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...  1663   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   533   e-172
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   532   e-172
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   501   e-160
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   481   e-153
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   481   e-152
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   478   e-151
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   470   e-148
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   463   e-146
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   456   e-143
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   453   e-142
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   449   e-141
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   417   e-128
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   407   e-125
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   387   e-117
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   386   e-117
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   383   e-116
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   381   e-115
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   379   e-115
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   373   e-112
Kwal_33.14109 s33 (531094..531480) [387 bp, 128 aa] {ON} YKR049C...    32   2.0  

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5 DNA
            polymerase V
          Length = 1021

 Score = 1663 bits (4307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 845/1021 (82%), Positives = 845/1021 (82%)

Query: 1    MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNS 60
            MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNS
Sbjct: 1    MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNS 60

Query: 61   ARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXXXXIL 120
            ARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADF             IL
Sbjct: 61   ARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFDEGKKRKGKDERGIL 120

Query: 121  FGKLFGLQALLNEPLFSNVFVTKDGISNFVPVFVQEMINLSKCKNWIREPALFSLYQTLE 180
            FGKLFGLQALLNEPLFSNVFVTKDGISNFVPVFVQEMINLSKCKNWIREPALFSLYQTLE
Sbjct: 121  FGKLFGLQALLNEPLFSNVFVTKDGISNFVPVFVQEMINLSKCKNWIREPALFSLYQTLE 180

Query: 181  KLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQGWKS 240
            KLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQGWKS
Sbjct: 181  KLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQGWKS 240

Query: 241  NDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTIINGSHS 300
            NDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTIINGSHS
Sbjct: 241  NDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTIINGSHS 300

Query: 301  LNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQRAFPMLK 360
            LNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQRAFPMLK
Sbjct: 301  LNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQRAFPMLK 360

Query: 361  SYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKILPVFETLAFG 420
            SYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKILPVFETLAFG
Sbjct: 361  SYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKILPVFETLAFG 420

Query: 421  KSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQFILDSMLH 480
            KSGSITFD            GIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQFILDSMLH
Sbjct: 421  KSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQFILDSMLH 480

Query: 481  LVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFXXXXXXXXXXXXXXXX 540
            LVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLF                
Sbjct: 481  LVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFSILSELNSLHLSESQE 540

Query: 541  IPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKATDKPYLRGLGSLFAT 600
            IPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKATDKPYLRGLGSLFAT
Sbjct: 541  IPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKATDKPYLRGLGSLFAT 600

Query: 601  CLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXXXXXXXXXXXXXXXXXXXXXXXXVW 660
            CLLQLYTGDSESVGTLQELKDIYEKLISDDERP                         VW
Sbjct: 601  CLLQLYTGDSESVGTLQELKDIYEKLISDDERPLSSITEILLSLLAQKKALLKKASIAVW 660

Query: 661  EQVVPYVSQDEXXXXXXXXXARENKQGFAQLFXXXXXXXXXXXXXXXXXXXQIKXXXXXX 720
            EQVVPYVSQDE         ARENKQGFAQLF                   QIK      
Sbjct: 661  EQVVPYVSQDELNLLLDILLARENKQGFAQLFEGIDEYEEDEDDEQLEDEEQIKEVTDDS 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDAVNNIDKETTSALAKALDLPADIINANGE 780
                                         NDAVNNIDKETTSALAKALDLPADIINANGE
Sbjct: 721  SSNSESDSEEDEDNSDSHEDTSSDSVEDHNDAVNNIDKETTSALAKALDLPADIINANGE 780

Query: 781  VDIEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIFKRRKEALSNIPTGNKRKNEVKE 840
            VDIEK                              EIFKRRKEALSNIPTGNKRKNEVKE
Sbjct: 781  VDIEKLEMQSDDDEDDEDDESMDDEQMMDLDDQLSEIFKRRKEALSNIPTGNKRKNEVKE 840

Query: 841  SRESVIAFKHRIVDLLLVYIKHVEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQTXX 900
            SRESVIAFKHRIVDLLLVYIKHVEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQT  
Sbjct: 841  SRESVIAFKHRIVDLLLVYIKHVEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQTLD 900

Query: 901  XXXXXXXXXXXXXXXFKIRVTGIKLDTADVVEDFQRIHQDFLFAKPGQFPILYYSVCSST 960
                           FKIRVTGIKLDTADVVEDFQRIHQDFLFAKPGQFPILYYSVCSST
Sbjct: 901  KSLAEKLAKLLKTRLFKIRVTGIKLDTADVVEDFQRIHQDFLFAKPGQFPILYYSVCSST 960

Query: 961  SLYFSKILVDNADYQQGVYETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQGPKT 1020
            SLYFSKILVDNADYQQGVYETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQGPKT
Sbjct: 961  SLYFSKILVDNADYQQGVYETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQGPKT 1020

Query: 1021 N 1021
            N
Sbjct: 1021 N 1021

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  533 bits (1372), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 297/699 (42%), Positives = 428/699 (61%), Gaps = 24/699 (3%)

Query: 1   MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIE-EWNYTINRLVKGLGSSRN 59
           M KVNRD FYKLASDLPEER+Q+AV +IKDLSAL+ P E+E E+ Y +NRL+ GL S+RN
Sbjct: 1   MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRN 59

Query: 60  SARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXX--X 117
           SARLGFS+CL+E +NLAL   D+    L SI+++L ++++TL  D               
Sbjct: 60  SARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDER 119

Query: 118 XILFGKLFGLQALLNEPLFSNVFVTKDG-ISNFVPVFVQEMINLSKCKNWIREPALFSLY 176
            I+FG++F LQALLNEPLF+ VF+ K+G IS F   F  +++ L+  KNW+REP LF+LY
Sbjct: 120 GIMFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLY 179

Query: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAE-IKLQN 235
           QT+EK +  +  S I +L+  LD+  LT+TNEGLAIYL L+  + K    +IA  + L++
Sbjct: 180 QTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGK----KIASSLPLES 235

Query: 236 QGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTII 295
           QGWK NDPLAKGNLP+LT+VLL+++      +  +  Q   ANW+PRLHFVW+ LL  ++
Sbjct: 236 QGWKLNDPLAKGNLPTLTQVLLNSNI-----NQSETPQGNAANWSPRLHFVWDILLPILL 290

Query: 296 NGSHSLNVEDKHVSKKRK-KNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQR 354
               + N  D+HVSKK+K K  +  SIKF  FW+MVVDE++FN+K+SSERKYLGFLI Q+
Sbjct: 291 GQDSTTN--DEHVSKKQKSKTTSSTSIKFQSFWKMVVDESFFNEKSSSERKYLGFLIIQK 348

Query: 355 AFPMLKSYEDVVDSL-GQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKILPV 413
           +  ++ +   +V+SL GQN +RS+INQ ++ KR L+KI+ + +  I+E+CE DTTKI P+
Sbjct: 349 SLELVPA--QLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPI 406

Query: 414 FETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQF 473
            + + FG++G+  FD             IK++  E LS++F +LS ++   SE     QF
Sbjct: 407 VKVILFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQKDQF 466

Query: 474 ILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFXXXXXXXXX 533
           +LD++LH+VRN K E++   +  ++L  ++ LAFF  +NE +  ++KER F         
Sbjct: 467 VLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAAI 526

Query: 534 XXXXXXXIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKATDKPYLRG 593
                    QY  ++L+      G  +  E+D +L   +   +  L E+ K +D   LRG
Sbjct: 527 TTSTRSW--QYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKSDTVQLRG 584

Query: 594 LGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXXXXXXXXXXXXXXXXXXX 653
           L  L +  LLQLY GD +SV  +++L   Y++   DD                       
Sbjct: 585 LECLLSMSLLQLYAGDVDSVSIVEDLCTFYDER-EDDSVSLVGITEILLALLAQRKAVLK 643

Query: 654 XXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                 WEQ VP++  +E         ARENK+GFAQLF
Sbjct: 644 KIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682

 Score =  190 bits (483), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 156/281 (55%), Gaps = 15/281 (5%)

Query: 756  IDKETTSALAKALDLPADIINANGEVDIEK--------XXXXXXXXXXXXXXXXXXXXXX 807
            I+KETTSALAKAL+LP +IIN NGEVD++                               
Sbjct: 739  INKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEKM 798

Query: 808  XXXXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMI 867
                    EIFKRRKEALS++ +GN+RK +VKESRE+VIAFKHRI+DLL  YIK+VEK+ 
Sbjct: 799  MELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858

Query: 868  QREDVDEN-SKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVT----G 922
             R+  D+  +K   LNC+      M++CI+ T                 FKI +T    G
Sbjct: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918

Query: 923  IKLDTADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVD--NADYQQGVYE 980
               +   V+   + IH+  + +KPGQ   LY+SVCS++SL+ SK+L++  NAD +   + 
Sbjct: 919  NVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAFS 978

Query: 981  TLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQGPKTN 1021
             L+D Y    K+WL   +F   +F+DF NWL SKK    T+
Sbjct: 979  QLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNSATTD 1019

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
           YEL055C
          Length = 1018

 Score =  532 bits (1370), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 283/706 (40%), Positives = 433/706 (61%), Gaps = 15/706 (2%)

Query: 1   MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNS 60
           + KVNRD FYKLASDL EER QAA+ ++K+L+ L +P E EEW Y +NRL+KGL S R+S
Sbjct: 2   VTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRSS 61

Query: 61  ARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXXXX-- 118
           ARLGFS+CL+E +NLALS+ + APEGL +I+++L++L++TL  D                
Sbjct: 62  ARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRD 121

Query: 119 ---ILFGKLFGLQALLNEPLFSNVFVTK-DGISNFVPV---FVQEMINLSKCKNWIREPA 171
              +LFGK+FGLQA+ NEP+FS+VF+TK DG +   P    F+ E+++L+  KNWI+E  
Sbjct: 122 ERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESC 181

Query: 172 LFSLYQTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEI 231
           LF+L+QT++KL+   +K    +++S LD +NL++T+EGLA+YL ++      ++ + + I
Sbjct: 182 LFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSSI 241

Query: 232 KLQNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLL 291
           + +N GWK+NDPL++GNLP LT+VL D+     +E  E  K++  +NWNPRLHFVW+ LL
Sbjct: 242 EFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDILL 301

Query: 292 STIINGSHSLNVEDKHVSKKRKKNNT--IASIKFHEFWQMVVDETYFNDKASSERKYLGF 349
             +I+G H+     +H+SKKRKKNN      I+F EFWQMVVDE++FN+KASSERKYLGF
Sbjct: 302 PILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLGF 361

Query: 350 LIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT- 408
           LIF +   ++ S   + +    NF+RSLINQ ++ KR L+K++   +  I+E C+ D++ 
Sbjct: 362 LIFIKTIKVV-SQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSN 420

Query: 409 KILPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEK 468
           K++     + FG SGSI FD             I  +  + L+ LFD+ +  +S KSE K
Sbjct: 421 KLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKSENK 480

Query: 469 SFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFXXXX 528
             ++++LD++LH+VR  K  ++   +   +L  +++ AFF  +NE L E++KER      
Sbjct: 481 QKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFSSILA 540

Query: 529 XXXXXXXXXXXXIPQYVVIKLVQQHIEGGE-KMTSELDDELRETESSALRILAEIAKATD 587
                         QY  + ++ +    G+ ++ ++LD+ L + ++ A  ++ +I K+  
Sbjct: 541 ELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKIIKSPQ 600

