Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B02365g8.844ON1050105051130.0
Smik_13.178.844ON1131111316400.0
NCAS0B002808.844ON1081107016290.0
TDEL0B005408.844ON1115110416180.0
KAFR0A028508.844ON1042105515690.0
KNAG0G034408.844ON1053108114520.0
ZYRO0G14256g8.844ON125987714540.0
TPHA0I002708.844ON1039103114041e-176
SAKL0D01364g8.844ON1082110612991e-161
KLTH0C03784g8.844ON997104312781e-158
Kwal_27.102398.844ON91494312541e-156
ABL122C8.844ON1043107012221e-150
Suva_13.268.844ON112262011881e-144
YML117W (NAB6)8.844ON113452611771e-142
Kpol_1068.58.844ON103248211541e-140
NDAI0E002708.844ON119852010981e-130
Ecym_46158.844ON106768310821e-129
TBLA0B032808.844ON136229610411e-121
Skud_13.248.844ON112829210201e-120
KLLA0D01485g8.844ON11516989801e-114
NCAS0H010406.183ON6291994692e-48
Kpol_1002.696.183ON5901994512e-46
NDAI0F022606.183ON6801994543e-46
KAFR0B066906.183ON5331994455e-46
KLLA0E19031g6.183ON6521994515e-46
TBLA0B052106.183ON7101994511e-45
SAKL0A05280g6.183ON5821994441e-45
Ecym_22336.183ON5762404432e-45
AFL061C6.183ON5231994374e-45
KNAG0M004306.183ON4431994325e-45
TDEL0G016206.183ON5841994371e-44
CAGL0C01419g6.183ON6391994373e-44
ZYRO0G08140g6.183ON6321994364e-44
KLTH0H04906g6.183ON5692004324e-44
Smik_6.3906.183ON6251994345e-44
Suva_16.1236.183ON5961994327e-44
YPL184C (MRN1)6.183ON6121994311e-43
Skud_16.946.183ON6141994311e-43
Kwal_27.111586.183ON5671994263e-43
TPHA0J022106.183ON5931994239e-43
ZYRO0F07238g8.670ON3892311253e-06
NDAI0E011908.670ON3582101201e-05
KAFR0A038308.670ON3742161020.002
NCAS0B061402.306ON4431881010.002
ACR135C8.670ON376213920.030
KLTH0D11088g8.670ON422215910.037
NCAS0B016008.670ON373205890.061
CAGL0H10604g2.306ON41689880.081
TBLA0C018208.670ON39467870.096
AGR390C2.306ON378135830.36
KAFR0D016608.797ON212102800.49
Suva_8.2928.670ON37069781.2
YOR242C (SSP2)8.670ON37169781.2
Suva_4.398.466ON34871781.3
Smik_15.4268.670ON37169771.6
Ecym_33442.306ON421188752.9
TDEL0A061608.670ON37868753.2
Skud_15.4098.670ON37169743.4
KAFR0G023206.104ON62079744.3
SAKL0A07370g6.104ON49081735.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B02365g
         (1050 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...  1974   0.0  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   636   0.0  
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     632   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   627   0.0  
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   608   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   563   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   564   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   545   e-176
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   504   e-161
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   496   e-158
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   487   e-156
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   475   e-150
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   462   e-144
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   457   e-142
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   449   e-140
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     427   e-130
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   421   e-129
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   405   e-121
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   397   e-120
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   382   e-114
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   185   2e-48
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   178   2e-46
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    179   3e-46
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   176   5e-46
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   178   5e-46
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   178   1e-45
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   175   1e-45
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   175   2e-45
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   172   4e-45
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   171   5e-45
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   172   1e-44
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   172   3e-44
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   172   4e-44
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   171   4e-44
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   171   5e-44
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   171   7e-44
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   170   1e-43
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   170   1e-43
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   168   3e-43
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   167   9e-43
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    53   3e-06
NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.6...    51   1e-05
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    44   0.002
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...    44   0.002
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    40   0.030
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    40   0.037
NCAS0B01600 Chr2 complement(261098..262219) [1122 bp, 373 aa] {O...    39   0.061
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...    39   0.081
TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {O...    38   0.096
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...    37   0.36 
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    35   0.49 
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    35   1.2  
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    35   1.2  
Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON} Y...    35   1.3  
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    34   1.6  
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...    33   2.9  
TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa] ...    33   3.2  
Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {...    33   3.4  
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    33   4.3  
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    33   5.6  

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score = 1974 bits (5113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 966/1050 (92%), Positives = 966/1050 (92%)

Query: 1    MTEKVKKHGRHYVPQTYYSVPDLYFXXXXXXXXXXXXXXXLMNSPYQNVPPTPFDTAYGA 60
            MTEKVKKHGRHYVPQTYYSVPDLYF               LMNSPYQNVPPTPFDTAYGA
Sbjct: 1    MTEKVKKHGRHYVPQTYYSVPDLYFPMAHAHAHAHPQPPQLMNSPYQNVPPTPFDTAYGA 60

Query: 61   SLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXXXXXGFVLQSNGNTPYMSS 120
            SLLPSHLLMGSPMISTTNLPRDNNADLLAGGY             GFVLQSNGNTPYMSS
Sbjct: 61   SLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRNSGFVLQSNGNTPYMSS 120

Query: 121  KRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKKLISPISINYRVLPSG 180
            KRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKKLISPISINYRVLPSG
Sbjct: 121  KRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKKLISPISINYRVLPSG 180

Query: 181  DDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTDTPSKDKESDKDTCCLQ 240
            DDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTDTPSKDKESDKDTCCLQ
Sbjct: 181  DDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTDTPSKDKESDKDTCCLQ 240

Query: 241  LSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXYVTDEXXXXXXXXXXXINTE 300
            LSFLSRQAALDFYNNFLQRLPD                  YVTDE           INTE
Sbjct: 241  LSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTDEDKDKDKDKDKDINTE 300

Query: 301  KRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFEKLPFLDDKDNKRYILE 360
            KRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFEKLPFLDDKDNKRYILE
Sbjct: 301  KRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFEKLPFLDDKDNKRYILE 360

Query: 361  AVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYSVNECFFVSLPGCKSQR 420
            AVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYSVNECFFVSLPGCKSQR
Sbjct: 361  AVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYSVNECFFVSLPGCKSQR 420

Query: 421  ESSTTPVLGHISTEGSKSVSEVNLANGGNTVMIDRXXXXXXXXXXXXXXXXKCLKIIRSD 480
            ESSTTPVLGHISTEGSKSVSEVNLANGGNTVMIDR                KCLKIIRSD
Sbjct: 421  ESSTTPVLGHISTEGSKSVSEVNLANGGNTVMIDRELESLSDELASLKLEEKCLKIIRSD 480

Query: 481  YPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNSGMYLHDNLTDHSSIIGSPFSNYIDPS 540
            YPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNSGMYLHDNLTDHSSIIGSPFSNYIDPS
Sbjct: 481  YPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNSGMYLHDNLTDHSSIIGSPFSNYIDPS 540

Query: 541  ISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIAAAMGGD 600
            ISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIAAAMGGD
Sbjct: 541  ISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIAAAMGGD 600

Query: 601  ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
            ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI
Sbjct: 601  ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660

Query: 661  DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720
            DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH
Sbjct: 661  DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720

Query: 721  ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHK 780
            ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHK
Sbjct: 721  ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHK 780

Query: 781  KFNNRYEGLIINYGKDRCGNINKNLIAGXXXXXXXXXXXPSYDIRIKKMEEKRKMQEDNL 840
            KFNNRYEGLIINYGKDRCGNINKNLIAG           PSYDIRIKKMEEKRKMQEDNL
Sbjct: 781  KFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKMEEKRKMQEDNL 840

Query: 841  LSQKKNSIQLDSLGISVDRTFSNESKLSGGHTTTEENGGVKQDLESNDYKSDHPQISSNG 900
            LSQKKNSIQLDSLGISVDRTFSNESKLSGGHTTTEENGGVKQDLESNDYKSDHPQISSNG
Sbjct: 841  LSQKKNSIQLDSLGISVDRTFSNESKLSGGHTTTEENGGVKQDLESNDYKSDHPQISSNG 900

Query: 901  PIGIGLSSKKSPIFDDISGSDESVISDFENSASKETSSSDRKYQTTNSRGDTFVPKTNLS 960
            PIGIGLSSKKSPIFDDISGSDESVISDFENSASKETSSSDRKYQTTNSRGDTFVPKTNLS
Sbjct: 901  PIGIGLSSKKSPIFDDISGSDESVISDFENSASKETSSSDRKYQTTNSRGDTFVPKTNLS 960

Query: 961  HAPPRAPSTINMTYKKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQ 1020
            HAPPRAPSTINMTYKKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQ
Sbjct: 961  HAPPRAPSTINMTYKKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQ 1020

Query: 1021 YLAQLQHSTFMYAANILGASVETEEDPSAP 1050
            YLAQLQHSTFMYAANILGASVETEEDPSAP
Sbjct: 1021 YLAQLQHSTFMYAANILGASVETEEDPSAP 1050

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
            (REAL)
          Length = 1131

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1113 (37%), Positives = 581/1113 (52%), Gaps = 158/1113 (14%)

Query: 43   NSPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXX 102
            NSP  N+PPTPFDTAYGASLLPSHLLMGSP +S+ N+          GGY          
Sbjct: 57   NSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNM---------QGGYSPARSSNFKR 107

Query: 103  XX-----------------------XGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNS 139
                                      G V  SN    Y   +R+S S+   S + +  N+
Sbjct: 108  KAYSRPVSNHNNYNGNNNSNQNNNNNGMVTPSN----YYRIERNSFSRNNNSTRNSTHNN 163

Query: 140  TDSSVGSHGKKKLQHKKRTPIDVTKKLI--SPISINYRVLPSGDDTYKTRSLLFENVQKN 197
                  +   ++   +     D++ +L+   P  INY++LP+GDD Y+TRSLL ENV ++
Sbjct: 164  KGCDNRNSSGRRTSTRNNIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRS 223

Query: 198  DEMLSVFMRLIINYSQVESVYVFQQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFL 257
             ++ S+ ++  +  + +ES Y+     +     E   +   L +SFL+R   L+FYNN L
Sbjct: 224  TDLHSI-VKNFVKSNTLESTYIIGNEKSDDLKDEQTSNLSIL-ISFLTRSDCLNFYNNIL 281

Query: 258  QRLPDXXXXXXXXXXXXXXXXXXYVTDEXXXXXXXXXXXINTEKRNIKRSQELLKEPALG 317
            QRL +                  Y                N E+ +I     ++   +L 
Sbjct: 282  QRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMIS-ASLH 340

Query: 318  EEIFSHDATRSIAIEFYSQVEQDALF-EKLPFLDDKDNKRYILEAVDIISAEDAADDFPA 376
             ++ + DATRSI +EF S ++   LF +KL FLD  +NKRYILE++DI++ +  ++ FP 
Sbjct: 341  HDLENKDATRSIIVEFKSPLKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPE 400

Query: 377  NYVILTFINIKMAIEVLDYLKANLMTYSVNECFFVSL-PGCKSQRESSTTPVL------- 428
            NY +LTF+NI MAIEVLDYLK       +++CF+VSL P   S   SS   +        
Sbjct: 401  NYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTH 460

Query: 429  -----------------------------GHISTEGSKSV----SEVNLANGGNTVMIDR 455
                                          H S   +++     S V+LA+  ++V ++ 
Sbjct: 461  RLSVPSVPVENNNDNNNSNNHKSNISDANTHNSNNSTRASLYGNSNVSLASLPSSVSLNE 520

Query: 456  XXXXXXXXXXXXXXXXKCLKIIRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEG--- 512
                              L+I   DY  P +  H  H+  +   S  + +    P     
Sbjct: 521  EIDILTTKLQGIQLDGTDLEINYHDYQTPTVHEHSTHL-SNVKISKTVENSRQFPHDIPS 579

Query: 513  ----NSGMYLHDNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEPIS 568
                N  M+++D+   + SI+         P  S + +    LP             PI 
Sbjct: 580  PLPLNERMFMNDSNHSNGSIVPQQLMATPSPVSSTIQMNQRVLP------------NPI- 626

Query: 569  GPPFNHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGI 628
                       TQS+E   N SA++A++MG D  NRT+YIGNINPRS+ EDICNVVRGGI
Sbjct: 627  -----------TQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGI 675

Query: 629  LQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALA 688
            LQ++K++ +KRICFVTFIEA +A QF ANSFIDPIVLHGN LRVGWG+ SGPLPKSI+LA
Sbjct: 676  LQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLA 735

Query: 689  VTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLK 748
            VT+GA+RNVYVSLPE+AFK+KFI+DP+YK+ HE   LP  EQLR+DF+TYG+IEQINYL 
Sbjct: 736  VTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLS 795

Query: 749  DSHCCWVNFINIASAIRLVEDIN-----HN-NGEEFH-----KKFNNRYEGLIINYGKDR 797
            DSHCCW+NF+NI+SAI LVE++N     HN +GE  H     KKF  RYEGL+INYGKDR
Sbjct: 796  DSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDR 855

Query: 798  CGNINKNLIAGXXXXXXXXXXXPSYDIRIKKMEEKRKMQEDNLLSQK-KNSIQLDSLGIS 856
            CGNINKNL+AG           PSY+IR+ K+EE+R+  E++   +    ++ L+SLGIS
Sbjct: 856  CGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERAFDKALNLESLGIS 915

Query: 857  VD-----------------RTFSNESKLSGGHTTTEENGGVKQDLESNDY------KSDH 893
            +D                 R   NE++       T   GG+   + S++       ++D+
Sbjct: 916  LDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLGLGVASSEVNRAASDETDY 975

Query: 894  PQISSNGPIGIGLSSKKSPIFDDISGSDESVISDFENSASKETSSSDRKYQTTNSRG--- 950
              + +        SS    I    S  + ++ S    S+S+   +S R  +  +      
Sbjct: 976  EDLFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKAEDEEDAVE 1035

Query: 951  -DTFVPKTNLSHAPPRAPSTINMTYKKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPT 1009
               F  K++L HAPPRAPST++    K +   P+    P  +     K+   +FP     
Sbjct: 1036 ISQFNHKSSLRHAPPRAPSTLSYNRSKKNET-PIRDIVPNGETTSNRKKNRGSFPRH--- 1091

Query: 1010 RPIPGSDVMAQYLAQLQHSTFMYAANILGASVE 1042
            R IPGSDVMAQYLAQ+QHSTFMYAANILGAS E
Sbjct: 1092 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1124

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1070 (38%), Positives = 583/1070 (54%), Gaps = 142/1070 (13%)

Query: 44   SPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXXX 103
            SP  NVPPTPFDTAYGA+LLPSHLLMGSP ++T       +A                  
Sbjct: 73   SPLPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSA------------------ 114

Query: 104  XXGFVLQSNGNTPY-MSSKRSSLSQAPM-------SQKRAEKNSTDSSVGSHGKKKLQHK 155
                + Q     PY M+  R+S SQ P           R + N  D +     +++  ++
Sbjct: 115  ----IFQQ----PYMMTPNRASFSQIPSMLNVGNPPSARRQGNQNDPN-----RRRSSYR 161

Query: 156  KRTP-IDVTKKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQV 214
             + P  D     + P  ++Y++LPSGDD Y+TRSLLFENV  + E L  FM   + +S +
Sbjct: 162  SKVPETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIE-LHTFMTEFVRFSPI 220

Query: 215  ESVYVFQQTDTPSKDKESDKDTC-CLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXX 273
            ESVY+    D+   DK  D   C  + LSFL+R+  L FYNN LQRL +           
Sbjct: 221  ESVYLINHHDS---DKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLR 277

Query: 274  XXXXXXXYVTDEXXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEF 333
                   Y  DE              E+ NI        + ++  E+ +  ATRSI I+F
Sbjct: 278  LSFVSIKY-QDENEE-----------EETNIVDEPSFYTKESVYFELSNPQATRSILIQF 325

Query: 334  YSQVEQDALFE-KLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEV 392
             +   +  LF+ KL FL+ ++N RYILE++D+++     ++FP +Y ILTFINI MA+E+
Sbjct: 326  KNPCSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEI 385

Query: 393  LDYLKANLMTYSVNECFFVS-LPGCKSQRESSTTPVLGHISTEGSKSVSE---------- 441
             DYLK +   Y + +C FV  +P   S   S    ++   +    +++S           
Sbjct: 386  CDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASIISKDNDNNDETLSSQQKKNDILKN 445

Query: 442  ---VNLANGGNTVMIDRXXXXXXXXXXXXXXXXKCLKII-RSDYPKPEIRSHDDHIPGST 497
               ++L +  N  + D                 + + I+  + YP+P   SHD+H+P +T
Sbjct: 446  SSIISLPSAENDQVSDEEKLDKLSEKLKSTNIEELILIVDTATYPRPSFLSHDEHLPNAT 505

Query: 498  NFSMYIFDDGMNPEGNSGMYLHDNLTDHSSII--GSPFSNYIDPSISHV----MLPNNGL 551
                       NP      Y ++   D  + +  GS  +N   P++ ++    + PN   
Sbjct: 506  ----LSLSSSSNPFEQQLPYSYEEDDDQRTNVRSGSLPANPQFPNMPNLPKGYISPN--- 558

Query: 552  PVGGFDAPGKFPIEP-ISGPPFNHTNKV---------ITQSIEDRLNTSARIAAAMGGDA 601
            P   ++ P  +P    ++ P F+  N           I++++E    T++++  ++G DA
Sbjct: 559  PNMNYNTPLMYPNGYFVNDPAFSMNNNYNNNTNYRNPISKTLEQHATTTSQVVNSLGADA 618

Query: 602  DNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFID 661
             NRT+YIGNIN RSKVEDICNVVRGGILQNVK+IE K ICF+TFIEASAA  F ANSFID
Sbjct: 619  GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678

Query: 662  PIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHE 721
            PIVLH +TL++GWGN   PLPK++ALAVTVGA+RNVYVSLPE+AFKDKFINDP+Y+EYH+
Sbjct: 679  PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738

Query: 722  RYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKK 781
            +YKLP  +QLR DF+ YG IEQINYLKDSHCCWVNF+NI++AIRLVED ++    +F +K
Sbjct: 739  KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798

Query: 782  FNNRYEGLIINYGKDRCGNINKNLIAGXXXXXXXXXXXPSYDIRIKKMEEKRKMQEDNLL 841
            FNNRY+GLIINYGKDRCGN+NK+L++             S ++++K++EEKRK   + L 
Sbjct: 799  FNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLN 858

Query: 842  SQKKNS------IQLDSLGISVDRTFSNESKLSGGHTTTEENGGVKQDLESNDYKSDHPQ 895
            S +K S       +LD+ GI +D T SN           EE+G +++    +   +D   
Sbjct: 859  SLRKTSSSDGQLSKLDAFGIGID-TVSN----------NEEDGNIEKGNTLSKIDTD--- 904

Query: 896  ISSNGPIGIGLSSKKSPIFDDISGSDESVISDFENSASKETSSSDRKYQT---TNSRGDT 952
            ++    +G  +  K   + + +  + E   +  EN +S E+S+ +    +   +  +GD 
Sbjct: 905  VNGFNALGFKIEPKHDMMNETMDNNTEGN-NTLENISSDESSNIELMISSPKESVQKGDV 963

Query: 953  FV---PKTNLSHAPPRAPSTINMTYKKI--------------SYVPPLN---GQAPKMDY 992
                 P +N  H   R  S+    YK+               ++ P      G +P +D 
Sbjct: 964  ITNQKPHSNNHHNFKRNSSSNRQRYKETDTQNTHRNNNNSNATFAPNKEFGFGISPNVDE 1023

Query: 993  PKKYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVE 1042
             +K  + HN   N +  R IPGSDVMAQYLAQLQHSTFMYAANILGAS E
Sbjct: 1024 HQKNNKKHNT--NDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAE 1071

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1104 (37%), Positives = 581/1104 (52%), Gaps = 162/1104 (14%)

Query: 45   PYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXXXX 104
            P  N PPTPFDTAYG +LLPSHLLMGSP +S+ NL +  +    A               
Sbjct: 52   PVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFQQPHHHQHAHQRLQQYSHNQSKSS 111

Query: 105  XGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRT-PIDVT 163
             G   +S G          SL+  P S+         +++ + G ++  H K     D +
Sbjct: 112  SG---RSFGKLATAYPVPPSLNSPPASR---------NALHNRGPRRGSHYKSIQSSDAS 159

Query: 164  KKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQT 223
            K+   P  + YRVLP G+D ++TRSLLFENV  + ++ S F+    NY  VESVY+F+  
Sbjct: 160  KRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHS-FVTNFTNYGPVESVYLFK-- 216

Query: 224  DTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXY-V 282
                    S+ D   + LSF S+   LDFYN+ LQRL +                  Y V
Sbjct: 217  --------SEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKV 268

Query: 283  TDEXXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQDAL 342
            +D            I+ E  +   +  +    +L  ++ +  ATRSI I F +   +D L
Sbjct: 269  SD-------TSEEDIDKEDDSKPDAFNITAAGSLRYDVINRGATRSIMITFKTPCSKDEL 321

Query: 343  FEK-LPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLM 401
             +K L FL  ++N RY+LE++D+++A++ +  FP NY +LTF+NI MA+E+LDY++ +  
Sbjct: 322  IDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQ 381

Query: 402  TYSVNECFFVSL----PGCKSQRESSTTPVLGHISTEG---SKSVSEVNLANGGNTVMID 454
               +++CFF+S+    P  K    SS +      S  G   SK+ S  +L + G+ + +D
Sbjct: 382  KLDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLD 441

Query: 455  RXXXXXXXXXXXXXXXXKCLKIIRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNS 514
            +                  L++  ++Y  P    H DH+   TN ++           + 
Sbjct: 442  QEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHL---TNVTV-----------SE 487

Query: 515  GMYLHDNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLP----------VGGFDA--PGKF 562
               L   LT     + SP     + +++  +LPN  +P          V   DA  P   
Sbjct: 488  AASLDSQLT-----MPSP----QEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAVPPSMV 538

Query: 563  PIEPISGPPFN------------HTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGN 610
            P+  +   P+             +  K ITQS++ +  TSA +A++MGG   NRTVYIGN
Sbjct: 539  PMSTMPNTPYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGN 598

Query: 611  INPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTL 670
            I+PRS+ EDICNVVRGGILQNVKF+ +KRICFVTF+EASAA QF  N+FIDPIVLHGN L
Sbjct: 599  IHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNML 658

Query: 671  RVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQ 730
            +VGWG+ SGPLPKSIALAVTVGA+RNVYVSLPE+AFKDK+I DP+Y+EY+++++LP +EQ
Sbjct: 659  KVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQ 718

Query: 731  LRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLI 790
            LR DF+ YG+IEQINYL D HCCWVNF NI++AI+LVE++ +  G  F+K    RY+GL+
Sbjct: 719  LRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLV 778

Query: 791  INYGKDRCGNINKNLIAGXXXXXXXXXXXPSYDIRIKKMEEKRKMQEDNLLSQKKNS--- 847
            I YGKDRCGN+NKN IAG           PS++IR+ KMEE+R+  E+ L  Q++N+   
Sbjct: 779  IGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEK 838

Query: 848  -IQLDSLGISVDRT------------FSNESKLSGG--HTTTEENGGVKQDLESNDY--- 889
             +Q  SLGI++D              F +E K        T E+  G + D E  +    
Sbjct: 839  FLQFGSLGITIDSNGKEDPEKVDDVDFEDEVKFDSNSPKKTVEQASGKESDQEEQELLKL 898

Query: 890  --KSDHPQ----ISSNGPIGIGLSSKK----------SPIFDDISGSDESVISDFENSAS 933
              KS   Q    + S G       + K          +    D S   E +I+  E   S
Sbjct: 899  SNKSQGAQGLNIVESQGQSTREKEATKLTRNHSENDETSAKSDASSDVELIINSPEEEES 958

Query: 934  KETSSSDRKYQTTNSR-----------GDTFVPKTN----------LSHAPPRAPSTINM 972
               S S+R ++  + R            + F   TN          L   PP AP+TI+ 
Sbjct: 959  NFKSKSNRGFRKNDRRKLANCAEGASSKERFKSTTNDVSSALSSSSLEANPPMAPATISR 1018

Query: 973  TY-----KKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPT-----------RPIPGSD 1016
             Y     ++ ++    + +    D  +  + ++ +F + Q T           + IPGSD
Sbjct: 1019 NYSLMFKQQYNHEKLRDFEGESFD-DESQQESNFDFESTQQTRRRRYPNRRHGKSIPGSD 1077

Query: 1017 VMAQYLAQLQHSTFMYAANILGAS 1040
            VMAQYLAQLQHSTF+YAANILGAS
Sbjct: 1078 VMAQYLAQLQHSTFIYAANILGAS 1101

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
            Anc_8.844 YML117W
          Length = 1042

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1055 (39%), Positives = 566/1055 (53%), Gaps = 147/1055 (13%)

Query: 44   SPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXXX 103
            SP  N PPTPFDTAYGA+LLPSHLLMGSP IS+ N+P       L   +           
Sbjct: 68   SPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPQQQYFLQQQFNTNNNNGSSTP 127

Query: 104  XXGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVT 163
               F   SN   P +SS+ S  S+   S       + +S+  ++ K+ L+          
Sbjct: 128  RKSFFKVSN--RP-ISSRSSRFSEKRKSFIINNPTTNNSNNNNNNKEILE---------- 174

Query: 164  KKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQT 223
            K    PI+I+Y +LP GDD Y+TRSLLFENV     + S     + N S +ES+Y+    
Sbjct: 175  KLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNS-IESIYL---- 229

Query: 224  DTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXYVT 283
              P+K+   D +TC + LSFLSR   LDFYNN LQRL +                  ++ 
Sbjct: 230  -VPNKN---DSNTCDIILSFLSRHICLDFYNNVLQRLKEFKK---------------HLN 270

Query: 284  DEXXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQ------V 337
             E             T + N        + P+L   I + DATRS+AIE  S       +
Sbjct: 271  SESLNLNFVSLKYNKTTRDN--------QGPSLEFNIVTRDATRSLAIELCSNENDSLIL 322

Query: 338  EQDALFEKL--PFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDY 395
            E++ LFEK+    L   +NKRY+LE++D++S + +  +F  NY IL+F+NI MAIE++DY
Sbjct: 323  EKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDY 382