Query: 588 KPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXX-XXXXXXXXXX 646
            P L GL SL + CLLQL++G++ES+ T++EL + Y++   D E                
Sbjct: 601 SPQLNGLESLLSMCLLQLFSGETESLSTIEELIEFYKEHKGDTESTSLVGITEILLSLLA 660

Query: 647 XXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                       VWEQ +  V ++E         ARENKQGFA LF
Sbjct: 661 QKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLF 706

 Score =  185 bits (470), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 115/269 (42%), Positives = 152/269 (56%), Gaps = 12/269 (4%)

Query: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXXXXX 812
            VNNIDKE TSALAKAL+LP +I+N  GEVD+ K                           
Sbjct: 756  VNNIDKEATSALAKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKMM 815

Query: 813  ----XXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQ 868
                   EIFKRRKEALS   TGN+RK E KESRE+VIAFK R+VDLL VY+K+VEK+ Q
Sbjct: 816  LLDDQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKL-Q 874

Query: 869  REDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIK--LD 926
              D      + K   L++F  PM+ C+++T                 FKI+ +  K   +
Sbjct: 875  TAD-----HSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSAN 929

Query: 927  TADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTY 986
              +V+E  +++H+  L  KPGQ P LYY++ SS SL+FSKI V ++  +   Y  L+D Y
Sbjct: 930  PVEVLEYLKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQY 989

Query: 987  STTIKEWLKDTKFPHSIFLDFVNWLASKK 1015
            S T K W+  +KF  + F DF NWLAS+K
Sbjct: 990  SNTTKSWMSKSKFGPNFFADFFNWLASRK 1018

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1028

 Score =  501 bits (1290), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 295/727 (40%), Positives = 426/727 (58%), Gaps = 43/727 (5%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
            KVNRD FYKLAS+L EERLQAAV +I++LSAL++P   EEWNY + RL+KGL S R  A
Sbjct: 6   GKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRTGA 65

Query: 62  RLGFSMCLSEALNLALSLGDKAPE--GLNSIENYLKILNETLGADFXXXXXXXXXX---X 116
           RLGFS+CL+E +NLA+ L  K  E   L++I+ YL IL+ETL  D               
Sbjct: 66  RLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGKDE 125

Query: 117 XXILFGKLFGLQALLNEPLFSNVFV-TKDGISNFVPVFVQEMINLSKCKNWIREPALFSL 175
             +LFGK+FGL+ALLNEPLFS  F+  K   SNF   F+ E+++L+  KNWIREP LF+L
Sbjct: 126 RGLLFGKMFGLKALLNEPLFSKTFLPNKKVASNFCERFMVELLDLASRKNWIREPCLFTL 185

Query: 176 YQTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVD---ESNKISRAEIAEIK 232
           +QT+EKL+       I  ++  LD++  T+TNEGLAIYLLL+    E  K    +I  + 
Sbjct: 186 FQTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKIKLLV 245

Query: 233 LQNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLS 292
           L+N  WK NDPLA+GNLP LT+VL ++   +     E++ +   ANW PRLHFVW+ LL 
Sbjct: 246 LKNSSWKLNDPLARGNLPRLTQVLRESSLAS----EEKKVEVMSANWQPRLHFVWDILLP 301

Query: 293 TIINGSHSLNVEDKHVSKKRKKNN---TIASIKFHEFWQMVVDETYFNDKASSERKYLGF 349
           T+   +   N ++KH+SK+RKKN    T   I+F EFWQM VDE++FN+KASSERKYLGF
Sbjct: 302 TV--STIESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASSERKYLGF 359

Query: 350 LIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESC-ENDTT 408
            IF+RA  ++++         QNF+RSLINQ S+  R L+KI+ + +  IV++C E+ +T
Sbjct: 360 SIFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEESPST 419

Query: 409 KILPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSI-KSEE 467
           K++PV  ++ F  +GS  FD             I  +    L +LFD+L+ Q+ +  SE+
Sbjct: 420 KLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGTSED 479

Query: 468 KSFSQFILDSMLHLVRNQKAEV--------DSLLLTEKVLPQIVKLAFFT---------- 509
              +QFILDS+LH+VR+ K ++        ++ L+ +  +  +V+LAFF           
Sbjct: 480 FKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQTDIAKKEDE 539

Query: 510 GDNETLQEMSKERLFXXXXXXXXXXXXXXXXIPQYVVIKLVQQHIEGGEKMTSELDDELR 569
            DN+ + E++KERLF                   Y +++++ +  E    + +++DD+L+
Sbjct: 540 SDNQ-VDELAKERLFSVLSELTTTTNKQLHSWQYYTLLEIIDRENENPNSLINKMDDDLK 598

Query: 570 ETESSALRILAEIAKATDKPYL---RGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKL 626
               +A++++  IA   +K      RGL SL + CLLQLY+GD++SV T++EL   Y   
Sbjct: 599 TVRDNAIKVIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVATIEELITFYNAS 658

Query: 627 IS-DDERPXXXXXXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENK 685
              +++R                          VWEQ V  + +D          ARENK
Sbjct: 659 RDVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLLDVLPARENK 718

Query: 686 QGFAQLF 692
           QGFA+LF
Sbjct: 719 QGFAELF 725

 Score =  198 bits (503), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/268 (43%), Positives = 158/268 (58%), Gaps = 16/268 (5%)

Query: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXX 809
            N+A+  IDKE TSALAKAL+LP DIIN NGEV+ +                         
Sbjct: 772  NEAIAKIDKEATSALAKALNLPDDIINENGEVNFDDLSDGSDISSDEESLDDEKMMELDD 831

Query: 810  XXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQR 869
                  EIFKRRKEALS++ TGN+RK EVKESRESVIAFKHR+ DLL +YIKH       
Sbjct: 832  QLA---EIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHA------ 882

Query: 870  EDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIKLDTAD 929
            ED +  +K   L     F  PM+KC++QT                 +K++   ++  TA+
Sbjct: 883  EDSELPAKYAIL-----FIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTKNMEEITAE 937

Query: 930  VVED-FQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYST 988
             V D    +H+  L +KPGQ+   +YS+CSSTS++ SK+L+  ++ ++  Y  +VD YS 
Sbjct: 938  QVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYGKIVDIYSE 997

Query: 989  TIKEW-LKDTKFPHSIFLDFVNWLASKK 1015
            T K+W LKD+KF  +IF+DF NWL+SKK
Sbjct: 998  TTKKWVLKDSKFGSNIFIDFYNWLSSKK 1025

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
           YEL055C
          Length = 1004

 Score =  481 bits (1237), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 278/713 (38%), Positives = 415/713 (58%), Gaps = 39/713 (5%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
            KVNRDHFYKLASDLPEERLQAAV +IK+LS+L +P   +EW+Y +NRL+KGL S RN A
Sbjct: 3   GKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRNGA 62

Query: 62  RLGFSMCLSEALNLALSL-GDKAPEGLNSIENYLKILNETLGADFX-XXXXXXXXXXXXI 119
           RLGFS+CL+E ++LA+ +  DKAPE L S++++L +L++T   D               +
Sbjct: 63  RLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKEERGL 122

Query: 120 LFGKLFGLQALLNEPLFSNVFVTKDGISNFVPVFVQEMINLSKCKNWIREPALFSLYQTL 179
           +FGKLF LQALLNEPLFS++F+    I+ F   F+ E++NL+  KNWI++P LF+LYQT+
Sbjct: 123 MFGKLFALQALLNEPLFSDIFIKDGKITKFTTKFIDELVNLASRKNWIKQPCLFTLYQTI 182

Query: 180 EKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQGWK 239
           E+L+     S +  +++ LD N  T+TNEGLAIYLL +   +K   + +  I + N+GWK
Sbjct: 183 ERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFI---SKGYSSALLSINVTNKGWK 239

Query: 240 SNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTIINGSH 299
            N+PL KGNL  +++V+   +     +DNE +     ANW+P+LHFVW+ LL  + N   
Sbjct: 240 YNNPLLKGNLSLVSEVV--RESAVVVDDNETK--TNNANWHPKLHFVWDILLPILYN--- 292

Query: 300 SLNVEDKHVSKKRKKNN--------TIASIKFHEFWQMVVDETYFNDKASSERKYLGFLI 351
             +  ++ + KK+K NN         + +I+F EFW+ +VDETYF+DKASSERK+LG LI
Sbjct: 293 --DPREEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLI 350

Query: 352 FQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT-KI 410
           F +A P + S + +     QN +R LINQCS+ +RHL+KIA + +  IV++CE D   K+
Sbjct: 351 FLKALPTVPS-KWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKL 409

Query: 411 LPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEKSF 470
           +PV   L FG +GSI FD              K +  + + KLF + + +L+ +  E   
Sbjct: 410 VPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAVL 469

Query: 471 SQFILDSMLHLVR----NQKAEVDSLLLTEKVLPQIVKLAFFTG------DNETLQEMSK 520
             FILD++LH++R    N K E  S  L   +L  +VKL FF        D   + E+++
Sbjct: 470 -HFILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATETSPEDKINVSEIAR 528

Query: 521 ERLFXXXXXXXXXXXXXXXXIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILA 580
           ER++                   +++ +L    +E    +T+ LD++L   + + L ++ 
Sbjct: 529 ERIYSILSELSSVPTGDAHSWQFHILNELTT--VENELTLTNALDEDLTTVKDTGLSVIH 586

Query: 581 EIAKATDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKD-IYEKLISDDERPXXXXXX 639
            ++   DK   RG+ SL A CLLQLY+G+++SV T++E+ D + E+  S +         
Sbjct: 587 SLSVKNDKSS-RGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGITE 645

Query: 640 XXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                              VWEQ++  V  DE         ARENK+GF+ LF
Sbjct: 646 ILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLF 698

 Score =  200 bits (509), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 156/268 (58%), Gaps = 7/268 (2%)

Query: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXX 809
            N  V NID++T  ALAKAL LP +++N +GEV   K                        
Sbjct: 741  NKDVTNIDRQTACALAKALKLPENVVNEDGEV---KFNEIDDLEDESSDDESMDDEAMMA 797

Query: 810  XXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQR 869
                  +IFKRRK+ALS++PTGN RK EV++SRESVI FK R++D+L +Y+K+VEK+   
Sbjct: 798  LDGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKL--- 854

Query: 870  EDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIKLDTAD 929
            +  D++   +KL  + TF  PM+KC+++T                 FK+++     D   
Sbjct: 855  DLEDKDVMKEKLQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKIFKVKIPVSAEDGER 914

Query: 930  VVEDFQRIHQDFLFA-KPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYST 988
             VE  QRIH  +L A K GQ+  +YYS+CSS S++F K+L+++ D +   +  ++D Y+ 
Sbjct: 915  FVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAE 974

Query: 989  TIKEWLKDTKFPHSIFLDFVNWLASKKQ 1016
            T K+W+   KFP S+F DF NWL+SK+Q
Sbjct: 975  TTKKWMDKKKFPTSVFFDFYNWLSSKRQ 1002

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  481 bits (1239), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 287/701 (40%), Positives = 412/701 (58%), Gaps = 22/701 (3%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
            KVNRD FY+LASDL +ER++AAV +I++LSALE+P   EEW+Y + RL+ GL S RNSA
Sbjct: 3   GKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRNSA 62

Query: 62  RLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXX--XXXXXXXI 119
           RLGFS+CLSE + +AL  G  AP+ L+S + YL++L+  L  D                I
Sbjct: 63  RLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDERGI 122

Query: 120 LFGKLFGLQALLNEPLFSNVFVTKDG-ISNFVPVFVQEMINLSKCKNWIREPALFSLYQT 178
           LFGK+FGLQA+LNEPLF+++F  ++G +S F   F QE+  L+  KNW+RE  L++L+QT
Sbjct: 123 LFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTLFQT 182

Query: 179 LEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVD---ESNKISRAEIAEIKLQN 235
           +++L+  +    +++++  LD+  LTMTNEGLAIYLLL       N  S    + + L+ 
Sbjct: 183 VQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLALEF 242

Query: 236 QGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNE--QRKQKGGANWNPRLHFVWEKLLST 293
             WK+NDPL+KGNLP L++VL D    A A D+E         ANWNPRLHFVW+ L+  
Sbjct: 243 AAWKNNDPLSKGNLPQLSRVLRD----APANDSEVADGSHPKSANWNPRLHFVWDILIPI 298

Query: 294 IINGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQ 353
           +  G     +     S K+KK +T+  I+F EF+Q  VDET+F++KASSERKYLGFL+F 
Sbjct: 299 LAPGKSDEEIP-SKKSHKKKKKDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLVFI 357

Query: 354 RAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT-KILP 412
           RA  ++ S + +     QNF+R+LINQ S+ KR LNKI+ + ++ IV++CE D + KI  
Sbjct: 358 RAVEVVSS-QWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIAL 416

Query: 413 VFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSE-EKSFS 471
             E + FG  G+I+FD             IK +    L +LF++LS QLS + E  K   
Sbjct: 417 CLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQHY 476

Query: 472 QFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFXXXXXXX 531
           QF+LD++LH VR  + E+   L+   +L  IV LAFF+   E + ++++ERLF       
Sbjct: 477 QFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLFSILSELT 536

Query: 532 XXXXXXXXXIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKATDKPYL 591
                      Q+  +KL+      G +  ++LD++L+  E+ AL IL  I  ++D P  
Sbjct: 537 IQKDGQSW---QHYTLKLILSKEAEGNEPINKLDEDLKAIETEALDILQNI--SSDSPQS 591

Query: 592 RGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXXXXXXXXXXXXXXXXX 651
           RGL  L + CLLQLY+GDSES+  ++EL   Y + + ++                     
Sbjct: 592 RGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGL-NESNSLVGITEILLSLLAQKKAL 650

Query: 652 XXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                  VWEQ V  V + E         ARENK+GFA+LF
Sbjct: 651 LRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLF 691

 Score =  203 bits (516), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 110/283 (38%), Positives = 156/283 (55%), Gaps = 17/283 (6%)

Query: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXX--------------XXXXXX 798
            V  ID+E TSALAKAL+LP +I+N  GEVD+E+                           
Sbjct: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEE 814

Query: 799  XXXXXXXXXXXXXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLV 858
                             +IFKRRKEALS + TGN+RK EVKE+RE+VI FKHRIVD+L  
Sbjct: 815  EESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874

Query: 859  YIKHVEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKI 918
            YIKH +++  +++ DE +  D    L  F  PMI+C++ T                 +KI
Sbjct: 875  YIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKI 934

Query: 919  RVTGIK--LDTADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQ 976
            +++  K  +D+  ++E  +  H+  L +KPGQFP LY+S CS+TSL+  K+LV+N     
Sbjct: 935  KISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSEDP 994

Query: 977  GV-YETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQGP 1018
             + Y  ++D Y+ T KEWL   KF  ++F DF NWL S+K+ P
Sbjct: 995  AISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKTP 1037

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  478 bits (1231), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 288/732 (39%), Positives = 418/732 (57%), Gaps = 44/732 (6%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
            KVNRD FYKLASDL EERLQ+AV +IK+LS L VP +IEEW Y +NRL+KGL S RNSA
Sbjct: 3   GKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRNSA 62

Query: 62  RLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXXXX--- 118
           RLGFS+CL+EA+NLAL +GD AP+G+ SI  +L +L++TL  D                 
Sbjct: 63  RLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKKKG 122

Query: 119 -----ILFGKLFGLQALLNEPLFSNVFVTKDGI---SNFVPVFVQEMINLSKCKNWIREP 170
                ILFGKLF LQALLNEPLFS +F+++D     S+    +V E+  L   KNWIRE 
Sbjct: 123 RDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIRES 182

Query: 171 ALFSLYQTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAE--I 228
             F+LYQT+EKL+          +++ LD+  LT++ EGLAIYLL++  S    + E  +
Sbjct: 183 CFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEKTL 242

Query: 229 AEIKLQNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGG----ANWNPRLH 284
           ++I+L N  WKSN+PLA+GNLP+LT +L D++   F +D+E+   K      ANW PRLH
Sbjct: 243 SDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEF-QDHEKPPTKNNKQPPANWAPRLH 301

Query: 285 FVWEKLLSTI--------INGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYF 336
           FVW+ LL  +         N       + +   KK + +N    I+F EFWQM +DE++F
Sbjct: 302 FVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEF--IRFPEFWQMAIDESFF 359

Query: 337 NDKASSERKYLGFLIFQRAFPML--KSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQ 394
           N+KASSERKYLGFLIFQ+    +   + + +     +NF+RSLINQ S+ KR L+K++  
Sbjct: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419

Query: 395 TVEIIVESCEND-TTKILPVFETLAFGKS--GSITFDXXXXXXXXXXXXGIKSVRYEVLS 451
            ++ IV+ CE+D + K++P  + L F  +  GSI FD             IK +    L 
Sbjct: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSSTLR 479

Query: 452 KLFDILSRQLSIKSEEKSFS---QFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF 508
           +L  +   Q++  S EK  +   QF LD++LH+VR+ K+E D   + E +L  +VKLAFF
Sbjct: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFF 539

Query: 509 TGDNETLQEMSKERLFXXXXXXXXXXXXXXXXIP----QYVVIKLV-QQHIEGGEKMTSE 563
           + DNE L E++KERL+                       Y  ++L+ +    G +++ ++
Sbjct: 540 SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNK 599

Query: 564 LDDELRETESSALRILAEIAKA-TDK--PYLRGLGSLFATCLLQLYTGDSESVGTLQELK 620
           LD +L   +++ L++L EI+   TD+     +GL  L + C+LQL++GD+ES+ T++EL 
Sbjct: 600 LDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELV 659

Query: 621 DIYEKLISDDERPXXXXXXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXX 680
           + Y     ++                            VWE  +  + ++E         
Sbjct: 660 EFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVLP 719

Query: 681 ARENKQGFAQLF 692
            RENKQGFA LF
Sbjct: 720 VRENKQGFAHLF 731

 Score =  200 bits (508), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 158/285 (55%), Gaps = 21/285 (7%)

Query: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXX---- 805
            N  + NIDKE TSALAKAL+LP +I+N  GEVD+ K                        
Sbjct: 784  NGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEE 843

Query: 806  -----XXXXXXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYI 860
                           EIFKRRKEALSNI TGN+RK EVKESRE+VIAFKHR++D+L++Y+
Sbjct: 844  SMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYM 903

Query: 861  KHVEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRV 920
            K+VE +    +       +K   LL F  PMIKC+KQT                 FKI+ 
Sbjct: 904  KYVEGLTLTTE-----NGEKFGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKS 958

Query: 921  TGIKLDTAD-----VVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVD-NADY 974
            +  ++++ +     V+E  QR H+  L +K GQFP LYYS+CS+ S++  KILV   ++ 
Sbjct: 959  SNFQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESND 1018

Query: 975  QQGVYETLVDTYSTTIKEW-LKDTKFPHSIFLDFVNWLASKKQGP 1018
            ++  Y  L+D Y  T K W +   KF  + F DF NWL+S++Q P
Sbjct: 1019 KEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQIP 1063

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  470 bits (1209), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 277/702 (39%), Positives = 405/702 (57%), Gaps = 25/702 (3%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
            +VNRD FYKLASDL EER+QAAV +I++LSAL++P    EW+Y + RL+ GL SSRNSA
Sbjct: 3   GRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRNSA 62

Query: 62  RLGFSMCLSEALNLALSLGDKAPEGLNSIENY-----LKILNETLGADFXXXXXXXXXXX 116
           RLGFS+CL+E +NLAL+L    PE L+SI+ +       +  +  G D            
Sbjct: 63  RLGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTLSLQPSGQD--SKKQIKGKDE 120

Query: 117 XXILFGKLFGLQALLNEPLFSNVFVTKD-GISNFVPVFVQEMINLSKCKNWIREPALFSL 175
             +LFGK+FGLQALL+EPLF  VF++K+ GIS+F   F+ E+  L+  K+W+REP LF+L
Sbjct: 121 RGLLFGKMFGLQALLSEPLFEKVFISKEKGISDFALRFMDELCQLAVFKSWLREPCLFTL 180

Query: 176 YQTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQN 235
           +Q  E+++          ++  LD+  LT+TNEGLAIYLLL+ +S +   + I ++  ++
Sbjct: 181 FQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSILQMDFES 240

Query: 236 QGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTII 295
           + WKSNDPLA+GNLP L++VL D+  VA  ED    K    +NW PRLHFVW+ LL  I 
Sbjct: 241 KSWKSNDPLARGNLPLLSQVLRDS-SVA-TEDESSPK---ASNWTPRLHFVWDILLPIIT 295

Query: 296 NGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQRA 355
             +     ED+    K++K     +I+F EFWQM VDE+ FN+KAS+ERK+LG +IFQ+A
Sbjct: 296 QDNSRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVIFQKA 355

Query: 356 FPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESC-ENDTTKILPVF 414
             +   ++ V     QN +R+LIN  S+ KR L KI+L+ +  IV+ C +    K++P  
Sbjct: 356 LEV-TPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLVPCL 414

Query: 415 ETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSE--EKSFSQ 472
             + FG  GSI FD             +  +    L++LF +LS  L I+S   E+   Q
Sbjct: 415 SAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNL-IESSLVEQKNQQ 473

Query: 473 FILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFXXXXXXXX 532
           FILD+MLH VR+ K+E++  ++   +L  I+ LAFFT  +E    ++KER +        
Sbjct: 474 FILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFFTVKDEHTSNLAKERFYSILSEITH 533

Query: 533 XXXXXXXXIPQY--VVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKATDKPY 590
                    P Y  + + +++  I  G+++T++LDD L + +S ALR L  I+     P 
Sbjct: 534 LNNEG----PSYQNMALDIIRDEIAAGKELTTKLDDTLEDVKSEALRTLQAISNNEKNPQ 589

Query: 591 LRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXXXXXXXXXXXXXXXX 650
           LRGL  L + CLLQLY+G+SE+V  ++EL   Y+    ++                    
Sbjct: 590 LRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQD-TDENSTSLVGITEILLSLLAQKKA 648

Query: 651 XXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                    W+Q V  + + E         ARENK+GF+QLF
Sbjct: 649 VLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQLF 690

 Score =  191 bits (484), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 107/280 (38%), Positives = 152/280 (54%), Gaps = 20/280 (7%)