Query: 396  LKANLMTYSVNECFFVSLPGC-------KSQRESSTTPVLGHISTEGSKSVSEVNLANGG 448
            ++      ++ +C FV++           S   SS T +   +S+EG+ + +       G
Sbjct: 383  IQVISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNIQSSVSSEGNNNQNNN-----G 437

Query: 449  NTVM----------------IDRXXXXXXXXXXXXXXXXKCLKIIRSDYPKPEIRSHDDH 492
            +T                  ID                   L I+  DYP+PE     DH
Sbjct: 438  STFFHKNSINSLLSSESSVSIDEEVISIADKLKGIKLKDISLDILPRDYPEPEFNFSTDH 497

Query: 493  IPGSTNFSMYIFDDGMNPEGNSGMYLHDNLTDHSSIIGSPFSNYIDP-SISHVMLPNNGL 551
            +P  T       D          +Y++D          SP    ID  + S  ML  NG 
Sbjct: 498  LPNVTISVPTQLDQIPGTPRTQEIYIND---------MSPSFEGIDMMNSSSTMLSGNGT 548

Query: 552  PVGGFDAPGKFPIEP--------ISGPPFNHTNKV--ITQSIEDRLNTSARIAAAMGGDA 601
             +   + P   P +         I   PF   + +  IT S+E++L+TSA++A+AMG DA
Sbjct: 549  FIS--NTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDA 606

Query: 602  DNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFID 661
             NRT+YIGNINPRSK EDICNVVRGGILQ++KFIE K ICFVTFIEA+AA QF AN+FID
Sbjct: 607  GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFID 666

Query: 662  PIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHE 721
            PIVLHGNTL++GWGN SGPLPKSIALAVT+GA+RNVYVSLPE+AFKDK+INDP++KEYHE
Sbjct: 667  PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726

Query: 722  RYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKK 781
            ++KLP  EQLR DF++YG  EQINYL DSHCCWVNF+NI+SAI+LVE+   N+ + F++K
Sbjct: 727  KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEAT-NDFDRFNEK 785

Query: 782  FNNRYEGLIINYGKDRCGNINKNLIAGXXXXXXXXXXXPSYDIRIKKMEEKRKMQEDNLL 841
            F+ RY GL+INYGKDRCGNINKNLIAG            +++ ++ K+EEKR+  +    
Sbjct: 786  FDERYNGLVINYGKDRCGNINKNLIAGKNSRFYKIRQ--NHNFKLSKLEEKRRDHD---- 839

Query: 842  SQKKNSIQLDSLGISVDRTFSNESKLSGGHTTTE--ENGGVKQDLESNDYKSDHPQISSN 899
             +++N  +      + + T  NES  +      E  EN G    L+S             
Sbjct: 840  -RRENGFK---HVYNDEETIYNESMETDNQHNEESKENDGKFLQLDS------------- 882

Query: 900  GPIGIGLSSKKSPIFDDISGSDESVISDFENSASKETSSSDRKYQTTNSRGDTFVPKTNL 959
              +GI L SK   I DDI  +D   +  FEN  S    + +  ++ T+   D+      +
Sbjct: 883  --LGISLESKNE-IADDI--NDALTVDQFENEKSI---TKNNGFENTSFHSDSSSDIELI 934

Query: 960  SHAPPRAPSTINMTY---KKISYVPPLNGQAPKMDYPKKYKRTHNN-------FPNQQPT 1009
             ++P    +  N      K I+     N       Y   Y +  N+           + +
Sbjct: 935  INSPNSLRTKDNDVLDSEKIINSANTTNRTGNANGYKNDYTKNRNDGMRNNRSRNRSRYS 994

Query: 1010 RPIPGSDVMAQYLAQLQHSTFMYAANILGASVETE 1044
            R IPGSDVMAQYLAQLQHSTFMYAANILGAS E E
Sbjct: 995  RTIPGSDVMAQYLAQLQHSTFMYAANILGASGEEE 1029

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1081 (37%), Positives = 540/1081 (49%), Gaps = 193/1081 (17%)

Query: 43   NSPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXX 102
            NSP  N  PTPFDTAYGA+LLPSHLLMGSP +ST NLP+                     
Sbjct: 83   NSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLPQ--------------------- 121

Query: 103  XXXGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDV 162
                        T Y + ++ S +                   ++G   + + +  P  +
Sbjct: 122  ------------TNYTAQRKGSHTGM-----------------ANGTGSMNYYRTDPQII 152

Query: 163  TKKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEM--LSVFMRLIINYSQVESVYVF 220
                  P  I+Y++LP GDD Y+TRSLL  N+   D+M  L  F+   +  + VESVY+ 
Sbjct: 153  NGLFQIPFEISYKILPKGDDLYRTRSLLLGNI---DDMVDLHTFVSKFVQNNSVESVYIT 209

Query: 221  QQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXX 280
            ++   P K            LSFLS Q  L+FYNN LQRL +                  
Sbjct: 210  KEGQQPEK--------YGFLLSFLSVQICLNFYNNVLQRLKEFK---------------- 245

Query: 281  YVTDEXXXXXXXXXXXINTEKRNIKRSQELLKEPAL----GEEIFSHD------ATRSIA 330
                E           ++  +R  K   ++ +  A     G      D      ATRSIA
Sbjct: 246  ----EQLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIA 301

Query: 331  IEFYSQ---VEQDALF-EKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINI 386
            IEF  +   + +D L  +KL FL + +N RYILE + +   +     F  NY I+TF++I
Sbjct: 302  IEFVDKDVILTRDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSI 360

Query: 387  KMAIEVLDYLKANLMTYSVNECFFVSLPGCKSQRESSTTPVLGHISTEGSKSVSEVN--- 443
             MA+E++DYLK N+    + + F+V +     Q  +++        TE ++  S  N   
Sbjct: 361  PMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKK 420

Query: 444  ----LANGGNTVMIDRXXXXXXX--------XXXXXXXXXKCLKIIRSDYPKPEIRSHDD 491
                  N     ++                            LK+   DYP+P      +
Sbjct: 421  DQEFFPNNSMLSLVSSESSTSLADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSE 480

Query: 492  HIPGSTNFSMYIFDDGMNPEG--NSGMYLHDNLTDHSSIIGSPFSNYIDPSISHV-MLPN 548
            H   S      +      P G   S +          + IGSP ++++   ++H   +PN
Sbjct: 481  H---SNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPLDLNHSNSVPN 537

Query: 549  NGLPVGGFDAPGKFPIEPI---------------SGPPFNHTNKVITQSIEDRLNTSARI 593
              LP G   A    P+ P                +G  F H    IT S+E ++ TS ++
Sbjct: 538  --LPPGFIPATPSGPMSPQQQQLFLNSQRQQRDHAGGKFAHP---ITDSLESQMKTSTQV 592

Query: 594  AAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQ 653
            A AMG D +NRT+YIGNINPRS+ EDICNVVRGGILQN+KFIE K ICF+TFIEASAA Q
Sbjct: 593  ATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQ 652

Query: 654  FCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFIND 713
            F AN+FIDPIVLHGNTL++GWG  +GPLPK IALAVT+GA+RNVY+SLPE AFKDK+I D
Sbjct: 653  FYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKD 712

Query: 714  PKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHN 773
            PK+K YHE +KLP++E LRKDF  YG IEQIN L DSHCCWVNF+NI+SAIRLVED +  
Sbjct: 713  PKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDAS-T 771

Query: 774  NGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGXXXXXXXXXXXPSYDIRIKKMEEKR 833
              + F++ F++RYEGL+INYGKDRCGNIN+NL+AG            + D+R+ ++EEKR
Sbjct: 772  KQDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGKTSKYHKKVKKHTRDVRLSQLEEKR 831

Query: 834  KMQ-------------EDNLL---------SQKKNSIQLDSLGISVDRTFSNESKLSGGH 871
            + Q             E+N           ++KK+ + LDSLGIS+    S  S +S   
Sbjct: 832  RNQDAERREMVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGISIMEVES-ASPIS--- 887

Query: 872  TTTEENGGVKQDLE--SNDYKSDHPQISSNGPIGIGLSSKKSPIFDDISGSDESVISDFE 929
                    V  DLE  +N   +D      N     G SS    I +  +  + SV    E
Sbjct: 888  -------PVMGDLEDHTNGSYTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRSV-GVLE 939

Query: 930  NSASKETSSSDRKYQTTNSRGDTFVPKTNLSH-APPRAPSTINMTYKKISYVPPLNGQAP 988
               S  +  SD++           V    +S   PP AP TI+  Y + SY    N    
Sbjct: 940  GDPSTLSPPSDKR---------KLVALHEVSSPPPPLAPDTISRQYAEASY---HNELVT 987

Query: 989  KMDYPKK-YKRTHNNFPNQQ---PTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETE 1044
              D+P   Y +  N    QQ     R IPGSDVMAQYLAQLQHSTFMYAAN+LGAS E  
Sbjct: 988  GNDHPDTGYGKAENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGT 1047

Query: 1045 E 1045
            E
Sbjct: 1048 E 1048

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/877 (38%), Positives = 484/877 (55%), Gaps = 94/877 (10%)

Query: 54  FDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXXXXXGFVLQSNG 113
           FDTAYG +LLPSHLL+GSP +S+ +L +                        G V   N 
Sbjct: 87  FDTAYGITLLPSHLLIGSPFVSSPDLFQSQQQSQHH------HHHQNHQHQIGMV---NS 137

Query: 114 NTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKL--------------------Q 153
           N  + S  +     A    K +  N++D+++ ++G  +L                    +
Sbjct: 138 NASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLSEASYPVPPPLKNPPVVARNR 197

Query: 154 HKKRTPIDVTKKLI-SPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYS 212
           H++R   +   K+   P  + YR+LP GDD Y+TRSLLFENV  + ++ S F+     Y 
Sbjct: 198 HRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYS-FVSKYSRYG 256

Query: 213 QVESVYVFQQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXX 272
            VES+Y+F       KD+ +DK    + LSFLSR+  LD YN+ LQRL +          
Sbjct: 257 PVESIYMF-------KDR-NDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSL 308

Query: 273 XXXXXXXXY----------VTDEXXXXXXXXXXXINTEKRNIKRSQ------ELLKEPAL 316
                   Y            D             +  K  +  S        +    +L
Sbjct: 309 TVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASL 368

Query: 317 GEEIFSHDATRSIAIEFYSQVEQDALF-EKLPFLDDKDNKRYILEAVDIISAEDAADDFP 375
             +I +  ATRS+A+E   + ++  L  ++L FL   +N+RY+LE++ +I+A++    FP
Sbjct: 369 QYDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFP 428

Query: 376 ANYVILTFINIKMAIEVLDYLKANLMTYS-VNECFFVSLPGCKSQRE--------SSTTP 426
            NY ILTF+NI MA+EVLDY++ N    S   +CFFVS+  C             +S TP
Sbjct: 429 KNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITP 488

Query: 427 VL----GHISTEG------SKSVSEVNLANGGNTVMIDRXXXXXXXXXXXXXXXXKCLKI 476
           V       I+T G      SK+ S  +L + G+ + +D+                  + +
Sbjct: 489 VASGGSAGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGS----HTITV 544

Query: 477 IRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNSGMYLHDNLTDHSSIIGSPFSNY 536
              +YPKP      DH+  ++       D  ++      + +     D   + G+P  + 
Sbjct: 545 AVDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQ--DSPLVGGAPPLDA 602

Query: 537 IDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKV----ITQSIEDRLNTSAR 592
           + P+ +   L +  LP+     P       I   PF   NK     ITQS++ +  TSA 
Sbjct: 603 VHPAATPA-LSSQVLPL----QPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAE 657

Query: 593 IAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAA 652
           +A +MGG   NRTVYIGNI+PRSK EDICNVVRGGILQ+++F++DK ICFVTFIEAS A 
Sbjct: 658 VANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAV 717

Query: 653 QFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFIN 712
           QF  N+FIDPIVLHGN L+VGWG+ SGPLPKS++LAVTVGA+RNVYVSLP++AFKDK+IN
Sbjct: 718 QFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYIN 777

Query: 713 DPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINH 772
           DP+Y+ Y + YKLP++EQLR DF  +G+IEQIN+L D HCCWVNF+NI+SAI+LVE+I +
Sbjct: 778 DPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKY 837

Query: 773 NNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGXXXXXXXXXXXPSYDIRIKKMEEK 832
           N+GE FHK F+NRY GLII YGKDRCGN+NKNLI+G           PSY+IR+ +MEE+
Sbjct: 838 NDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEE 897

Query: 833 RKMQEDNLLSQKKNS----IQLDSLGISVDRTFSNES 865
           RK  E+ L SQ +N+    +Q  SLGI ++   +N++
Sbjct: 898 RKKHEETLRSQNQNNDEKMLQFGSLGIHLEGNDNNKT 934

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/38 (78%), Positives = 33/38 (86%)

Query: 1009 TRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETEED 1046
             + IPGSDVMAQYLAQLQHSTFMYAANILGA+ E + D
Sbjct: 1214 AKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVD 1251

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  545 bits (1404), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 372/1031 (36%), Positives = 525/1031 (50%), Gaps = 154/1031 (14%)

Query: 54   FDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXXXXXGFVLQSNG 113
            FD AYG +LLPSH+LM SP +ST   P  +     A                 F      
Sbjct: 112  FDYAYGTTLLPSHILMNSPFVST---PNKSYLSFQASPSRGISYNRRNSNQMVFPNPPII 168