Query: 751  DAVNNIDKETTSALAKALDLPADIINANGEVDIEK-------------XXXXXXXXXXXX 797
            D V  IDKE TSALAKAL+LP +I+N  GEVD+                           
Sbjct: 743  DDVAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDE 802

Query: 798  XXXXXXXXXXXXXXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLL 857
                              +IFKRRK+ALSNI TGN+RKNE KESRE VIAFK R++D+L 
Sbjct: 803  DEDSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLE 862

Query: 858  VYIKHVEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFK 917
            +Y+K VEK    + + E + +   +CLL    PMIKCI+QT                 FK
Sbjct: 863  IYVKFVEK----QSLKEENYSKISSCLLLLE-PMIKCIQQTTDKSLANRIAKLLRTKVFK 917

Query: 918  IRVTGI--KLDTADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQ 975
            ++ +      D  +++E  +  H+     KPGQ   +YYSVCS+ SL+ +KI+++N+D +
Sbjct: 918  LKTSAFCGSCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSK 977

Query: 976  QGVYETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKK 1015
                  ++D Y+ T+K+W  + KF  +IF+DF NWL+S+K
Sbjct: 978  DAAVHDIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
           YEL055C (REAL)
          Length = 1023

 Score =  463 bits (1191), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 294/716 (41%), Positives = 425/716 (59%), Gaps = 42/716 (5%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
            KVNRD F+KLASDL EERL AAV +IKDLSALE+P + EEW+Y +NRL+KGL S RNSA
Sbjct: 3   GKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRNSA 62

Query: 62  RLGFSMCLSEALNLALSL-GDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXX--XX 118
           RLGFS+CL+E +NLA+++   + P+GL S+ ++L  L+  L  +                
Sbjct: 63  RLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDERG 122

Query: 119 ILFGKLFGLQALLNEPLFSNVFV--TKDGISNFVPVFVQEMINLSKCKNWIREPALFSLY 176
           ILFGKLFGL++LLNEPLFS +FV   K G + F+  F++++I+L+  KNWI+EP L+SL+
Sbjct: 123 ILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYSLF 182

Query: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQ 236
           QT++ L+  +++S    ++   D+ +LT+TNEGL+ YLLL  ES+K      + + L+N 
Sbjct: 183 QTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKYESDK--DLVPSTLGLKNL 240

Query: 237 GWKSNDPLAKGNLPSLTKVLLDN----DGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLS 292
           GWK+NDPLA+GNLP LTKVL D+    D    A+DN  +KQK   NWNPRLHFVW  LL 
Sbjct: 241 GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDN-TKKQK-NTNWNPRLHFVWNILLP 298

Query: 293 TIINGSHSL-NVEDKHVSKKRKKNNTI---ASIKFHEFWQMVVDETYFNDKASSERKYLG 348
               GS  L N E  H+SKKRKK +     +SI+F EFWQM VDE++FN+KASSERKYLG
Sbjct: 299 LF--GSGKLENAE--HISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSERKYLG 354

Query: 349 FLIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCEND-T 407
           FLI    F  +     +     +N +R+LINQ  + +R LNKIA  T++ I+++CE D  
Sbjct: 355 FLIIDATFKTVPG-SCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPV 413

Query: 408 TKILPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEE 467
            K++P    + FG  GSI FD             IK +   VL++LF++   QL  K ++
Sbjct: 414 NKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQLQEKKDD 473

Query: 468 KSFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF---TGDNET--LQEMSKER 522
              + F+LDS+LH++R  KAE++ + + + VL  IV +AFF   T D E+  L E++KER
Sbjct: 474 LPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKER 533

Query: 523 LFXXXXXXXXXXXXXXXXIP----QYVVIKLVQQHIEGGEK--MTSELDDELRETESSAL 576
           L+                      Q++ ++L+   +E   K  +T+ LD+ L +T++ A+
Sbjct: 534 LYSILGELTINKEMRSEDPQINSWQFLTLRLILD-MEKSHKGDLTNPLDEGLEKTKNEAI 592

Query: 577 RILAEIAKA-TDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXX 635
             L EI+K+ T + +  GL +L + CL+QLY G+++S+  ++EL +  +    D+     
Sbjct: 593 SSLTEISKSNTSQSW--GLSTLLSMCLIQLYAGETDSISVIEELCEFAK----DENSSMV 646

Query: 636 XXXXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQL 691
                                  +W+Q +  V   E          RENKQGFA L
Sbjct: 647 GITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQGFALL 702

 Score =  199 bits (506), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 164/272 (60%), Gaps = 10/272 (3%)

Query: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXXXXX 812
            V NIDKE TSAL KAL+LP +I+N  GEVD+++                           
Sbjct: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISDDGDGGDDDEDEESMDDEKMME 810

Query: 813  ---XXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKM-IQ 868
                  EIFKRRKEALS+I TGN+RK EVKESRE+VIAFKHRIVD+L +Y+KH EK+ I 
Sbjct: 811  LDDQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIA 870

Query: 869  REDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIK-LD- 926
             +          L+ L+ F IPMIKCIK+T                 FKIR +  K LD 
Sbjct: 871  NKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDK 930

Query: 927  TADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVD-NADYQQGVYETLVDT 985
            T ++++  +  H++ L +KPGQ   +++S CS++SL+ SK+ VD N + +   ++ L+D 
Sbjct: 931  TIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGNDK---FDDLIDL 987

Query: 986  YSTTIKEWLKDTKFPHSIFLDFVNWLASKKQG 1017
            Y++T K+W +  KF  +IF+DF+NWL+SKK+G
Sbjct: 988  YASTTKQWTQKGKFGANIFIDFINWLSSKKEG 1019

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
           YEL055C (REAL)
          Length = 1019

 Score =  456 bits (1172), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 291/714 (40%), Positives = 412/714 (57%), Gaps = 37/714 (5%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
            KVNRD F+KLASDL EERL AAV +IKDLSALE+P + EEW+Y +NRL+KGL S RNSA
Sbjct: 3   GKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRNSA 62

Query: 62  RLGFSMCLSEALNLALSL-GDKAPEGLNSIENYLKILNETLG--ADFXXXXXXXXXXXXX 118
           RLGFS+CL+E +NL +++   + P+GL S   +L  L+  L    +              
Sbjct: 63  RLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDERG 122

Query: 119 ILFGKLFGLQALLNEPLFSNVFV--TKDGISNFVPVFVQEMINLSKCKNWIREPALFSLY 176
           ILFGKLFGL++LLNEPLFS +FV   K G + FV  F++++I+L+  KNWIREP LFSL+
Sbjct: 123 ILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFSLF 182

Query: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQ 236
           QT++ L+  +++S    ++   D+ +LT+TNEGL+ YL+L  ES++      + + L+N 
Sbjct: 183 QTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDE--SLIPSTLDLRNS 240

Query: 237 GWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQ-RKQKGGANWNPRLHFVWEKLLSTII 295
           GWK+NDPLA+GNLP LTKVL D+  +       Q  K++  ANWNPRLHFVW+ LL    
Sbjct: 241 GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLF- 299

Query: 296 NGSHSL-NVEDKHVSKKRKKNNTIA---SIKFHEFWQMVVDETYFNDKASSERKYLGFLI 351
            GS  L N E  H++KKRKK +      SI+F EFW+M VDE++FN+KASSERKYLGFLI
Sbjct: 300 -GSGKLENTE--HITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLI 356

Query: 352 FQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT-KI 410
               F  +     +     QN +R+LINQ  + +R LNKIA  T+E IV++CE D   K+
Sbjct: 357 IDATFKTVPG-SCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKL 415

Query: 411 LPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEKSF 470
           +P    + FG  GSI FD             IK +   VL++L      QL  K  +   
Sbjct: 416 VPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPH 475

Query: 471 SQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDN-----ETLQEMSKERLFX 525
           + FILDS+LH++R  K E++ + + + VL  I+ +AFF         E L E++KERL+ 
Sbjct: 476 THFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYS 535

Query: 526 XXXXXXXXXXXXXXXIP----QYVVIKLVQQHIEGGEK--MTSELDDELRETESSALRIL 579
                                QY+ + L+   IE   K  + + LD+ L + ++ A+  L
Sbjct: 536 ILGELTINKEVNSEDPQINSWQYLTLNLILD-IEKSYKADLINPLDESLEKIKNEAISSL 594

Query: 580 AEIAKA-TDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXXXX 638
           AEI+K+ T + +  GL +L + CL+QLY G+++S+  ++EL +  +     D        
Sbjct: 595 AEISKSNTTQSW--GLSTLLSMCLIQLYAGETDSISVIEELCEFTKH----DNNSMVGIT 648

Query: 639 XXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                               +W+Q +  V  +E         ARENKQGFAQLF
Sbjct: 649 EILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF 702

 Score =  187 bits (476), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 153/270 (56%), Gaps = 6/270 (2%)

Query: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXX 809
            N+ V NIDKE T AL KAL LP +I+N  GEVD+ +                        
Sbjct: 747  NEDVVNIDKEATGALIKALHLPDNIVNDKGEVDMNQ-LGGLSDDDDDEDEESMDDEKMME 805

Query: 810  XXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQR 869
                  EIFKRRKEALSNI TGN+RK EVKESRE+VI+FKHRIVD+L VY+K+ EK+   
Sbjct: 806  LDDQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIA 865

Query: 870  EDVDENSKAD-KLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIKL--D 926
              V+ +S  +  L+ L+ F +PM+KCI++T                 FKI+    K+   
Sbjct: 866  NKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKILDK 925

Query: 927  TADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTY 986
              +++   +  H+  L +KPGQ   +++S CS++SL+ SK+  +         + L+D Y
Sbjct: 926  NIELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGG--NNALDELIDLY 983

Query: 987  STTIKEWLKDTKFPHSIFLDFVNWLASKKQ 1016
            + T KEW+   KF  ++F+DF NWL+SKKQ
Sbjct: 984  AATTKEWMLKGKFSTNVFIDFTNWLSSKKQ 1013

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
           YEL055C (REAL)
          Length = 1020

 Score =  453 bits (1166), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 289/714 (40%), Positives = 416/714 (58%), Gaps = 39/714 (5%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
            KVNRD F+KLASDL EERL AAV +I+DLSAL +P + EEW Y +NRLVKGL S RNSA
Sbjct: 3   GKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRNSA 62

Query: 62  RLGFSMCLSEALNLALSL-GDKAPEGLNSIENYLKILNETLGADFX--XXXXXXXXXXXX 118
           RLGFS+CL+E +NLA+++   + P+GL S  ++L  L+  L  +                
Sbjct: 63  RLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGKKSVKGKDERG 122

Query: 119 ILFGKLFGLQALLNEPLFSNVFVT--KDGISNFVPVFVQEMINLSKCKNWIREPALFSLY 176
           ILFGKLFGL++LLNEPLFS +F+   ++G ++F   F +E+I+L+  KNWI+EP  F+L+
Sbjct: 123 ILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFFTLF 182

Query: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQ 236
           QT++ L+  + +S    ++   D+ N+T+TNEGL+ YLLL    +K      + + L+N 
Sbjct: 183 QTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYGGDK--NLIPSTLDLKNL 240

Query: 237 GWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQR--KQKGGANWNPRLHFVWEKLLSTI 294
           GWKS+DPLA+GNLP LTKVL D+  V    D + R  K++   NWNPRLHFVW+ LL   
Sbjct: 241 GWKSDDPLARGNLPLLTKVLRDS-SVIPDTDGKSRDTKKQKNTNWNPRLHFVWDILLPLF 299