Query: 114  NTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKKLISPISIN 173
             +P++   +S  +++   +K       D+         L  +KR      ++      I+
Sbjct: 169  TSPHLVGDKSERAKSDNYEK------VDT---------LDDEKRNREVFEEESAIAYKIS 213

Query: 174  YRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTDTPSKDKESD 233
            Y++LP GDDTY TRSLLFEN+ ++ + L  F+   +NY  +ESVYV    +T     +S 
Sbjct: 214  YQILPKGDDTYHTRSLLFENINESID-LHTFIEKFVNYGLIESVYVVPSYETHQNSVKS- 271

Query: 234  KDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXYVTDEXXXXXXXX 293
                 + LSF SR   LDFYN+ LQ+L +                  Y+ +         
Sbjct: 272  -----ILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQN--------- 317

Query: 294  XXXINTEKRNIKRSQELLKEPALGE-------EIFSHDATRSIAIEFYSQVEQ--DALFE 344
                N  K N K S E  K     E       ++ +  ATRS+ IEF  +V++  D +  
Sbjct: 318  ----NINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIET 373

Query: 345  KLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYS 404
             LPFL    NKRYI+E++ I++     ++FPA+YVIL+F+NI M IEVL Y+++  ++ +
Sbjct: 374  YLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKT 433

Query: 405  VNECFFVSLPGCKSQRESSTTPVLGHISTEGSKSVSEVNLANGGNT--------VMIDRX 456
            +  C +VS    K    +S    L    T  + +   +      NT         + D  
Sbjct: 434  IKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTYTLESPINHNTEVDMNDIPSIYDEN 493

Query: 457  XXXXXXXXXXXXXXXKCLKIIRSDYPKPEIRSHDDHIPG-STNFSMYIFDDGMNPEGNSG 515
                               +  S+Y  P I    +H+P  S +    I+ + +     SG
Sbjct: 494  EIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDPMIYANPIYQSPPSG 553

Query: 516  MYLHDNLTD----HSSIIGSPFSN-YIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGP 570
             Y+ +  T      S I+   ++N  +D ++ H    NN L    ++ P           
Sbjct: 554  -YMENMWTTTPFLSSHIVHEEYANDRVDYNMKHY---NNQL----YNVP----------- 594

Query: 571  PFNHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQ 630
                    + Q+++ +  TSA +A+ MGG   NRT++IGNINPRSK EDICNV RGGI+Q
Sbjct: 595  --------LPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQ 646

Query: 631  NVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVT 690
             VK+I +K ICFV FI+  AAAQF ANSFIDPI+LH NTL++GWG+  GPLPK+I LAVT
Sbjct: 647  QVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVT 706

Query: 691  VGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDS 750
             GA+RNVYVSLPE+AFKDK+INDP YKEYH +Y LPS++QLR+DF+ +GE+EQIN+LKD 
Sbjct: 707  AGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDK 766

Query: 751  HCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGXX 810
            HCCW+NF NI SAI+LVE + + +   FH+++ NRY+GLII YGKDRCGN+NK+L++   
Sbjct: 767  HCCWINFTNIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKN 826

Query: 811  XXXXXXXXXPSYDIRIKKMEEKRKMQEDNLLSQKKNSIQLDSLGISVDRTFSNESKLSGG 870
                     PSY+IR++++EE+RK + D +       I LDSLGI               
Sbjct: 827  SRYFRKVKKPSYNIRLQQLEEERK-RNDEIKQIDNKRINLDSLGI--------------- 870

Query: 871  HTTTEENGGVKQDLESNDYKSDHPQISSNGPIGIGLSSKKSPIFDDISGSDESVISDFEN 930
              TT  N  +++D                      LS  K  +  D    +    SD ++
Sbjct: 871  --TTSPNQNIQEDE--------------------TLSLAKLKLTSDTGFKNSENESDIDD 908

Query: 931  SASKETSSSDRKYQTTNSRGDTFVPKTNLSHAPPRAPSTINMTYKKISYVPPLNGQAPKM 990
            SAS   SS+D +    NS G+ F    N      R P   N+    +   P ++    K 
Sbjct: 909  SAS--NSSTDVEL-IINSPGNGFKSHRN------RKPKPNNL---DLGERPKVDAIVFKA 956

Query: 991  DYP-------KKYKRTHN---NFPNQQPTRP------IPGSDVMAQYLAQLQHSTFMYAA 1034
            D P         Y RTHN   + P  + TR       IPGSDVM+QYLAQ+QHSTFMYAA
Sbjct: 957  DGPMAPNKLSHDYHRTHNTRVDNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAA 1016

Query: 1035 NILGASVETEE 1045
            N+L AS+E  E
Sbjct: 1017 NVLNASIEEPE 1027

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  504 bits (1299), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 374/1106 (33%), Positives = 528/1106 (47%), Gaps = 201/1106 (18%)

Query: 44   SPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXXX 103
            SP  + P TPFDT+YGA+LLPSHLLMGSP IST       NA ++  G            
Sbjct: 61   SPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQ-----NAAMMHAG--SRGLNSSQQQ 113

Query: 104  XXGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPI--- 160
               +   +NG     S K +   +   +        +           + HK++T +   
Sbjct: 114  FYHYTYSNNGKNKGSSKKNNRDKKKVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHE 173

Query: 161  DVTKKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVF 220
              ++    P  IN+++LP GDD Y TRSLL  NV  + + L  F+   + +  +ESVYV 
Sbjct: 174  TNSQPSSEPYVINFKILPKGDDEYMTRSLLLSNVNASIK-LHDFITKFVKFGPIESVYVV 232

Query: 221  -------------QQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXX 267
                         ++ +   ++++ ++    + LSFL++   LDFYNN LQ+L D     
Sbjct: 233  PEEEEEEEEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFK--- 289

Query: 268  XXXXXXXXXXXXXYVTDEXXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDATR 327
                                         I+   +++  +   L    + +++    ATR
Sbjct: 290  -----------------------------IDLNSKSLTLNFVSLTSEDIRDDVLRKGATR 320

Query: 328  SIAIEFYSQVEQDALFEKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIK 387
            SIA+EF +      L E +  L +  N R+++E +DI++ E    +F  +Y I+ FI+I 
Sbjct: 321  SIALEFKNSFTTKQL-ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISIS 379

Query: 388  MAIEVLDYLKANLMTYSVNECFFVSLPGCKSQRESSTTPVLGHISTEGSKSVSEVNLANG 447
            MA+E   YL        ++  FFV+           + P     S + S+S         
Sbjct: 380  MAVEASSYLLNWDEKLGISRLFFVTDSIINKSDYFRSAPA----SQDASRS--------- 426

Query: 448  GNTVMIDRXXXXXXXXXXXXXXXXKCLKIIRSDYPKPEIRSHDDHIPGSTNFSM------ 501
              +V ID+                + L I    YP+ EI  H  H+   T+ S+      
Sbjct: 427  --SVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHL---TSISISKPLLS 481

Query: 502  -YIFDDGMNPEGNSG---------MYLHD--NLTDHSSIIGSPF----SNYIDPSISHVM 545
                   ++ +GN           MYLHD  N T    +I S      SN++ P   + M
Sbjct: 482  SNNNSSSVSLQGNQNLTSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYYM 541

Query: 546  LPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIAAAMGGDADNRT 605
                                           K I Q+++ +L T+A++A+ MGG   NRT
Sbjct: 542  ----------------------------DVTKPIRQTLQQQLTTTAQVASNMGGGLGNRT 573

Query: 606  VYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVL 665
            VY+GNINPRSK EDICNVVRGGILQ++KF E K +CFVTFIEA+AA QF AN+ I+PIVL
Sbjct: 574  VYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVL 633

Query: 666  HGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKL 725
            HGN L+VGWG+  G L +SIALAVT+GA+RNVYVSLPEYAFKDKFI DP+++E+ E+Y+L
Sbjct: 634  HGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYEL 693

Query: 726  PSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNR 785
            PS+EQLR+DF+ +GEIEQINYL D HCCWVNF+NI SAI+LVED N  + ++FH  + +R
Sbjct: 694  PSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDR 753

Query: 786  YEGLIINYGKDRCGNINKNLIAGXXXXXXXXXXXPSYDIRIKKMEEKRKMQEDNLLSQKK 845
            Y+GLII YGKDRCGN+NKNL+A             SY IR+ K  +         +S   
Sbjct: 754  YKGLIIGYGKDRCGNVNKNLVANKKSRFFKKVKKASYKIRMHKQNKAGGSNGQEPIS--- 810

Query: 846  NSIQLDSLGISVD-RTFSNES-----------------------KLSGGHTTTEENG--- 878
             S Q ++ GI +  R   +E                        KL+ G+   E  G   
Sbjct: 811  -SFQDNAFGICISPRGIESEEVEALPDVPQNIEEEKNPQNNGLLKLANGNGIGEGLGIEF 869

Query: 879  --GVKQDLESNDYKSDHPQISSNGPIG-----------------IGLSSKKSPIFDDISG 919
              G+ ++    D K D  Q   NG  G                 +    + S   DD   
Sbjct: 870  SPGLNKEGHEGDDKFDCIQ-QENGFDGKDEDESYSSDSSDIDIIVSAPEQSSAEEDD--- 925

Query: 920  SDESVISDFENSA-----SKETSSSDRKYQTTNSRGDTF--------VPKTNLSHAPPRA 966
             D+  ++ + N        KE S +  K + T+   D +        V  T+L   PP A
Sbjct: 926  -DKRSVTSYTNGHPTNKFKKEKSRTKLKRRPTSGLTDLYSLNGFPSMVSSTSLDAVPPLA 984

Query: 967  PSTINMTYKKI------SYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQ 1020
            PST++  Y         SY       A K  +      TH+     + ++ IPGS VMAQ
Sbjct: 985  PSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGKGNTHHG--RHRKSKAIPGSQVMAQ 1042

Query: 1021 YLAQLQHSTFMYAANILGASVETEED 1046
            YLAQLQHSTFMYAANILG +    ED
Sbjct: 1043 YLAQLQHSTFMYAANILGVTNGDNED 1068

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  496 bits (1278), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 355/1043 (34%), Positives = 519/1043 (49%), Gaps = 166/1043 (15%)

Query: 49   VPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXXXXXGFV 108
             P TPFDT+YG SLLPSHLLM SP ++T  +   + +   AGG                 
Sbjct: 48   APQTPFDTSYGVSLLPSHLLMSSPFLATPGM--GSASPHRAGGSRSSHA----------- 94

Query: 109  LQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKKLIS 168
             QS+ +TP   S  + L   P ++KR  K+      GS  +     ++R           
Sbjct: 95   -QSSYHTPNFGS--TQLRMPPPTEKRNFKH------GSSYRHNSSVQQRA---------- 135

Query: 169  PISINYRVLP----SGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTD 224
               + + +LP     G D Y TRSLLF N+   D  L  F+     + +VESVY+     
Sbjct: 136  -YEVVFHILPRSADGGGDEYMTRSLLFSNLNP-DTHLHDFLTKFEKFDRVESVYLV---- 189

Query: 225  TPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXYVTD 284
                    D     + +SFL+++  LDFYN  LQ+L                        
Sbjct: 190  --------DSQQQSVLVSFLTKETCLDFYNGVLQKL-----------------------S 218

Query: 285  EXXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFE 344
            E           +N       ++   L+E  +  E+    ATRS+ +EF  +V+   L +
Sbjct: 219  EFKKELKSKELTLNFASLRDVKTGPTLQEIKI--EVLRAGATRSLILEFQDKVDLALLSK 276

Query: 345  KLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYS 404
             L F+ + +  RY++EA++I++A  ++  F  +Y I+ FI+I MA+E ++YLK+      
Sbjct: 277  SLGFIVN-EGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSN--- 332

Query: 405  VNECFFVSLPGCKSQRESSTTPVLG--HISTEGSKSVSEVNLANGGNT-VMIDRXXXXXX 461
                    L G    R  +TT   G     T  S  ++E  L+N  ++ +          
Sbjct: 333  -------KLAGLIKFRYVNTTSASGKSEFQTLSSSQLNERALSNTSDSDISGGESVASLG 385

Query: 462  XXXXXXXXXXKCLKIIRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNSGMYLHDN 521
                      + L +  + Y +P +    +H+P  T          +N +         +
Sbjct: 386  SKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVT------ISKALNSK--------SS 431

Query: 522  LTDHSSIIGSP------FSNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPF-NH 574
            L D +S   SP       +++ D S    M+    L       P  +P  PI G PF  +
Sbjct: 432  LNDLTSNTTSPQPQEVLVNDHEDSSSRGSMV---SLKQANSHGPA-YP--PIPGYPFYMN 485

Query: 575  TNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKF 634
             +K + Q+++ +  T+A++A AMGG   NRTVYIGNI+PRSK EDICNVVRGGILQ+VK+
Sbjct: 486  MSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKY 545

Query: 635  IEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGAN 694
            IE K ICFVTFIEA++A QF ANS I+PIVLHGN L+VGWG+ SG LP+SI+LAVT+GA+
Sbjct: 546  IEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGAS 605

Query: 695  RNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCW 754
            RNVYVSLPE+AFKDKFI DP+Y+E+ E+++LPS+EQL +DF+ +G+IE +N+L+D HCCW
Sbjct: 606  RNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCW 665

Query: 755  VNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGXXXXXX 814
            +NF+NI++AI+LVED N+ N + FH+KF NRY+GL I YGKDRCGN+NKNL+A       
Sbjct: 666  INFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYF 725

Query: 815  XXXXXPSYDIRIKKMEEKRKMQEDNLLSQKK---NSIQLDSLGISVDRTFSNESKLSGGH 871
                  SY+IR++K ++        +  + K     I+ D+ GISV           G  
Sbjct: 726  KKVKKASYNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISV-----------GDT 774

Query: 872  TTTEENGGVKQDLESNDYKSDHPQISSNGPIGIGLSSKKSPIFDD--------------- 916
                 +   +Q LE ++        ++ G +GI L+S      +                
Sbjct: 775  QNLVRDSDEEQKLEEDELLRLSDLNNTGGGLGISLASSTGEETNTPVSDESSKEESVSSE 834

Query: 917  -------ISGSDESVISDFENSASKETSSSDRKYQTTNSRGDTF------VPKTNLSHAP 963
                   +S    +  S  E+  +  +    R       +   F      V   +L   P
Sbjct: 835  SSDVDILVSAPGSADTSQLESKTAPRSPKQPRVLANVPEKPSAFSAIIPRVSSASLDAVP 894

Query: 964  PRAPSTINMTYKKISYVPPLNG--------QAPKMDYPKKYKRTHNNFPNQQPTRPIPGS 1015
            P APST++  Y   S      G         +P+ +  +         P ++ ++ IPGS
Sbjct: 895  PLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGS 954

Query: 1016 DVMAQYLAQLQHSTFMYAANILG 1038
            DVMAQYLAQLQHSTFMYAANILG
Sbjct: 955  DVMAQYLAQLQHSTFMYAANILG 977

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  487 bits (1254), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 323/943 (34%), Positives = 490/943 (51%), Gaps = 173/943 (18%)

Query: 169  PISINYRVLP---SGD-DTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTD 224
            P  + + +LP   +GD D ++TRSL F N+   D  L  F+     + ++ESVYV     
Sbjct: 62   PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNP-DVRLHEFLATFHKFDRIESVYVV---- 116

Query: 225  TPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXYVTD 284
                    D++   + +SFL+++  LDFYN  LQ+L +                      
Sbjct: 117  --------DREQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSL---------- 158

Query: 285  EXXXXXXXXXXXINTEKRNIKRSQELLKEPALGE---EIFSHDATRSIAIEFYSQVEQDA 341
                              +    Q++   P L E   E+    ATRS+ +EF  +++  +
Sbjct: 159  ------------------SFASPQKVESGPTLQEIKFEVLRAGATRSLGLEFKDEIDFAS 200

Query: 342  LFEKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANL- 400
            L +K  F D+    RY++E+++ ++ +  +  F +NY I+ FI+I MA+E ++YLK    
Sbjct: 201  LLKKFDFFDN-SGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTP 259

Query: 401  MTYSVNECFFV--SLPGCKSQRES-STTPVLGHISTEGSKSVS---EVNLANGGNTVMID 454
             ++ + +  +V  +    KS+ ++ S + +      E   S+S   ++ L+ G  +V   
Sbjct: 260  ESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQNDVEVQDSISSFEDITLSEGSMSV--- 316

Query: 455  RXXXXXXXXXXXXXXXXKCLKIIRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNS 514
                             K   ++ S Y  P +  H+ H                     S
Sbjct: 317  --------------ENEKAFTVLPSQYGPPVVEEHNQHC--------------------S 342

Query: 515  GMYLHDNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLP------VGGFDAPGKFPIEPIS 568
             + +   L+   S  GS  S+   P    V++ N+  P      V    A  + P  P+ 
Sbjct: 343  HITISKALSSKVSRNGSS-SSIASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPTYPVP 401

Query: 569  GPPF-NHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGG 627
            G  +    +K + Q+++ +   +A++A AMGG A NRTVYIGNI+PRSK EDICNVVRGG
Sbjct: 402  GYHYYMDMSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGG 461

Query: 628  ILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIAL 687
            ILQ+VK+IE K ICFVTFIEA++A QF ANS I+PIVLHG+ L+VGWG+ SG LP+SI+L
Sbjct: 462  ILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISL 521

Query: 688  AVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYL 747
            AVT+GA+RNVYVSLPEYAFKDKFI DP+Y+ + E++KLPS++QL  DF+T+G+IE IN+L
Sbjct: 522  AVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFL 581

Query: 748  KDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIA 807
            +D HCCW+NF+NI++AI+LVED N++N E FH+KF NRY GL I YGKDRCGN+NKNL++
Sbjct: 582  EDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGNVNKNLVS 641

Query: 808  GXXXXXXXXXXXPSYDIRIKK-----MEEKRKMQEDNLLSQKKNSIQLDSLGISV----D 858
                         SY+IR+++     +E + K  + +  S+KK  +Q+D+ GISV    D
Sbjct: 642  NKNSKYFKKVKKASYNIRLRRQQKSDIEAQAKSGKGDENSEKK--LQVDAFGISVGSQPD 699

Query: 859  RTFSNESKLSGGHTTTEENGGVKQDLESNDYKSDHPQISSNGPIGIGLSSKKSPIFDD-- 916
              +S+E                +Q +E N+        S+ G +GI +S   +   ++  
Sbjct: 700  ARYSDE----------------EQKIEENELLLLSKPNSAEGGLGISVSQDVTVTENNTA 743

Query: 917  --------------------ISGSDESVISDFENSA--SKETSSSDRKYQTTN--SRGDT 952
                                +S    +  S  E      + T++S+ K + ++  S+   
Sbjct: 744  CGGKNKTGSVSSGSSEVDILVSAPGSANTSQLEGGGPTQRTTAASNGKKERSSGVSKLHC 803

Query: 953  F------VPKTNLSHAPPRAPSTINMTYKKISYVP-----------PLNGQAPKMDYPKK 995
            F      V K +L   PP AP+ +N  Y                  P++G   K D   K
Sbjct: 804  FSEIAPRVSKASLDAVPPLAPAALNCHYNSAPRRSARKNGHDHDSNPVSGS--KSDIGSK 861

Query: 996  YKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILG 1038
              +  ++   Q+  + IPGS+VMAQYLAQLQHSTFMYAA+ILG
Sbjct: 862  STQGKSSKSRQRNAQAIPGSNVMAQYLAQLQHSTFMYAADILG 904

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  475 bits (1222), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 359/1070 (33%), Positives = 507/1070 (47%), Gaps = 173/1070 (16%)

Query: 49   VPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYXXXXXXXXXXXXXGFV 108
            VP TPFD  YGASLLPSH+LMGSP +ST   P+ +      G                  
Sbjct: 59   VPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPG------------------ 100

Query: 109  LQSNGNTPYMSSKRSSL---SQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKK 165
              S+ +  +  S RSS     Q PM +    +           +KK          VT  
Sbjct: 101  -HSSHSLHHAQSARSSFLYYPQPPMLKPIPPR-----------RKK---------SVTLN 139

Query: 166  LISPISINYRVLPSGDDTYKTRSLLFENVQK-NDEMLSVFMRLIINYSQVESVYVFQQTD 224
               P  IN+++LP G D Y TRSLL  N++   D  +  F+   + +  VES+Y+     
Sbjct: 140  HSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM---- 195

Query: 225  TPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXYVTD 284
                      D   + LSFL++   LDFYNN LQR  +                  +V  
Sbjct: 196  ---------DDNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVS-----FVCQ 241

Query: 285  EXXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQ---DA 341
            +              E    K  Q           + +  ATRS+ +EF   V++   D 
Sbjct: 242  D--------------ESSWFKYLQM---------NVVTRGATRSLTVEFEDSVKELNEDF 278

Query: 342  LFEKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLK--AN 399
            +  K P+L    ++R++LE +D+I+A      F   Y+IL FI+I MA+EV D+L+  + 
Sbjct: 279  VRLKFPWL--FCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQ 336

Query: 400  LMTYSVNECFFVSLPGCKSQRESSTTPVLGHISTEGSKSVSEVNLANGGNTVMIDRXXXX 459
                +++   FV++ G  S+            +  G +  S  +  +  +  + +     
Sbjct: 337  KRQLNISRIQFVNVNGHHSKLSDEEAAA----AANGLQQDSRTSSVSSISLSISNTADLA 392

Query: 460  XXXXXXXXXXXXKCLKIIRSDYPKPEIRSHDDHIPGST----------NFSMYIFDDGMN 509
                          L+++ S+YP P I  H +H+   T          + S+   D    
Sbjct: 393  ALFHSLDLSLDTLSLQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNAT 452

Query: 510  PEGN--------SGMYLHDNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLPVGGFDAPGK 561
              GN        SG+     + D SS   +P    I PS  ++  P  G P+ G   PG 
Sbjct: 453  NAGNHHGVSSSLSGVLF---MNDPSSSGSTPM---IVPSELNLNTPVMGGPMQGQLMPG- 505

Query: 562  FPIEPIS---------GPPFNHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNIN 612
             P +P+S         G P    + ++   I   L       A+     +NRTVYIGNI+
Sbjct: 506  -PPQPMSLHNPSDGNGGSPSYFMDPMVGAPIGQTLQRQYLAGASQANGINNRTVYIGNIH 564

Query: 613  PRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRV 672
            PRSK EDICNVVRGGILQ +K+I  KRICFVTFIE +AA QF AN+ ++PIVLHGN LRV
Sbjct: 565  PRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRV 624

Query: 673  GWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLR 732
            GWG  SG LPK+IALAVT+GA+RNVYVSLPEY+FK+K+IN+P++K YH +YKLP++EQLR
Sbjct: 625  GWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLR 684

Query: 733  KDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDIN---HNNGEEFHKKFNNRYEGL 789
            +DFT YG++EQINYL+D HCCWVNF+NIA AIRLVED N     N E+FH +F+ RY+ L
Sbjct: 685  QDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNL 744

Query: 790  IINYGKDRCGNINKNLIAGXXXXXXXXXXXPSYDIRIKKMEEKRK--MQEDNLLSQKK-- 845
            II YGKDRCGN+NKNL A             SY ++  K   K    +  D+L    +  
Sbjct: 745  IIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMKQGKQPRKEDGIVNSDDLTKNNEVL 804

Query: 846  NSIQLDSL---GISVDRTFSNESKLSGGHTTTEENGGVKQDLESNDYKSDH-PQISSNGP 901
              +Q++S    G+   ++   + +L+ G   +  +  +  D     + SD   +      
Sbjct: 805  PGVQMNSSKNGGVGESQSLVGDQELAEGLGISLTSAQISPDTGHTHHYSDGVEEGDECDD 864

Query: 902  IGIGLSSKKSPIFDDI-----------SGSDESVISDF-----ENSASKETSSSDRKYQT 945
               G S+  S   D I           SG+              N  S   SS+    Q 
Sbjct: 865  DDAGYSTSGSSDIDIIVAPPDEFKRRESGTSSGKHKKKSKSTRRNQHSNAASSASYNQQY 924

Query: 946  TNSRGDTFVPKTNLSHAPPRAPSTI--NMTYKKISYVP---------PLNGQAPKMDYPK 994
            +    D      +L   PP APS++  ++  ++  + P           N Q P     K
Sbjct: 925  SLGSLDHTSSAGSLDAPPPLAPSSMQQHLADRRPRHTPGRSTDSSASQYNSQTPTNANYK 984

Query: 995  KYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETE 1044
              +R    F     ++PI G DVM+QYL QL HSTF+YA NILGA+   E
Sbjct: 985  SRRRRQAKF-----SKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQE 1029

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
            (REAL)
          Length = 1122

 Score =  462 bits (1188), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 271/620 (43%), Positives = 359/620 (57%), Gaps = 87/620 (14%)

Query: 474  LKIIRSDYPKPEIRSHDDH-----IPGSTNFSMYIFDDGMNP-EGNSGMYLHDNLTDHSS 527
            L++   DYP P I  H  H     I  + + S     D  +P   N  M++ D+   + +
Sbjct: 532  LEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSNGT 591

Query: 528  I-----IGSPFSNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQS 582
            I     I +P     +P ++  +LPN                              ITQS
Sbjct: 592  IVSQQLITAPSPQSPNPQMNQRVLPN-----------------------------PITQS 622

Query: 583  IEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICF 642
            +E   N SA++A++MG D  NRT+YIGNINPRS+ EDICNVVRGGILQN+K+I +KRICF
Sbjct: 623  LEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICF 682

Query: 643  VTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLP 702
            VTFIEA++A QF ANSFIDPIVLHGN LRVGWG+ SGPLPKSI+LAVT+GA+RNVYVSLP
Sbjct: 683  VTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLP 742

Query: 703  EYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIAS 762
            E+AFK+KFI+DP+YK+ HE   LP  EQLR+DF+TYG+IEQINYL DSHCCW+NF+NI+S
Sbjct: 743  EFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISS 802

Query: 763  AIRLVEDIN-----HNNGEEF------HKKFNNRYEGLIINYGKDRCGNINKNLIAGXXX 811
            AI LVE++N     H++  E        +KF+ RY+GL+INYGKDRCGNINKNL+AG   
Sbjct: 803  AISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNS 862