Query: 295 INGSHSL-NVEDKHVSKKRKKNNTIA---SIKFHEFWQMVVDETYFNDKASSERKYLGFL 350
             GS  L N E  HVSKKRKK +T     SI+F EFW+M +DE++FN+KASSERKYLGFL
Sbjct: 300 --GSGKLENTE--HVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERKYLGFL 355

Query: 351 IFQRAFPMLK-SYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCEND-TT 408
           I   AF  +  SY  +     QN +R+LINQ  + +R LNKIA  T+  IV++CE D T 
Sbjct: 356 IIDAAFKTVPGSY--IGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEEDLTN 413

Query: 409 KILPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEK 468
           K++P   ++ FG  GS+ FD             IK +   VL++L ++   QL     + 
Sbjct: 414 KLVPCLNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSKRDL 473

Query: 469 SFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF---TGDN--ETLQEMSKERL 523
           + + FILDS+LH++R  K E+D + + + +L  I+ +AFF   T D   E L E++KERL
Sbjct: 474 THTHFILDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATDDQELEQLHELAKERL 533

Query: 524 FXXXXXXXXXXXXXXXXIP----QYVVIKLVQQHIEGGEK--MTSELDDELRETESSALR 577
           F                      Q++ +KL+   +E   +  + + LD+ L +T+  A+ 
Sbjct: 534 FSILGELTMNKEIHSEDPEINSWQFLTLKLILD-MEKSHRGILINPLDENLEKTKEEAIS 592

Query: 578 ILAEIAKATDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXXX 637
            LAEI++++      GL +L + CL+QLY G+++S+  ++EL +  +    D        
Sbjct: 593 SLAEISRSSTAQAW-GLSTLLSMCLIQLYAGETDSISVIEELCEFSK----DKNNSMVGI 647

Query: 638 XXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQL 691
                                +W+Q +  V  +E         ARENKQGFAQL
Sbjct: 648 TEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQGFAQL 701

 Score =  204 bits (518), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 159/267 (59%), Gaps = 5/267 (1%)

Query: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXXXXX 812
            V NIDKE TSAL KAL+LP +I+N  GEVDI++                           
Sbjct: 750  VVNIDKEATSALVKALNLPDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDG 809

Query: 813  XXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKM-IQRED 871
               EIFKRRKEALSNI TGN+RK EVKESRE+VI+FKHRIVD+L VY+K+ EK+ +  + 
Sbjct: 810  QLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLALANKS 869

Query: 872  VDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIK-LD-TAD 929
             D +S    L+ L+ F IP++KCI +T                 FKI+V   K +D   +
Sbjct: 870  EDSSSIGSPLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFKIKVNAFKEMDKNIE 929

Query: 930  VVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYSTT 989
            V++  +  H+  L +KPGQ P ++YS CS++SL+ SK+ V+   +     + L+D Y+ T
Sbjct: 930  VMDLLKSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVE--IHGNDKLDELIDLYAAT 987

Query: 990  IKEWLKDTKFPHSIFLDFVNWLASKKQ 1016
             KEW    KF  ++F+DF+NWL+SKKQ
Sbjct: 988  TKEWTNRGKFGANVFIDFINWLSSKKQ 1014

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
           POL5DNA Polymerase phi; has sequence similarity to the
           human MybBP1A and weak sequence similarity to B-type DNA
           polymerases, not required for chromosomal DNA
           replication; required for the synthesis of rRNA
          Length = 1022

 Score =  449 bits (1156), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 287/715 (40%), Positives = 410/715 (57%), Gaps = 39/715 (5%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
            KVNRD F+KLASDL EERL AAV +IKDLSAL++P + EEW+Y +NRL+KGL S RNSA
Sbjct: 3   GKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRNSA 62

Query: 62  RLGFSMCLSEALNLALSL-GDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXX--XX 118
           RLGFS+CL+E +NLA+++   + P+GL S   +L  L+  L  +                
Sbjct: 63  RLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDERG 122

Query: 119 ILFGKLFGLQALLNEPLFSNVFVT--KDGISNFVPVFVQEMINLSKCKNWIREPALFSLY 176
           ILFGKLFGL++LLNEPLFS +FV   + G + F   F +++I+L+  KNWI+EP  F+L+
Sbjct: 123 ILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFTLF 182

Query: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQ 236
           QT++ L+  + +S    ++   D+ +LT+TNEGL+ YLLL  E ++     + ++K  N 
Sbjct: 183 QTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLK--NP 240

Query: 237 GWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDN--EQRKQKGGANWNPRLHFVWEKLLSTI 294
           GWK NDPLA+GNLP LTKVL ++  +  A     E +KQK   NWNPRLHFVW  LL   
Sbjct: 241 GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQK-NTNWNPRLHFVWSVLLPLF 299

Query: 295 INGSHSLNVEDKHVSKKRKKNNTIA---SIKFHEFWQMVVDETYFNDKASSERKYLGFLI 351
            NG         H+SKKRKK N      SI+F EFW+M VDE++FN+KASSERKYLGFLI
Sbjct: 300 GNGKLE---NTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLI 356

Query: 352 FQRAFPMLK-SYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT-K 409
              AF  +  SY  +     QN +R+LINQ  + +R LNKI+  T++ IV++CE D+  +
Sbjct: 357 IDAAFKAVPGSY--IGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANR 414

Query: 410 ILPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEKS 469
           ++P    + FG  GSI FD             IK +   VL++L D+   QL  K    S
Sbjct: 415 LVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQDKKGVLS 474

Query: 470 FSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF--TGDN---ETLQEMSKERLF 524
            + F LDS+LH+VR  K E++ + + + VL  IV +AFF  T D+   E L E++KERL+
Sbjct: 475 HTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLY 534

Query: 525 XXXXXXXXXXXXXXXXIP----QYVVIKLVQQHIEGGE--KMTSELDDELRETESSALRI 578
                                 QY+ +KL+   IE      + + LD+ L   ++ A+  
Sbjct: 535 SILGELTINKEIRCKDPEINSWQYLTLKLILD-IENSHVGDLINPLDENLENIKNEAISC 593

Query: 579 LAEIAKA-TDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXXX 637
           L+++ ++ T + +  GL +L + CL+QLY GD++S+  ++EL +  +     +       
Sbjct: 594 LSKVCRSRTAQSW--GLSTLLSMCLVQLYAGDTDSISVIEELCEFSKH----ENNSMVGI 647

Query: 638 XXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                                +W+Q +  V  +E         ARENKQGFAQLF
Sbjct: 648 TEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGFAQLF 702

 Score =  197 bits (501), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 108/265 (40%), Positives = 158/265 (59%), Gaps = 5/265 (1%)

Query: 755  NIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 814
            NIDKE TSAL KAL+LP +I+N  GEVD+++                             
Sbjct: 754  NIDKEATSALVKALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKMMELDDQL 813

Query: 815  XEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKM-IQREDVD 873
             EIFKRRKEALS+I TGN+RK EVK+SRE+VI+FKHR+VD+L VY+K+ EK+ +  +   
Sbjct: 814  SEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEH 873

Query: 874  ENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIKLDTADV--V 931
             N+    L+ L+ F IPM+KC+ +T                 FKI+VT  K    D+  +
Sbjct: 874  SNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIELM 933

Query: 932  EDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYSTTIK 991
            +  ++ H+  L +KPGQ   ++YS+CS++SL+ SK+ V+     +   + L+D Y+ T K
Sbjct: 934  DLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDK--LDELIDLYTATTK 991

Query: 992  EWLKDTKFPHSIFLDFVNWLASKKQ 1016
            EW++  K   +IF+DF+NWL+SKKQ
Sbjct: 992  EWMQKGKCGPNIFIDFINWLSSKKQ 1016

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  417 bits (1071), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 258/706 (36%), Positives = 382/706 (54%), Gaps = 39/706 (5%)

Query: 3   KVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIE-EWNYTINRLVKGLGSSRNSA 61
           +V+RD FYKLASD+PEER+ + VGV+ +L  L V  E E EW Y ++RLVKGL S+RNSA
Sbjct: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 62  RLGFSMCLSEALNLALSLG-DKAPEGLNSIENYLKILNETLG----ADFXXXXXXXXXXX 116
           RLGFSMCL+EAL+L LS    + P  L  + +YLK ++                      
Sbjct: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDE 121

Query: 117 XXILFGKLFGLQALLNEPLFSNVFVTKDGISNFVPVFVQEMINLSKCKNWIREPALFSLY 176
              LFG+LF  + LLNEPLFS +F  K     F+  F + +I L   KNW+ EP  FSLY
Sbjct: 122 RGTLFGRLFAYKVLLNEPLFSLLFDQK-----FLIEFQERVIQLGSMKNWLLEPCFFSLY 176

Query: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQ 236
           Q +EKL+  + +      ++Q+DE+ LTMTNEGL++YLLL        +  +++  L+N 
Sbjct: 177 QAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA------KKFTLSDFTLENS 230

Query: 237 GWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTII- 295
            WK+NDPL KGNL  + KV+LD + V  A  N  +      NW PRLH++W+ +L     
Sbjct: 231 AWKANDPLQKGNLSVMAKVMLDTN-VDGANSNTNK------NWAPRLHYIWDIILREFFD 283

Query: 296 NGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQRA 355
           N  H  + +  +  KK  K+     ++F  FWQ VVDE++FNDKAS ERKY G+LIFQ+A
Sbjct: 284 NEQHGSDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKA 343

Query: 356 FPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKILPVFE 415
              + + E V     QN +RS+INQ S+ KR LNK++ +T+  +V  CE++  K+ PV  
Sbjct: 344 VESVPASE-VEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVLT 402

Query: 416 TLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQ--- 472
            L F + GS+ FD              K   +  L+ L  + + +L++  +     +   
Sbjct: 403 ALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNP 462

Query: 473 ---FILDSMLHLVRNQKA--EVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFXXX 527
              FILDS+L+L+R+QKA  E D  ++ E +L   ++LAFF  DNE +  ++KERL    
Sbjct: 463 RLKFILDSLLNLIRSQKALLETDKEIVME-ILESTIQLAFFQKDNEYINNIAKERL-SSM 520

Query: 528 XXXXXXXXXXXXXIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKATD 587
                         P Y+ ++++    E  E +   LDD L   ++ +L IL +I++   
Sbjct: 521 LAELIVLPSTDGSWP-YLALEIIVTK-EKSETLIDSLDDSLVAVKAESLDILKKISELKS 578

Query: 588 K-PYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXXXXXXXXXXXX 646
           K   L G+ SL +  L+QLY+GD+ES+G +++L   Y +  + +                
Sbjct: 579 KSSQLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFTGVTEILLSLLA 638

Query: 647 XXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                       VWEQ +  + ++E         ARENK+GF+ LF
Sbjct: 639 QRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684

 Score =  184 bits (468), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 112/281 (39%), Positives = 153/281 (54%), Gaps = 14/281 (4%)

Query: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXX 809
            ++ ++ IDKETTSALAKAL+LP +IIN NGEV+I                          
Sbjct: 741  DEKISQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDD 800

Query: 810  XXXXX-----XEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVE 864
                       EIFKRRK+ALS + TGN+RK +VKESRE+VIAFKHRI+D+L +YIKH+E
Sbjct: 801  EKMMELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIE 860