Query: 812  XXXXXXXXPSYDIRIKKMEEKRKMQEDNLLSQKKNSIQLDSLGISVD------------- 858
                    PSY+IR+ K+EE+R+  E++        + L+SLGIS+D             
Sbjct: 863  RFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLGISLDPHKGTDIDEAEAE 922

Query: 859  ------------RTFSNESKLSGGHTTTEENGGVKQDLESNDYKSDHPQISSNGPIGIGL 906
                            NE+   GG      N  VK+ L     ++D+ +  +        
Sbjct: 923  GTTGAEVENEVEAENGNETVGLGGLGLGVVNSDVKRALSD---ETDYDEFFNKSSRSSDS 979

Query: 907  SSKKSPIFDDISGSDESVISDFENSASKETSSSDRKYQTTNSRG----DTFVPKTNLSHA 962
            SS    I    S  + ++ S    S+S+   +S R  +  N  G      F  +++L  A
Sbjct: 980  SSDIEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVENEDGLVGLSQFNHRSSLKQA 1039

Query: 963  PPRAPSTINMTYKKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQYL 1022
            PPRAPST++  + K + + P+       +      +   +FP     R IPGSDVMAQYL
Sbjct: 1040 PPRAPSTLSHNHSKKNQM-PIQDAGINAEVTDNKTKKRGSFPRH---RTIPGSDVMAQYL 1095

Query: 1023 AQLQHSTFMYAANILGASVE 1042
            AQ+QHSTFMYAANILGAS E
Sbjct: 1096 AQVQHSTFMYAANILGASAE 1115

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%)

Query: 43 NSPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNL 79
          NSP  NVPPTPFDTAYGASLLPSHLLMGSP +S+ N+
Sbjct: 57 NSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  457 bits (1177), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 260/526 (49%), Positives = 331/526 (62%), Gaps = 78/526 (14%)

Query: 579  ITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDK 638
            ITQS+E   N SA++A++MG D  NRT+YIGNINPRSK EDICNVVRGGILQ++K+I +K
Sbjct: 628  ITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEK 687

Query: 639  RICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVY 698
            +ICFVTFIEA +A QF ANSFIDPIVLHGN LRVGWG+ SGPLPK I+LAVT+GA+RNVY
Sbjct: 688  KICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVY 747

Query: 699  VSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFI 758
            VSLPE+AFK+KFI+DP+YK+ HE   LP  EQLR+DF+TYG+IEQINYL DSHCCW+NF+
Sbjct: 748  VSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFM 807

Query: 759  NIASAIRLVEDIN------HNNGE-----EFHKKFNNRYEGLIINYGKDRCGNINKNLIA 807
            NI+SAI LVE++N      + +GE        +KF  RY+GL+INYGKDRCGNINKNLIA
Sbjct: 808  NISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIA 867

Query: 808  GXXXXXXXXXXXPSYDIRIKKMEEKRKMQEDNLLSQKKNS----IQLDSLGISVDRTFSN 863
            G           PSY+IR+ K+EEKR+  E   + +K+ +    + L+SLGIS+D    N
Sbjct: 868  GKNSRFYKKVKRPSYNIRLSKLEEKRRQNE---IDEKEKAFDKPLNLESLGISLDAHKDN 924

Query: 864  ESKLSGGHTTTEENGGVKQDLESNDYKSDHPQISSNGPIGIGLSSKKSPIFDDI--SGSD 921
                 GG T T  N G + + E      +  +  S G +G+ ++S       D+  + SD
Sbjct: 925  ----GGGETGTANNTGHENESELEAENENGNETGSFGGLGLAVAS------SDVKRATSD 974

Query: 922  ESVISDFENSASKET-----------SSSDRKY----QTTNSRGDTFVP----------- 955
            E+   D  N +S  +           S SD +Y    QT  S   T +            
Sbjct: 975  ETDYEDIFNKSSGSSDSSSDVEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKIEDEE 1034

Query: 956  ----------KTNLSHAPPRAPSTINMTYKKISYVPPLNGQAPKMDYPKKYKRTHNNFPN 1005
                      +++L  APPRAPST++  + K       N + P  D       T NN   
Sbjct: 1035 EAVGMSQLNYRSSLRQAPPRAPSTLSYNHSK-------NNETPMQDIFTN-GETANNRKK 1086

Query: 1006 QQPT----RPIPGSDVMAQYLAQLQHSTFMYAANILGASVETEEDP 1047
            ++ +    R IPGSDVMAQYLAQ+QHSTFMYAANILGAS E    P
Sbjct: 1087 KRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHP 1132

 Score =  199 bits (505), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 139/390 (35%), Positives = 199/390 (51%), Gaps = 27/390 (6%)

Query: 43  NSPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNA----DLLAGGYXX---- 94
           NSP  N+PPTPFDTAYGASL PSHLLMGSP +S+ N+    N+    +L    Y      
Sbjct: 57  NSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVSN 116

Query: 95  ------XXXXXXXXXXXGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHG 148
                            G V  SN    Y    R+S S+   S +    N+       + 
Sbjct: 117 HNGYNGNSNSNQNNTNNGMVTPSN----YYRMGRNSFSRNNNSTRNVTHNNNKGCDTRNN 172

Query: 149 KKKLQHKKRTPID--VTKKLIS-PISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFM 205
             +    +    D  + + L+  P  INY+VLP+GDD Y+TRSLL ENV  + ++ S+ +
Sbjct: 173 SGRRTFARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSI-V 231

Query: 206 RLIINYSQVESVYVFQQTDTP-SKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXX 264
           +  +  + +ES Y+ +   +  SKD E+      + +SFL++   L+FYNN LQRL +  
Sbjct: 232 KNFVKSNTLESAYLIEGGKSDDSKDVETK--NLSILISFLTKGDCLNFYNNILQRLSEFK 289

Query: 265 XXXXXXXXXXXXXXXXYVTDEXXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHD 324
                           Y                N E+ +I     ++   +L   I + D
Sbjct: 290 TFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMIS-ASLHHNIANKD 348

Query: 325 ATRSIAIEFYSQVEQDALFEK-LPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTF 383
           ATRSI IEF S VE+  LF+K L FLD   NKRYILE++D+++ +  ++ FP NY +LTF
Sbjct: 349 ATRSIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTF 408

Query: 384 INIKMAIEVLDYLKANLMTYSVNECFFVSL 413
           +NI MAIEVLDYLK       +++CF+VSL
Sbjct: 409 LNISMAIEVLDYLKKYSKNLGISKCFYVSL 438

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  449 bits (1154), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 242/482 (50%), Positives = 318/482 (65%), Gaps = 52/482 (10%)

Query: 589  TSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEA 648
            TSA IA  MGG A NRTVYIGNINPRSK EDICNVVRGG LQ +KF ++K ICFVTFIEA
Sbjct: 566  TSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEA 625

Query: 649  SAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKD 708
            ++AAQF ANSFIDPI+LH NTLRVGWG+ SGPLPKSI+LAVTVGA+RNVYVSLPEYAFKD
Sbjct: 626  ASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKD 685

Query: 709  KFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVE 768
            KFINDP+YKEYH +Y LP++E+LRKDF+ +GE+EQ+N+L D HCCW+NF+NI SAI+LVE
Sbjct: 686  KFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVE 745

Query: 769  DINHNN-GEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGXXXXXXXXXXXPSYDIRIK 827
             +N +N G+ FH+++ NRY+GLII YGKDRCGN+NK+LI+G           PSY+IR++
Sbjct: 746  SVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQ 805

Query: 828  KMEEKRKMQEDNLLSQKKNSIQLDSLGISVDRTFSNESKLSGGHTTTEENGGVKQDLESN 887
            ++EE+RK +E N +S K  SI L+S GI V+    NES                      
Sbjct: 806  QLEEERKQEEKNKISNK--SINLNSFGIQVETPSQNES---------------------- 841

Query: 888  DYKSDHPQISSNGPIGIGLSSKKSPIFD--------DISGSDESVISD---FENSASKET 936
              + + P+IS +G +G+ LS   S   D            +D  +I D    EN+   + 
Sbjct: 842  --EQEEPKISLDG-LGMSLSKPNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKN 898

Query: 937  SSSDRKYQTTNSRGDTFVP----KTNLSHAPPRAPSTINMTYKK--------ISYVPPLN 984
               + +    N+  +   P    KT L  +PP AP+T++  ++K        ++ +  ++
Sbjct: 899  KKQNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMD 958

Query: 985  -GQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVET 1043
                 + D     K   +   +++  + +PGSDVM+QYLAQLQHSTFMYAANILGAS + 
Sbjct: 959  QNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDE 1018

Query: 1044 EE 1045
             E
Sbjct: 1019 PE 1020

 Score =  127 bits (318), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 91/283 (32%), Positives = 139/283 (49%), Gaps = 40/283 (14%)

Query: 170 ISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTD----- 224
            +I+Y+VLP G+D Y+TRSLLFENV K+ + L  F++  +N+  +ESVY+          
Sbjct: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVD-LHCFIKKFVNFGPIESVYLINSNGIYDNN 309

Query: 225 -------------TPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXX 271
                          + D  ++ DT  + LSFLSR   LDFYN+ LQRL +         
Sbjct: 310 KNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSND 369

Query: 272 XXXXXXXXXYVTDEXXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAI 331
                    Y   +            + E+ +   +  L    +L  +I    ATRSIA+
Sbjct: 370 LTLSFVLLKYKNQDRP----------DDEESDFSPALPL----SLEYDIIKRGATRSIAV 415

Query: 332 EFYSQVEQDALF--EKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMA 389
           EF   +     F   KL FL   +NKRYI+E+VDII+A +   + P N VILTF+NI M 
Sbjct: 416 EFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMT 475

Query: 390 IEVLDYLKANLMTYSVNECFFVSLPGCKSQRESSTTPVLGHIS 432
           ++V+D ++       +++C FV+       +E+ T P +  +S
Sbjct: 476 VDVMDRIRLERKDSGISKCVFVTF-----NKENPTVPNMKRLS 513

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%)

Query: 48  NVPPTPFDTAYGASLLPSHLLMGSPMIST 76
           N PPTPFD+AYGASLLPSHLLMGSP +ST
Sbjct: 120 NAPPTPFDSAYGASLLPSHLLMGSPFVST 148

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  427 bits (1098), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 244/520 (46%), Positives = 313/520 (60%), Gaps = 65/520 (12%)

Query: 567  ISGPPFNH--TNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVV 624
            +  P FN   T   I +++ED+ NTSA++A++MG +  NRT+YIGN+NPRSK ED+CNVV
Sbjct: 689  VEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVV 748

Query: 625  RGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKS 684
            RGGILQ++K I  KRICFVTFIEASAA QF ANSFIDP++LHGNTL++GWGN   PL KS
Sbjct: 749  RGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKS 808

Query: 685  IALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQI 744
            IALAVT+GA+RNVYVSLPE+AFKDKF+NDP+YKE+HE+YKLPS++QLR DF  YG IEQI
Sbjct: 809  IALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQI 868

Query: 745  NYLKDSHCCWVNFINIASAIRLVEDINHN-NGEEFHKKFNNRYEGLIINYGKDRCGNINK 803
            NYL DSHCCWVNF+NI SAI+LVED+N+N     F KKFN+RY+GLIINYGKDRCGN+N+
Sbjct: 869  NYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNR 928

Query: 804  NLIAGXXXXXXXXXXXPSYDIRIKKMEEKRKMQE-----------DNLLSQKKNSIQLDS 852
            NLI+             S + ++++++EKR++++           DN L        LD+
Sbjct: 929  NLISNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLP------SLDA 982

Query: 853  LGISVDRTF---------SNESKLSGGHTTTEENGGV-------------KQDLESNDYK 890
            LGI + RT          SNE   +     TE +                  D E ND K
Sbjct: 983  LGIGLQRTAPPEEQKVPESNEDDANYDSAVTESDTNTFNALGFRIQSNTDSHDDEQNDEK 1042

Query: 891  SDHPQ----ISSNGPIGIGLSSKKSPIFD-DISGSDESVISDFENSASKETSSSDRKYQT 945
             +  +    I+    I    SS    I D   + SD S+I + + +  K     DR  + 
Sbjct: 1043 GEEQEEVDVIAHADDISSVNSSDVEIIIDCPHNESDTSMIQEKKKTIRKNQQKIDRLAKA 1102

Query: 946  TNS---RGDTFVPKTNLSHAPPRAPSTINMTYKKISYVPPLNGQAPKMDYPKKYKRTHNN 1002
             N+        +P  N      R     N   ++      +  Q P +    K +R    
Sbjct: 1103 RNAMFPEHRETIPDINNKLFHDRKNKDKN---RRKQVQGGIQDQDPHLSSTGKQQRV--- 1156

Query: 1003 FPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVE 1042
                     IPG+DVMAQYL QLQHSTFMYAANILG S E
Sbjct: 1157 ---------IPGADVMAQYLTQLQHSTFMYAANILGVSAE 1187

 Score =  171 bits (433), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 136/426 (31%), Positives = 201/426 (47%), Gaps = 82/426 (19%)

Query: 44  SPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTN--LPRDNNADLLAGGYXXXXXXXXX 101
           SP  N PPTPFDTAYGA+LLPSHLLMGSP +ST N  +P       +             
Sbjct: 77  SPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMF------------ 124