Query: 865  KM-IQRED----VDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIR 919
            ++ + R D    V        L  +L        C++QT                  KIR
Sbjct: 861  QLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIR 920

Query: 920  VTGIK-LDTA-DVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNA--DYQ 975
             T  + ++T+ +++   +RIH      KPGQF   YY  CSSTSLY  + L+D      +
Sbjct: 921  FTLFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEK 980

Query: 976  QGVYETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQ 1016
              ++E LVD Y+ T K W+++ K+   IF+DF NWLASKKQ
Sbjct: 981  TKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  407 bits (1045), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 268/716 (37%), Positives = 391/716 (54%), Gaps = 45/716 (6%)

Query: 1   MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQE---IEEWNYTINRLVKGLGSS 57
           +++VNRD F+K+AS+L +ERL+AA+ +I ++S ++  +    + EW Y I RLVKGL S+
Sbjct: 7   VSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLASN 66

Query: 58  RNSARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXXX 117
           R  ARLGFSMCL+E + LAL   D  P    SI  +L  L +TL A              
Sbjct: 67  RGGARLGFSMCLTEVIALALERRDILP----SIYAFLNQLEQTLPAG---TAFKNGKEER 119

Query: 118 XILFGKLFGLQALLNEPLFSNVFVTKDGIS---NFVPVFVQEMINLSKCKNWIREPALFS 174
            +LFG++F LQ+LLNEP+FS +F++ D  S    F+  ++ ++I L+  K W+REP L+S
Sbjct: 120 GVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPCLYS 179

Query: 175 LYQTLEKLISKV--SKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIK 232
           +YQT++K  +++    + I  ++  LDE  LT+TNEGL+IYL+   + +  S + +    
Sbjct: 180 VYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMFNAQRDTYSSSLV---- 235

Query: 233 LQNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLS 292
           + N GWK+NDPL+KGN+  L  VL D   V    +    KQKG   W PRLH+VW+ LL 
Sbjct: 236 IHNSGWKNNDPLSKGNVQLLASVLKDVVPV----EKSDLKQKG--TWAPRLHYVWDILLP 289

Query: 293 TI-INGSHSLNVEDKHVSKKRKKNNTIAS------IKFHEFWQMVVDETYFNDKASSERK 345
            +  +GS   ++E  H+SKKRKKN    S      I+F +FWQ VVDE++FN+K+S+ERK
Sbjct: 290 LLEDDGSFGQSMES-HISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNERK 348

Query: 346 YLGFLIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCEN 405
           YLGFLI + A  +  S + +   L QN +R +INQ  + +R LNKI+ Q ++ IV  CE 
Sbjct: 349 YLGFLILEEAIKVC-SPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECER 407

Query: 406 DTTKILPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSI-K 464
              K++P+ E   FG++GSI FD               S+  E L  L ++L  QL   +
Sbjct: 408 SPAKVVPLVEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQDQ 467

Query: 465 SEEKSF--SQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFT-GDNETLQEMSKE 521
           S + SF  ++FI D+ LH+ R  K  ++S  + + +L  I+K AFF   DN  L E++KE
Sbjct: 468 STKDSFNLTRFIFDTFLHITRAHKTRLESHWV-KPLLSAIIKAAFFNESDNSKLSELAKE 526

Query: 522 RLFXXXXXXXXXXXXXXXXIPQYVVIKL-VQQHIEG-GEKMTSELDDELRETESSALRIL 579
           RL+                I  +  I L +   IEG G  ++ +LD++L     SA++ L
Sbjct: 527 RLYSILGELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRKSAIKSL 586

Query: 580 AEIA---KATDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXX 636
            +     K    P L GL  L +  +LQLY GD ESV  LQ+L   YE+    +      
Sbjct: 587 KQNHSDNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEE-CDKESTDLVG 645

Query: 637 XXXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                                 VWE  V  + + E         ARENKQGFA LF
Sbjct: 646 ITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGFADLF 701

 Score =  169 bits (429), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/273 (34%), Positives = 150/273 (54%), Gaps = 14/273 (5%)

Query: 752  AVNNIDKETTSALAKALDLPADIINANGEVDI------EKXXXXXXXXXXXXXXXXXXXX 805
            A+  I+KE TSALAKAL+LP  I+  +G+V +      +                     
Sbjct: 751  ALEKIEKEATSALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDDE 810

Query: 806  XXXXXXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEK 865
                      EIFKRRKEAL ++PTGNKRK EV+ESRE+VI+FKHR+VD+L +Y+K  ++
Sbjct: 811  AMMQLDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDR 870

Query: 866  MIQREDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIKL 925
             + R +    +  ++ N L +  +P++KC++ T                  K++ T  K 
Sbjct: 871  AVARNNTSIIT-VEEWNNLSSIILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAKE 929

Query: 926  D---TADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETL 982
            +   T+++    +++H+  + AKPGQF  L++S CS  SL+ SK+ + +     G +E L
Sbjct: 930  EKTVTSEIFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSG----GSHENL 985

Query: 983  VDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKK 1015
            +D Y+ T K W+KD K   + F+DF NWL +K+
Sbjct: 986  IDLYADTSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
           Ashbya gossypii ACR020C
          Length = 1027

 Score =  387 bits (993), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 272/730 (37%), Positives = 395/730 (54%), Gaps = 61/730 (8%)

Query: 1   MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNS 60
           M +VNRD FY+LASD+ EER++AAVG++ +LS +      +EW Y + RL+KGL S+R  
Sbjct: 1   MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQG 60

Query: 61  ARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXXXXIL 120
           ARLGFSMCLSE + L L  G      L S+E Y+  L E L AD              ++
Sbjct: 61  ARLGFSMCLSEVVTLGLEKGR-----LESVEVYIGQLFEKL-AD---GHVKNGKEERGLV 111

Query: 121 FGKLFGLQALLNEPLFSNVFVTKDGIS-NFVPVFVQEMINLSKCKNWIREPALFSLYQTL 179
           FGKLFGLQALLNEPLF  +F+    I   F  +F+  ++ L+  K W+REP LF+LYQ +
Sbjct: 112 FGKLFGLQALLNEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLI 171

Query: 180 EKLISKVSK-SDITNLISQLDENNLTMTNEGLAIYLLLVDE-----SNKISRAEIAEIKL 233
           EKL SK ++   +  +   LD + LT+TNEGLAIYLLL+ E     S  I    +++I L
Sbjct: 172 EKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILSKITL 231

Query: 234 QNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLST 293
           ++  WK+NDPL+KGN+  L+ VL D   +   EDN   KQKG  +W PRLHFVW+ +L  
Sbjct: 232 RS-CWKNNDPLSKGNVTILSSVLKD---IIPVEDNVM-KQKG--SWAPRLHFVWD-ILIP 283

Query: 294 IINGSHSLNVEDKHVSKKRKKNNTI------ASIKFHEFWQMVVDETYFNDKASSERKYL 347
           I+     +    +HV KKRK +         A + F EFWQ+VVDE++FN KASSERKYL
Sbjct: 284 ILCRQQEIPGAAEHVPKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYL 343

Query: 348 GFLIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDT 407
           G LI ++A   + S   V     +N +R+LINQ SE  R+L+KI+   ++ IV  CE+D 
Sbjct: 344 GLLIIEKAMQCVPS-SYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDP 402

Query: 408 TKILPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEE 467
           TK+LPV  +L FG +GSI FD             ++ ++ E L+ L  ++  ++  +S  
Sbjct: 403 TKVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSP 462

Query: 468 KSFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTG----------------- 510
            S  +++LD +LH+V+  K + D +  T+ +L  IVKL+FF                   
Sbjct: 463 VSKVRYLLDILLHIVQAHKLKAD-MFWTKPLLSSIVKLSFFNDKLSDFEDVDLDAHADAD 521

Query: 511 -DNETLQEMSKERLFXXXXXXXXXXXXXXXXIP-QYVVIKLVQQHIEGGEKMTSELDDEL 568
            +++ +  +S+ERLF                    YV +++V    E    +  +LD+EL
Sbjct: 522 AESKKIPVLSRERLFSILGQLIPTSKQNVDGPTWPYVTLQIVIAE-EHRRSLIFKLDEEL 580

Query: 569 RETESSALRILAEIAKATDK----PYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYE 624
           ++T+  AL+ + +I K + +      L GL  L    +LQ+Y+GD+ES   L+EL   Y+
Sbjct: 581 QQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYK 640

Query: 625 KLISDDERP--XXXXXXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXAR 682
            +   D +P                           VWE ++  +  DE          R
Sbjct: 641 SI---DTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVR 697

Query: 683 ENKQGFAQLF 692
           ENKQGFA LF
Sbjct: 698 ENKQGFAALF 707

 Score =  175 bits (444), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 104/270 (38%), Positives = 147/270 (54%), Gaps = 11/270 (4%)

Query: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXX 809
            N+ ++ I+KETTSALA AL LP ++I+ NG+V  E                         
Sbjct: 762  NEYIDKINKETTSALADALKLPENMIDENGDVGFEDFDDGDEEEEEEESMDDEAMMELDG 821

Query: 810  XXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQR 869
                  EIFKRRKEALS +PTGNKRK EV+ESRESVI+FKHR++D+L +Y K+V ++  +
Sbjct: 822  QLS---EIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGK 878

Query: 870  EDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIKLDTAD 929
                E SK   ++ ++    P++KCI+QT                  K+++   K    +
Sbjct: 879  SQQCEASKLLNIHSMID---PLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDE 935

Query: 930  VVE----DFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDT 985
            V E      + IH   L  KPGQF  LY+  CS++SL+  KILV      +  Y  ++D 
Sbjct: 936  VSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKP-DEVTYNRIIDI 994

Query: 986  YSTTIKEWLKDTKFPHSIFLDFVNWLASKK 1015
            YS +IK W    KF  + F+DF+NWLASK+
Sbjct: 995  YSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
           YEL055C
          Length = 1041

 Score =  386 bits (992), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 260/719 (36%), Positives = 392/719 (54%), Gaps = 40/719 (5%)

Query: 1   MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQE-------IEEWNYTINRLVKG 53
           M  VNRD FY+LASDL EERLQ+ V ++K+L  L+           ++EWNY +NRL+ G
Sbjct: 1   MQVVNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLING 60

Query: 54  LGSSRNSARLGFSMCLSEALNLALSLGDK--APEGLNSIENYLKILNETLGADFXXX--- 108
           L S+R  ARLGFS+CL+E LNLALS   K   P  L  I ++L ++++TL          
Sbjct: 61  LASNRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEP 120

Query: 109 -XXXXXXXXXXILFGKLFGLQALLNEPLFSNVFVTKDGISNFVPVFVQEMINLSKCKNWI 167
                      +LFGKLF LQ+LLN+P+F  +F  KD  +  +  F+ E+I LS  KNWI
Sbjct: 121 RKLLKGKDERGLLFGKLFALQSLLNDPIFGKIF-NKDNKA-ILFEFIYELIALSNLKNWI 178

Query: 168 REPALFSLYQTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAE 227
           +EP LF+L+  ++K+I  + +SDI  L++ L  NNLT+TNEGL+IY+ L+  +  IS  +
Sbjct: 179 KEPTLFTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIYTNPHISPED 238