Query: 102 XXXXGFVLQSNGNTPYMSSKRSSLSQ--APMSQKRAEKNSTDSSVGSHGKKKLQHKKRTP 159
                   QS   TP     R S SQ  + ++Q  +  N    S  +  +   Q   R P
Sbjct: 125 -----LYSQSPAGTP----NRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQ--TRIP 173

Query: 160 -IDVTKKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVY 218
            +D  +    P  I+Y++LP+GDD Y+TRSLLF NV  + ++ S F+   + YS +ES+Y
Sbjct: 174 EVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHS-FIYDFVQYSSIESIY 232

Query: 219 VFQQT-DTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXX 277
           +   T D   +D E+DK+   + LSFLSR+  L FYNN LQRL +               
Sbjct: 233 LISNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFV 292

Query: 278 XXXY-----------VTDEXXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDAT 326
              Y           +++            +NT + + + S   +   AL  ++ + DAT
Sbjct: 293 ILNYLEKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVN--ALKFDLINPDAT 350

Query: 327 RSIAIEFYSQVEQDALFEK-LPFL-DDKDNKRYILEAVD---IISAEDAADD-------- 373
           R I IE  ++ +++ L  K L FL D+K N RYILE++D   II  E+++++        
Sbjct: 351 RFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKN 410

Query: 374 --------------------------FPANYVILTFINIKMAIEVLDYLKANLMTYSVNE 407
                                     FP +Y +L+FINI MA+E+ DYLK N + + +  
Sbjct: 411 ENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITN 470

Query: 408 CFFVSL 413
             +V +
Sbjct: 471 ASYVQI 476

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  421 bits (1082), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 263/683 (38%), Positives = 377/683 (55%), Gaps = 109/683 (15%)

Query: 169 PISINYRVLPSGDDTYKTRSLLFENVQKNDEM-LSVFMRLIINYSQVESVYVFQQTDTPS 227
           P  +N+++LP G D Y TRSLLF N+++ +   +  F+   I +  +ES+Y+        
Sbjct: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLD------ 211

Query: 228 KDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXYVTDEXX 287
                  D+  + LSFL++   LDFYNN LQR  +                         
Sbjct: 212 -------DSHSILLSFLTKATCLDFYNNLLQRFSEFK--------------------SKL 244

Query: 288 XXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQ---VEQDALFE 344
                    +  ++ N  R         L   + +   TRS+ IEF  Q   +  D + E
Sbjct: 245 HSTKLSVSFVCQDETNWFR--------LLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHE 296

Query: 345 KLPFLDDKDNKRYILEAVDIISAEDAAD-DFPANYVILTFINIKMAIEVLDYLK--ANLM 401
           K+P+L    + R+++E +D+++A    + +F   Y+++ FI I MA+EV +YL+  +   
Sbjct: 297 KIPWL--FFSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKK 354

Query: 402 TYSVNECFFVSLPGCKS--QRESSTTPVLGHISTEGSKSVSEVNLANGGNTVMIDRXXXX 459
              +++  FV++ G  S    E +     G      + SVS ++L    ++ +++     
Sbjct: 355 QLGISKIQFVNVNGHSSDLSDEDAVAAANGLQRESRTSSVSSISLPISNSSDLVELFHSL 414

Query: 460 XXXXXXXXXXXXKCLKIIRSDYPKPEIRSHDDHIPGST----------NFSMYIFDDGM- 508
                         L++I S+YP P I SHDDH+   T          + S+   D G  
Sbjct: 415 DLALGIIS------LQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDGGPN 468

Query: 509 -------------------NPEGNSGMYLHDNLTDHSSIIGSPFSNYIDPSISHVML--P 547
                              + +GN+   L + L  ++S++  P    +  +   + L  P
Sbjct: 469 GGTPNGSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNP 528

Query: 548 NNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVY 607
           N+     G   P  F ++P+SG P N       Q+++ +  T         G ++NRTVY
Sbjct: 529 NDN----GGAGPSYF-MDPMSGAPIN-------QALQRQYLT----GTGQVGGSNNRTVY 572

Query: 608 IGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHG 667
           IGNI+PRSK EDICNVVRGGILQN+K+I  KRICFVTFIEA+AA QF AN+ ++PIVLHG
Sbjct: 573 IGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHG 632

Query: 668 NTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPS 727
           N LRVGWG  SG LPK+IALAVT+GA+RNVYVSLPEY+FK+K+IN+P++KEYH +YKLPS
Sbjct: 633 NILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPS 692

Query: 728 QEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDIN---HNNGEEFHKKFNN 784
           +EQLR+DFT YG++EQINYL D HCCWVNF+NIA AIRLVED N     N E+FH +F+ 
Sbjct: 693 EEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDG 752

Query: 785 RYEGLIINYGKDRCGNINKNLIA 807
           RY+ LII YGKDRCGN+NKNL A
Sbjct: 753 RYKNLIIGYGKDRCGNVNKNLTA 775

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/39 (61%), Positives = 30/39 (76%), Gaps = 2/39 (5%)

Query: 1009 TRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETEEDP 1047
            ++PI G DVM+QYL QL HSTF+Y+ NILGA+  T  DP
Sbjct: 1020 SKPIAGQDVMSQYLEQLHHSTFLYSTNILGAT--TVHDP 1056

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/33 (69%), Positives = 26/33 (78%)

Query: 49  VPPTPFDTAYGASLLPSHLLMGSPMISTTNLPR 81
           VP TPFD  YGASLLPSH+LMGSP +ST   P+
Sbjct: 82  VPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQ 114

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  405 bits (1041), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 232/296 (78%), Gaps = 10/296 (3%)

Query: 575  TNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKF 634
            T+  +TQ++E+  NTS  ++A +GG   NRTVYIGNINPRSK ED+CNVVRGGILQ + F
Sbjct: 797  THNNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVF 856

Query: 635  IEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGAN 694
            + DK ICFVTFIEA+ AAQF AN++IDPIVLHGN L+VGWGN SGPLPKSI+LAVT+GAN
Sbjct: 857  LRDKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGAN 916

Query: 695  RNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCW 754
            RNVYVSLPE+AFKDKFIN+P Y++YHE YKLP++ QLRKDF+ YGEIEQINYL D HCCW
Sbjct: 917  RNVYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCW 976

Query: 755  VNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGXXXXXX 814
            +NF+NI SAI LVE++N ++G  FH KF+ RY GLII YGKDRCGN+NKNL+A       
Sbjct: 977  INFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFF 1036

Query: 815  XXXXXPSYDIRIKKMEEKRKMQEDNLLSQ----------KKNSIQLDSLGISVDRT 860
                 P+Y I++KK+EE+R++QE+N L            +K ++ L+SLGI+ + +
Sbjct: 1037 KKVKKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLESLGITFESS 1092

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 65/106 (61%), Gaps = 9/106 (8%)

Query: 155 KKRTPIDVTKKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQV 214
           K  + ID+ K L  P+ ++Y++LP G D ++TRSLL EN+ ++ +  ++ ++  IN+  +
Sbjct: 246 KYSSVIDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTL-VKNFINFGPI 304

Query: 215 ESVYVFQQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRL 260
           ESVY+ +    P     S      + LSF+SR+  LDFYNN LQRL
Sbjct: 305 ESVYLIKL--NPGSKYNS------ILLSFVSREICLDFYNNVLQRL 342

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 52/100 (52%), Gaps = 16/100 (16%)

Query: 959  LSHAPPRAPSTINMTYKKISYVPP--------------LNGQAPK--MDYPKKYKRTHNN 1002
            L+  PP A ST+  TY+K    P               +  Q P   +D    ++   N 
Sbjct: 1249 LNQYPPMASSTLTRTYRKTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEKNPFRGPRNK 1308

Query: 1003 FPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVE 1042
              N+   + IPGSDVM+QYL QLQHSTFMYAANILG S E
Sbjct: 1309 NKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAE 1348

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 67/135 (49%), Gaps = 22/135 (16%)

Query: 315 ALGEEIFSHDATRSIAIEFYSQVEQDALFEK--LPFLDDKDNKRYILEAVDIISA----- 367
           AL  ++    ATRS+ ++F   V +D L  +    F+++  N RYILE++ +++      
Sbjct: 431 ALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESISLVNIENNTK 490

Query: 368 ----------EDAADDFPA-----NYVILTFINIKMAIEVLDYLKANLMTYSVNECFFVS 412
                     ED  +D P      NY +LTF NI MAIE  DY KA L   ++ +CFFVS
Sbjct: 491 NNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFVS 550

Query: 413 LPGCKSQRESSTTPV 427
                   E+S + +
Sbjct: 551 KTNYHKNSENSKSTI 565

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%)

Query: 44  SPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNL 79
           SP  + PPTPFD +YGA+LLPSHLLMGSP +ST N+
Sbjct: 99  SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNI 134

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  397 bits (1020), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 185/292 (63%), Positives = 229/292 (78%), Gaps = 11/292 (3%)

Query: 578 VITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIED 637
            ITQS+E   N SA++A++MG D  NRT+YIGNINPRS+ EDICNVVRGGILQ++K+I +
Sbjct: 624 AITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPE 683

Query: 638 KRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNV 697
           KRI FVTFIEA +A QF ANSFIDPIVLHGN LRVGWG+ SGPLPKSI+LAVT+GA+RNV
Sbjct: 684 KRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNV 743

Query: 698 YVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNF 757
           YVSLPE+AFK+KFI+DP+YK+ HE   LP  EQLR+DF+TYG+IEQINYL DSHCCW+NF
Sbjct: 744 YVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 803

Query: 758 INIASAIRLVEDIN------HNNGEEFHK-----KFNNRYEGLIINYGKDRCGNINKNLI 806
           +NI+SAI LVE++N      H+ GE   K     KF+ RY+GL+INYGKDRCGNINKNL+
Sbjct: 804 MNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLV 863

Query: 807 AGXXXXXXXXXXXPSYDIRIKKMEEKRKMQEDNLLSQKKNSIQLDSLGISVD 858
           AG           PSY+IR+ K+EE+R+  E++        + L+SLGIS+D
Sbjct: 864 AGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLGISLD 915

 Score =  160 bits (404), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 154/279 (55%), Gaps = 5/279 (1%)

Query: 166 LISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTDT 225
           L  P  INY++LP+GDD Y+TRSLL ENV ++ ++ S+ ++  + ++ +ES Y F   D 
Sbjct: 192 LQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSL-VKNFVKFNTLESAY-FVDNDK 249

Query: 226 PSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXYVTDE 285
               ++ + +   + +SFL+R   L+FYNN LQRL +                  Y + E
Sbjct: 250 NDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYES-E 308

Query: 286 XXXXXXXXXXXINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFEK 345
                         +++    +  ++   +L  ++ + DATRSI IEF S +E+  LF K
Sbjct: 309 CLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRK 368

Query: 346 -LPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYS 404
            L FLD+  NKRYILE++D+++ +  ++ FP NY +LTF+NI MA+EVLDYLK    +  
Sbjct: 369 RLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLE 428

Query: 405 VNECFFVSL-PGCKSQRESSTTPVLGHISTEGSKSVSEV 442
           +++CF+VSL P   S   SS   +    +T    SV  V
Sbjct: 429 ISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSV 467

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  382 bits (980), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 255/698 (36%), Positives = 369/698 (52%), Gaps = 125/698 (17%)

Query: 170 ISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTDT---- 225
           I   Y +LP G+DTY++RSLLF NV    +++    ++  NY  +ES+Y+ +  DT    
Sbjct: 215 IQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYP-IESIYLIKDEDTGDDI 273

Query: 226 ---------------------PSKDKESDKD----------------TCCLQ---LSFLS 245
                                 +  +E DKD                +C  Q   LSF +
Sbjct: 274 ENLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFT 333

Query: 246 RQAALDFYNNFLQRLPDXXXXXXXXXXXXXXXXXXYVTDEXXXXXXXXXXXINTEKRNIK 305
           +++ LDFYNN LQR                         E           +N  K  I+
Sbjct: 334 KESCLDFYNNLLQRYA-----------------------EIKNAVKSDQLAMNFVK--IQ 368

Query: 306 RSQELLKEPALGEEIFSHDATRSIAIEFYS-QVEQDALFEKLPFLDDKDNKRYILEAVDI 364
             +E +    L   + S  ATRS+ +EF    V  D +++ LPFL  K++ +Y++  VD+
Sbjct: 369 DDEEWMAN--LKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFL--KNSGKYVVIDVDV 424

Query: 365 ISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYSVNECFFVSLPGCKSQRESST 424
           ++ ++   +F  +Y +L F+++ MA+EV + L+      +V+   FV+ P   + +E   
Sbjct: 425 VTTDERRKNFGLHYCLLHFLSVTMALEVKELLETG--DEAVSRVSFVT-PANSADKEMR- 480

Query: 425 TPVLGHISTEGSKSVSEVNLANGGNTVMIDRXXXXXXXXXXXXXXXXKCLKIIRSDYPKP 484
                       +  S ++L    +  M                   + +    +D   P
Sbjct: 481 -----------RRRSSAISLKQEASPQMFSTDSRSRSRSSNVSLPLSEQVSTASTDISTP 529

Query: 485 EIRSHDDHIPGST---NFSMYI------FDDGMNPEGNS---GMYLHDNLTDHSSIIGSP 532
                D ++  ST   + S Y       FD  +N    S    +Y+H++ T + S   S 
Sbjct: 530 IYEEFDGNLTWSTLIVDVSEYKEPIVNEFDHHLNSWSISKPTTLYMHESGTTNFS--SSN 587