Query: 228 IAEIKLQNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVW 287
           I      N  WK+NDP  K N+  L+KVLL+    + +E     K    ANW PRLH+VW
Sbjct: 239 IQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQSE-----KHTSNANWTPRLHYVW 293

Query: 288 EKLLSTIINGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYL 347
           + +L  ++N   S  + +K+ +K+RK +     IKF+EFW+ V+DE++FN+KAS ERKYL
Sbjct: 294 DVILPILLNPKSSDKLLNKNGNKRRKVSRD--RIKFNEFWRQVIDESFFNEKASHERKYL 351

Query: 348 GFLIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCE-ND 406
           GFLI Q+ FP+L +  D+      N IRS+INQ ++ KR+LNKI+ +T++ IV  C+ N 
Sbjct: 352 GFLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQSNS 411

Query: 407 TTKILPVFETLAFGK--SGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIK 464
             +++PV     F +  S SI FD             ++ +  + LSKLF + + +L   
Sbjct: 412 ELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTSKLDSF 471

Query: 465 SEEKSFSQFILDSMLHLVRNQKAE-VDSLLLTEKVLPQIVKLAFF--TGDNETLQEMSKE 521
           +      QF+LDS+LH++R+ K++ + S    + VL  I+ L FF  T D  ++  + K+
Sbjct: 472 TTTTEL-QFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKETAD-VSISNILKD 529

Query: 522 RLFXXXXXXXXXXXXXXXXIPQYVVIKLVQQHIEGGEKMTS-ELDDELRETESSALRILA 580
           RL                   QY+ + L+    E  + + + + DD L E + SA+  L 
Sbjct: 530 RLISILNDLTTVGENSSSI--QYLTLNLIVNLNEDPKNVLNFKFDDSLLEVKDSAITTLK 587

Query: 581 E-IAKATDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLIS------DDERP 633
             I  +     L+ L SL +  ++QLY  D +S+ T+Q+L D Y++  S      D  RP
Sbjct: 588 RAIEHSKRDSRLKSLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRYKSNTIMKNDKNRP 647

Query: 634 XXXXXXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                                    +WE  +  +  +E          RENK+GFA+LF
Sbjct: 648 SLGIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRENKEGFARLF 706

 Score =  173 bits (438), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/285 (38%), Positives = 155/285 (54%), Gaps = 23/285 (8%)

Query: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXX--------XXXXXXXXXXX 801
            ND +N IDKE TSALAKAL LP +IIN  GEVD+ K                        
Sbjct: 754  NDDINRIDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDES 813

Query: 802  XXXXXXXXXXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIK 861
                          +IF RRKEALSNI TGNKRK +VKESRE+VIAFKHRIVD++ VY+K
Sbjct: 814  MDDEQMMELDGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLK 873

Query: 862  HVEKMIQREDVDENSKADK-LNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRV 920
            H+E + +  +  E +  +K LN +      ++ CI+QT                 FKI++
Sbjct: 874  HIEIITKSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKL 933

Query: 921  TGIK----LDTADVVEDFQRIHQD-FLFAKPGQFPILYYSVCSSTSLYFSKILVD---NA 972
               K    L + +++E    +H +  L  K GQ+  LY+ +CS +SL++ +I  +   NA
Sbjct: 934  VEFKDCGDLTSENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTNA 993

Query: 973  DYQQGVYETLVDTYSTTIKEWLKDT--KFPHSIFLDFVNWLASKK 1015
            D    +Y++L+D Y  T K W K++  K P +IF DF NWL+SK+
Sbjct: 994  D----LYDSLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKR 1034

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL055C
           (POL5)
          Length = 1002

 Score =  383 bits (984), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 261/714 (36%), Positives = 390/714 (54%), Gaps = 43/714 (6%)

Query: 3   KVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSAR 62
           +VNRD FYKL SDL +ER+Q+A+ +I +L+ L V +  +EW Y + RLV+GL SS  SAR
Sbjct: 4   QVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNKSAR 63

Query: 63  LGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXXXXILFG 122
           LGFS+CL+E    AL  G      + S E YL+ L   L  D               LFG
Sbjct: 64  LGFSLCLTEVAAAALENGH-----IGSAEEYLERLEAALPVD----KVKNGKEERGQLFG 114

Query: 123 KLFGLQALLNEPLFSNVFVTKDG--ISNFVPVFVQEMINLSKCKNWIREPALFSLYQTLE 180
           ++FGLQA+LNEPLFS VFV  DG     F   F+Q ++ L+  K W+R+P LF+LYQ +E
Sbjct: 115 RMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIE 174

Query: 181 KLISKVSKSD-ITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQN---- 235
           +L  + + ++ +  +++ LDE+NLT T+EGLAIYL L ++  +I R  + E K+ +    
Sbjct: 175 RLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRI-LDETKIFDALPL 233

Query: 236 -QGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTI 294
            + WK+++PLAKGN  +L  VL D+  +    + +  KQKG   W PRLHFVW+ LL  +
Sbjct: 234 VKRWKADNPLAKGNAKALASVLKDDALI----EGDGPKQKG--VWTPRLHFVWDLLLPLL 287

Query: 295 ----INGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFL 350
               ++    +++  KH + K+ K+     + F EFWQ+VVDE++F++KASSERKYLG L
Sbjct: 288 AEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVL 347

Query: 351 IFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKI 410
           I ++A   + S   V D   +N +R+LINQ SE  RHL+K+++  ++ IV +CE D +K+
Sbjct: 348 IMEKAVRSVPS-SLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKV 406

Query: 411 LPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEKSF 470
           +PV   + FG +G+I FD              KS+    L++L  +L +QL  ++ + S 
Sbjct: 407 VPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLEHENTDISK 466

Query: 471 SQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTG------DNETLQEMSKERLF 524
            +FILD++LH++R  K +   L  T  +L  +V+ AFF+        +E +  +S+ERLF
Sbjct: 467 IKFILDTLLHVIRAHKWKAH-LSWTNPLLLALVRYAFFSAPSHLSEQSEEIITLSRERLF 525

Query: 525 XXXXXXXXXXXXXXXXIP-QYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIA 583
                               Y  ++L+ Q  E    +  +LD EL    S+AL+IL +I 
Sbjct: 526 SVLGELIPLSKHDMGAPSWAYATLELLLQEKE-KHPLALQLDAELETVTSNALKILRKII 584

Query: 584 KATDK-----PYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPXXXXX 638
             + K     P L GL  L +  +LQ++ GD +S  TL+EL   YE      +       
Sbjct: 585 NKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGIT 644

Query: 639 XXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                               VWE  +  V ++E         ARENK GFAQLF
Sbjct: 645 EILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLF 698

 Score =  177 bits (449), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 149/271 (54%), Gaps = 15/271 (5%)

Query: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXX 809
            ++ V  IDKE TSALA AL LP +I++ +G V  E+                        
Sbjct: 739  DEDVAKIDKEATSALAHALRLPDNILDEDGNVGFEEMDDEEEEEESMDDEAMMELDGQLS 798

Query: 810  XXXXXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQR 869
                  EIFKRRK+AL+ IPTGN+RK E KESR+SVIAFKHR+VD+L +Y K+VE+ + +
Sbjct: 799  ------EIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTK 852

Query: 870  EDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIKLDTAD 929
               ++   A     +L+ A PM+K I+QT                  K++    K  T++
Sbjct: 853  ---NKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSE 909

Query: 930  VVED-----FQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVD 984
            + E+      + +H   L  KPGQFP L++S CSSTSL+ SK+L+   D      E ++ 
Sbjct: 910  INEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKD-DPSTSEQVIG 968

Query: 985  TYSTTIKEWLKDTKFPHSIFLDFVNWLASKK 1015
             YSTT+K W    KF  + F+DF+NWLASKK
Sbjct: 969  IYSTTMKHWNVSGKFGPNFFIDFINWLASKK 999

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  381 bits (978), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 264/721 (36%), Positives = 386/721 (53%), Gaps = 51/721 (7%)

Query: 3   KVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSAR 62
           K+NRD FYKLASDL EER+QAA+ +IK+L++LE      EW Y +NRL+KGL S+RNSAR
Sbjct: 4   KINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRNSAR 61

Query: 63  LGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXXXXILFG 122
           LGFS+CL+E L++AL  G      LNSIE Y+++L  TL                 +LFG
Sbjct: 62  LGFSLCLTEVLSVALEKG-----YLNSIEEYIQLLQSTL----LKETVKNGKEERGLLFG 112

Query: 123 KLFGLQALLNEPLFSNVFVTKDGISN--FVPVFVQEMINLSKCKNWIREPALFSLYQTLE 180
           ++FGLQALLNEPL S +F+ K G  N  F+  F+ E++ ++  K WIREP LF+L+Q +E
Sbjct: 113 RMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVE 172

Query: 181 KLISKVSKS-DITNLISQLDENNLTMTNEGLAIYLLLVD----ESNKISRAEIAEIKLQN 235
           KL   ++ +  I ++   LD+N L++TNEGLAIYL L+      S  I ++ + +    N
Sbjct: 173 KLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELN 232

Query: 236 QGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTII 295
             WK+NDPL KGNLP+L+ VL D   V+  ED+   KQKG  +W PRLHFVW  +L  + 
Sbjct: 233 SQWKNNDPLTKGNLPTLSAVLKD---VSPVEDS-GLKQKG--SWAPRLHFVWNIILPILA 286

Query: 296 NGSHSLNVEDKHVSKKRKKNNT----IASIKFHEFWQMVVDETYFNDKASSERKYLGFLI 351
               +    D+H++KKRKK       +  I+F EFW+ VVDE++FN+K+S ERKYLGFLI
Sbjct: 287 RDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLI 346

Query: 352 FQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKIL 411
            + AF  +     V     +N +R+LINQ S+ KR L+KI+ + +  I+E CE+   K +
Sbjct: 347 LEAAFKQV-PLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTV 405

Query: 412 PVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQL-SIKSEEKSF 470
           P  + + F ++G+I FD               S+  + LS L D+    L    +EE + 
Sbjct: 406 PSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAAL 465

Query: 471 SQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF-TGDNETLQE------------ 517
           ++F+LDSMLH+VR  K   D   + + ++  ++ + FF T   +  QE            
Sbjct: 466 TRFLLDSMLHVVRTHKTVSDKTWV-KPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEF 524

Query: 518 MSKERLFXXXXXXXXXXXXXXXXIP-QYVVIKLVQQHIEGGEKMTSELDDELRETESSAL 576
            ++ERL+                    Y+ ++++    E  +++   LDD L + +  AL
Sbjct: 525 QARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQ-EQSKELIHPLDDGLNKIKLDAL 583

Query: 577 R----ILAEIAKATDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLI-SDDE 631
                I  E+          GL  L +  +LQ+Y GD+ES+  L++L   Y  +  S +E
Sbjct: 584 NDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEE 643

Query: 632 RPXXXXXXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQL 691
                                      VWE  V  V   E         ARENK+GF  L
Sbjct: 644 NSLIGVIEILLALLAQKKALLRRLSLLVWELFVDKVGTPELEVLFDILSARENKEGFTAL 703

Query: 692 F 692
           F
Sbjct: 704 F 704

 Score =  191 bits (486), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 153/273 (56%), Gaps = 11/273 (4%)

Query: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXX 809
            N+ +N IDKETTSALAKAL+LP  IIN NGEV+  +                        
Sbjct: 776  NEDINKIDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKM 835

Query: 810  XXX--XXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMI 867
                    +IF+RRKEALS I TGNKRK E KESRE+VIAFKH++VD+L V++K VE+  
Sbjct: 836  MELDDQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTS 895

Query: 868  QREDVDENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIKLDT 927
            + ++  E     +L  + +   P+IKC++QT                  K+++  +  D+
Sbjct: 896  KNKECGET----ELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDS 951

Query: 928  ADV----VEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLV 983
             D+    + +   +H+  L  K GQFP LY+S CS  SL+ SK+LV  A     +Y+ L+
Sbjct: 952  DDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLV-QASTNDSIYDRLI 1010

Query: 984  DTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQ 1016
            D Y +T+K+W    KF  S F DF+NWLASKKQ
Sbjct: 1011 DIYLSTMKKWFSKGKFGTSFFFDFINWLASKKQ 1043

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa]
           {ON} similar to uniprot|P39985 Saccharomyces cerevisiae
           YEL055C
          Length = 1006

 Score =  379 bits (974), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 262/722 (36%), Positives = 392/722 (54%), Gaps = 59/722 (8%)

Query: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61
           A+V+RD FYKLASDL EERLQA +G++  LS +E  +E  EW Y +NRL+KGL SSRN A
Sbjct: 4   AEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRNGA 61

Query: 62  RLGFSMCLSEALNLAL--SLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXXXXI 119
           RLG+ +CL+E +  AL  S+   A E L  + + L   N   G +              I
Sbjct: 62  RLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKE-----------ERGI 110

Query: 120 LFGKLFGLQALLNEPLFSNVFVTKDGIS-NFVPVFVQEMINLSKCKNWIREPALFSLYQT 178
           LFGKLFGLQ LLNEPLFS VF  +D I+  F+  +V  +I+++  K WIRE ++F+LYQ 
Sbjct: 111 LFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQA 170

Query: 179 LEKLISKV-SKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKIS-----RAEIAEIK 232
           +EKL   + S+  +  L++ LD   LT T+EGLA+YL L  +S   +     +  + ++K
Sbjct: 171 IEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLK 230

Query: 233 LQNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLS 292
           L N  WK+NDPL+KGNLP++   L + +    + ++   KQKG   W PRLHFVW+ +L+
Sbjct: 231 L-NSPWKNNDPLSKGNLPAIANALKEIN----SSEDLSVKQKG--IWMPRLHFVWDIILT 283

Query: 293 TIINGSHSLNVEDKHVSKKRKKNNTIA-----SIKFHEFWQMVVDETYFNDKASSERKYL 347
           +   G      EDK     +KK    +      IKF EFW+ VVDE++FN+K+SSERKYL
Sbjct: 284 SFFEGGE---YEDKASEPAKKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSSSERKYL 340

Query: 348 GFLIFQRAFPMLK-SYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCEND 406
           GFL+F++AF +   SY   +  L +N  R LINQC   +R+L+K++ + +  IV+ C+N 
Sbjct: 341 GFLVFEKAFSLAPVSYTHTL--LSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQ 398

Query: 407 TTKILPVFETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSE 466
             K  P FETLA  + GSI+FD              KS+  + L+ L ++L+  L     
Sbjct: 399 PEKTAPSFETLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLR 458

Query: 467 EKSFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF----------TGDNE-TL 515
           + S  +F+LD+MLHLVR  K+  D + L   +L  +V+  FF           GD   T+
Sbjct: 459 DHSRVRFLLDAMLHLVRAHKSAADKVWLA-PLLDSLVQQGFFELDENDRQPEVGDETFTV 517

Query: 516 QEMSKERLFXXXXXXXXXXXXXXXXI-PQYVVIKLVQQHIEGGEKMTSELDDELRETESS 574
            +++ ERL+                  P++ V  L+ +  +   K+ + +D+EL E  +S
Sbjct: 518 SKLAVERLYSILADLISADYKSEKVCWPRFTVEILMSKLKKN--KLLNPMDEELTEILNS 575

Query: 575 ALR----ILAEIAKATDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDD 630
           +++    I +E  K   +   RG   +F+  +LQ Y+G+++S+  LQ+L   ++ L  + 
Sbjct: 576 SIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENK 635

Query: 631 ERPXXXXXXXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQ 690
                                       VWE  V   SQD+         ARENK+GF++
Sbjct: 636 SGSYAGFIEILLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLEILPARENKEGFSK 695

Query: 691 LF 692
           LF
Sbjct: 696 LF 697

 Score =  157 bits (398), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/268 (37%), Positives = 144/268 (53%), Gaps = 17/268 (6%)

Query: 756  IDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 815
            IDKE TSAL KAL+LP  I+N NGEV  E                               
Sbjct: 745  IDKEATSALVKALNLPESIVNDNGEVHFEDLEDTEDEEISDEDLDDEKMMELDGQLS--- 801

Query: 816  EIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQREDVDEN 875
            EIFKRRKEALS IPTGNKRK EVKESRE+VIAFKHR+VD+L ++++  E  +++    E 
Sbjct: 802  EIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPEK 861

Query: 876  SKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIRVTGIKLDTA-DVVED- 933
            S   K+    +  +P+I C++ T                  K+++T    DT+ D +E+ 
Sbjct: 862  SVTSKII---SIILPLISCVRTTLDKPLAEKVTKLLKNKICKLKIT---TDTSLDGLEEN 915

Query: 934  -----FQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYST 988
                  + +H+  L  K GQF  LY+S CS+ S++ +K+ V  +   +  Y TL + Y  
Sbjct: 916  LFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPE-TYFTLTEVYHK 974

Query: 989  TIKEWLKDTKFPHSIFLDFVNWLASKKQ 1016
            T+ EW    KF  ++F++F+NWL+ KKQ
Sbjct: 975  TLNEWFVGGKFSANLFIEFLNWLSIKKQ 1002

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
           (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  373 bits (957), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 252/714 (35%), Positives = 376/714 (52%), Gaps = 46/714 (6%)

Query: 3   KVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSAR 62
           ++NRD FYKLASDL EERLQA + ++  LS LE  ++  EW Y ++RL+KGL SSRN AR
Sbjct: 5   EINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGAR 62

Query: 63  LGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFXXXXXXXXXXXXXILFG 122
           LGFS+CL+E + LAL  G      L  ++ Y+ +L   L  +              +LFG
Sbjct: 63  LGFSLCLTEVVALALEKG-----VLARVDQYMHLLISALSKE----NVKNGKEERGLLFG 113

Query: 123 KLFGLQALLNEPLFSNVFVTKDGISN--FVPVFVQEMINLSKCKNWIREPALFSLYQTLE 180
           KLFGLQ LLNEPLFS VF   +   N   +  ++  +I+++  K WIRE +LF+L+Q +E
Sbjct: 114 KLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVE 173

Query: 181 KLISKV-SKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKIS-----RAEIAEIKLQ 234
           KL   + S+  +  ++  LD   LT T+EGLAIYL L+   +        +  + E+ L+
Sbjct: 174 KLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLK 233

Query: 235 NQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTI 294
           N  WK+NDPL +GNLP+++  L D+     A D+    QKG   W PRLHF W+ +L T+
Sbjct: 234 NP-WKNNDPLKRGNLPAISNALKDSG----ARDDPSLTQKG--VWAPRLHFAWDIVLQTL 286

Query: 295 INGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQR 354
           ++  +S     +  SKKRKK    A IKF EFW+ VVDE++FN+K+SSERKYLG L+F++
Sbjct: 287 LHAENSEITTMQPPSKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYLGILVFEK 346

Query: 355 AFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKILPVF 414
            F  L     +     +N IR LINQC   +R+L+KI+ + +  IVE C+    K  P F
Sbjct: 347 TF-QLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSF 405

Query: 415 ETLAFGKSGSITFDXXXXXXXXXXXXGIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQFI 474
             L+FG+ G+I FD              KS+R + L  L + L   L    +E S ++FI
Sbjct: 406 VGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFI 465

Query: 475 LDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDN-----------ETLQEMSKERL 523
           LD++LHLVR  KA  D + L + VL  +V L FF                +L  ++ ERL
Sbjct: 466 LDAILHLVRAHKAHADEVWL-KPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERL 524

Query: 524 FXXXXXXXXXXXXXXXXIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIA 583
           F                   ++ ++L++      + +   +D+EL +   S++ +L+ I+
Sbjct: 525 FSILADLLTVEQDTYSVCWPFIAVQLLKTDT-NQKTLLQSMDEELGDILDSSMTVLSSIS 583

Query: 584 KATDKPYL---RGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDER--PXXXXX 638
           +  ++  L   +GL  LF+  +LQ Y G+ ES+  L++L     +   D  +  P     
Sbjct: 584 QKANEANLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEF-EDGAKSAPLAGFI 642

Query: 639 XXXXXXXXXXXXXXXXXXXXVWEQVVPYVSQDEXXXXXXXXXARENKQGFAQLF 692
                                WE  V  V++ +          RENK+GF+ LF
Sbjct: 643 EILLSLAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGFSNLF 696

 Score =  166 bits (420), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 144/267 (53%), Gaps = 10/267 (3%)

Query: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKXXXXXXXXXXXXXXXXXXXXXXXXXXX 812
            +  IDKE TSALAKAL+LP  I++  GEV  E                            
Sbjct: 745  MGKIDKEATSALAKALNLPDSIVDDKGEVRFEDLGDTDEEEEESEEDLDDEKMMELDGQL 804

Query: 813  XXXEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQREDV 872
               EIFKRRKEALS IPTGNKRK EVKESRE+VIAFKHR+VD+L + ++ +E  ++++  
Sbjct: 805  S--EIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGH 862

Query: 873  DENSKADKLNCLLTFAIPMIKCIKQTXXXXXXXXXXXXXXXXXFKIR----VTGIKLDTA 928
             E S  DK+  ++   +P++ CI+ T                  K++     T  K+D  
Sbjct: 863  IEKSVLDKVFAII---LPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKK 919

Query: 929  DVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYST 988
             V+   + +H+  L  K GQF  LY+S CS+TS++ ++++VD     +  YE L   Y  
Sbjct: 920  AVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELE-TYEELTGIYHK 978

Query: 989  TIKEWLKDTKFPHSIFLDFVNWLASKK 1015
            T+  W    KF  S+F++F+NWL+ KK
Sbjct: 979  TLDGWFVTGKFGVSMFVEFLNWLSVKK 1005

>Kwal_33.14109 s33 (531094..531480) [387 bp, 128 aa] {ON} YKR049C -
           Hypothetical ORF [contig 105] FULL
          Length = 128

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 241 NDPLAKGNLPSLTKVLL-DNDGVAFAEDNEQRKQKGGANWNPR--LHFVWEKLL 291
           N PL +  +PSL+++L  ++   AF +D E   + G   WNPR  L   WEK L
Sbjct: 62  NQPLLQSQIPSLSELLQKESSNAAFGKDLEDCVKAG--TWNPRSSLWIDWEKKL 113

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,311,757
Number of extensions: 3502151
Number of successful extensions: 12556
Number of sequences better than 10.0: 41
Number of HSP's gapped: 12618
Number of HSP's successfully gapped: 79
Length of query: 1021
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 901
Effective length of database: 39,721,479
Effective search space: 35789052579
Effective search space used: 35789052579
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)