Query: 533 FSNYIDP-SIS-HVMLPNNGLPVGGFDAPGKFP--IEPISGPPFNHTNKVITQSIEDRLN 588
            S+ IDP SIS H  +P   L         ++P  +EP+  P        ITQ+I+++ +
Sbjct: 588 LSDDIDPLSISSHDPVPQQMLL-------NEYPYIMEPLMPPQ-------ITQTIQNQYS 633

Query: 589 TSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEA 648
            S +   A+    ++RTVYIGNINPRSK EDICNVVRGGILQ++K++  KRICFVTFIE 
Sbjct: 634 KSIQ---AVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIET 690

Query: 649 SAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKD 708
           +AA QF AN+ ++PI+LHGN L+VGWG   GPLPK+IALAVTVGA+RNVYVSLP+ AFKD
Sbjct: 691 AAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKD 750

Query: 709 KFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVE 768
           KFINDP++KEY  RYK+P+  QL+ DF  YG +EQ+N+  D HCCW+NF+NI+SAI+LVE
Sbjct: 751 KFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVE 810

Query: 769 DINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLI 806
           + +      FHKK   RY GLII YGKDRCGNIN+NL+
Sbjct: 811 EYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLV 848

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (73%)

Query: 995  KYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGAS 1040
            +++  +N  P +   +PI GSDVM +YL QL H+TF+YAANILGA+
Sbjct: 1095 QHEGANNGNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT 1140

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%)

Query: 49 VPPTPFDTAYGASLLPSHLLMGSPMIST 76
          +P TPFD  YG +LLPSHLL+GSP ++T
Sbjct: 68 IPQTPFDPVYGITLLPSHLLVGSPFVNT 95

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  185 bits (469), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 131/199 (65%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+GN+    K+E+ICNVVRGG+LQ+VK + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 447 NRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSLHG 506

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +     +VGWG  SGPLP ++ALAV+ GA+RNVY+      F+   + DP        
Sbjct: 507 LTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDP-------- 556

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
            ++ +++ LRK F  YGE+EQIN+L + +CC++NF NI++AI  ++ I          K 
Sbjct: 557 -RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKI----------KS 605

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  +E L IN+GKDRCGN+
Sbjct: 606 NPHFEDLKINFGKDRCGNV 624

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 108/204 (52%), Gaps = 22/204 (10%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI     V+++ + VR G++++VK I +K   F++F++ S+A  F +++ +
Sbjct: 211 APSRTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAIL 270

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720
             + + G  +++GWG  +   P   A  +   A RNV++        +K  ND   KE  
Sbjct: 271 KRLNIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFI-----GHLNKTDNDSCTKE-- 323

Query: 721 ERYKLP-SQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFH 779
                P ++ +LR+D   +GEIE +  + +    +V+F +I SAI+ V ++         
Sbjct: 324 -----PITEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNL--------- 369

Query: 780 KKFNNRYEGLIINYGKDRCGNINK 803
           +  N  YE   I YGKDRC  I K
Sbjct: 370 RSMNPYYENKKIAYGKDRCAFITK 393

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  178 bits (451), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 127/199 (63%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+GN+    K+E+ICN VR G+LQ+VK + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 408 NRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLHG 467

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           ++L     +VGWG  SGPLP  IALAV+ GA+RNVY+          F  D K  E    
Sbjct: 468 LILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIG------NIDFEEDSKRNE---- 517

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
            ++ +++ LRK F  YGE+EQIN+L   +CC++N+ NI++AI  ++ I          K 
Sbjct: 518 -RVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKI----------KS 566

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCGNI
Sbjct: 567 NPYFKDLKINFGKDRCGNI 585

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 113/204 (55%), Gaps = 16/204 (7%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI     V+++ + VR G++++VK + +K   F++F++ S+A  F +++ +
Sbjct: 166 APSRTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAIL 225

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVS-LPEYAFKDKFINDPKYKEY 719
             + + G  +++GWG  +   P       T GA RNVY+  L   A   + +N PK  E 
Sbjct: 226 KRLNIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPKESE- 284

Query: 720 HERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFH 779
                + ++E+L  D   YG+I+ +  +K+    +++F +I SAI++V ++  +N     
Sbjct: 285 -----IVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNLAASN----- 334

Query: 780 KKFNNRYEGLIINYGKDRCGNINK 803
           + + NR     I YGKDRC  I K
Sbjct: 335 RYYQNRK----IFYGKDRCAFITK 354

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  179 bits (454), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 132/199 (66%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRT+Y+GN+    +VE+ICNVVRGG+LQ+VK + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 498 NRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSLHG 557

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +     +VGWG  SGPL  ++ALAV+ GA+RN+Y+   ++A  DK  ++P + E    
Sbjct: 558 LTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIFTE---- 612

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
                 + LRK F+ YGE+EQIN+L + +CC++NF NI++AI  ++ I          K 
Sbjct: 613 ------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKI----------KS 656

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCGNI
Sbjct: 657 NPVFKDLKINFGKDRCGNI 675

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 111/235 (47%), Gaps = 41/235 (17%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI     V+++ + VR G++++VK I +K   F++F++ ++A  F +++ +
Sbjct: 219 APSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAIL 278

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVS-LPEYAF---KDKFINDPKY 716
             + ++G  +++GWG  +   P      +  GA RNV++  L   +F   K K    P  
Sbjct: 279 KRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPS 338

Query: 717 KEYHERYKLP----------------------------SQEQLRKDFTTYGEIEQINYLK 748
           + +     +                             S  +LRKD   +G+I+ I  ++
Sbjct: 339 RNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVE 398

Query: 749 DSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINK 803
           D    +++F +I SAI+ V ++N           N+ Y    I YGKDRC  I K
Sbjct: 399 DKGIAFIHFASITSAIKCVHNLN---------SMNDYYSTKKIFYGKDRCAFITK 444

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  176 bits (445), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 126/199 (63%), Gaps = 25/199 (12%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRT+Y+GN+    K+E+ICNVVRGG+LQN+K + D+  CF+TFI+ +AAAQF A S +  
Sbjct: 355 NRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSLHG 414

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +  N  +VGWG  SGPL  ++ALA++ GA+RN+Y+   ++  K+++ N          
Sbjct: 415 LTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFN---------- 464

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
                +E LR+ F  +GE+EQIN+L++  CC+VNF NI  AI  ++ I          K 
Sbjct: 465 -----EEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKI----------KS 509

Query: 783 NNRYEGLIINYGKDRCGNI 801
              +E L IN+GKDRCGNI
Sbjct: 510 LPEFEDLKINFGKDRCGNI 528

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 112/205 (54%), Gaps = 28/205 (13%)

Query: 600 DADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSF 659
           +A +RTVY+GNI     ++++ + VR G++++VK +  K   F++FI+   A  F +++ 
Sbjct: 124 NAPSRTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAI 183

Query: 660 IDPIVLHGNTLRVGWGNQSGPLPKSIALAVTV-GANRNVYVSLPEYAFKDKFINDPKYKE 718
           +  + + G  +++GWG +S  +   +A  +T  GA RNVY+         +  +DP    
Sbjct: 184 LKRLNIRGKDIKIGWG-KSNHIDSIVAARITNDGATRNVYIG--------QLNDDP---- 230

Query: 719 YHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEF 778
                 + ++++L KD   +GEI+ I +L +    +V+F +I+ AI +V++++       
Sbjct: 231 -----TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLS------- 278

Query: 779 HKKFNNRYEGLIINYGKDRCGNINK 803
             K N +Y+   I YGKDRC  I K
Sbjct: 279 --KLNEKYKNKRIFYGKDRCAFITK 301

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  178 bits (451), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 127/199 (63%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+GN+    K+E+ICN +RGG+LQN+K + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 471 NRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLHG 530

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +H    ++GWG  SGPLP  IALAV+ GA+RN+Y+          F  D K +E    
Sbjct: 531 LTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLG------NINFEEDAKQEE---- 580

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
             + +++ LR  F  +G +EQIN+L + +CC++NF NI++AI  ++ I  N        F
Sbjct: 581 -SVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSN------PHF 633

Query: 783 NNRYEGLIINYGKDRCGNI 801
           NN    L IN+GKDRCGN+
Sbjct: 634 NN----LKINFGKDRCGNV 648

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 103/206 (50%), Gaps = 20/206 (9%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI      + + + VR G+++ VK + +K   FV+F++ + A  F +++ +
Sbjct: 230 APSRTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAIL 289

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKD---KFINDPKYK 717
             + + G  +++GWG      P   A     GA RNVY+       KD   K+  DPK  
Sbjct: 290 KRLNIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTN-KDSCEKWGADPK-- 346

Query: 718 EYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEE 777
                  L ++E+L  D + +GEIE I  ++D    +V+F +I +AI+ V +I       
Sbjct: 347 -----EILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIG------ 395

Query: 778 FHKKFNNRYEGLIINYGKDRCGNINK 803
                +  Y    + YGKDRC  I K
Sbjct: 396 ---SIDPYYSNKKVFYGKDRCAFITK 418

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  178 bits (451), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 125/199 (62%), Gaps = 20/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+GN+    K+++ICN VRGG+LQ++K + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 527 NRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMSSLHG 586

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +     +VGWG  SGPLP  IALAV+ GA+RNVY+   ++    K  N P + E    
Sbjct: 587 LSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIFTEL--- 643

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
                   LR  F  YG++EQIN+L + +CC++NF NI++AI  +E I          K 
Sbjct: 644 -------SLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKI----------KN 686

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCGNI
Sbjct: 687 NPDFKDLKINFGKDRCGNI 705

 Score =  100 bits (249), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 114/221 (51%), Gaps = 26/221 (11%)

Query: 599 GDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANS 658
           G+  +RTVY+GNI     V+D+ + VR G+++N+K + DK   F++F++ S+A  F +++
Sbjct: 263 GNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDA 322

Query: 659 FIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVS----------------LP 702
            +  + + G  +++GWG  +   P      VT GA RNVY+                   
Sbjct: 323 ILKRLNIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTS 382

Query: 703 EYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIAS 762
             +  +   +D + K+  +   L ++E+LR+D   YGEI+ +  ++D    +V+  +I S
Sbjct: 383 PSSPSNNTSDDLEKKKNIDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILS 441

Query: 763 AIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINK 803
           AI++V ++          + N  Y+   I YGKDRC  I K
Sbjct: 442 AIKVVNNL---------AQTNPYYQNKRIFYGKDRCAFITK 473

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  175 bits (444), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/199 (42%), Positives = 129/199 (64%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+GN+    K+E+ICN VRGG+LQ+VK + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 400 NRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLHG 459

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +H    ++GWG  SG LP ++ALAV+ GA+RN+YV   ++   D         E  E 
Sbjct: 460 LTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAID---------ETGE- 509

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
             + +++ LR+ F  +GE+EQIN+L + +CC++NF NI++AI  ++ I          K 
Sbjct: 510 -TIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI----------KC 558

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L +N+GKDRCGN+
Sbjct: 559 NPYFKNLKVNFGKDRCGNV 577

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 112/207 (54%), Gaps = 22/207 (10%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI P    + + + VR G+++ +K + D+   F++F++ S+A  F +++ +
Sbjct: 158 APSRTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAIL 217

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSL----PEYAFKDKFINDPKY 716
             + + G  ++VGWG  +   P   A   + GA RNVY+      P+ A   +F  DP  
Sbjct: 218 KRLNIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPN- 274

Query: 717 KEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGE 776
                  ++ S+E+LRKD   +GEIE I  ++D    +V+F +I SAI++V ++   N  
Sbjct: 275 ------EEIVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLASVNPY 328

Query: 777 EFHKKFNNRYEGLIINYGKDRCGNINK 803
             +KK         I YGKDRC  I K
Sbjct: 329 YTNKK---------IFYGKDRCAFITK 346

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  175 bits (443), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 145/240 (60%), Gaps = 23/240 (9%)

Query: 564 IEPISGPPFNHTNKVITQSI--EDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDIC 621
           I+P   P F++  ++I+Q++  +     +   +A    +  NRT+Y+GN+    K+E+IC
Sbjct: 353 IQPGMEPLFSNDRELISQTLLQQSAAAAAIATSAGGANNLGNRTIYLGNLPKDVKLEEIC 412

Query: 622 NVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPL 681
           N VRGG+LQ++K + D+ +CFVTFI+ +AAAQF A S +  + +H    ++GWG  SGPL
Sbjct: 413 NSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSLHGLTIHNKRCKIGWGKHSGPL 472

Query: 682 PKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEI 741
           P  +ALAV+ GA+RN+Y+   ++   D+ +  P + E            LR  F  +GE+
Sbjct: 473 PNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIFTE----------TSLRSVFQEFGEV 521

Query: 742 EQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNI 801
           EQIN+L + +CC++NF NI+SAI  ++ I          K    ++ L IN+GKDRCGN+
Sbjct: 522 EQINFLYERNCCFINFANISSAILAIDKI----------KSIPTFKDLKINFGKDRCGNV 571

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 105/206 (50%), Gaps = 20/206 (9%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GN+ P     ++ + VR G++++VK + +K   F++F++ ++A  F +++ +
Sbjct: 153 APSRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAIL 212

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720
             + +    +++GWG  +   P   A     GA RNVY+         K   +PK     
Sbjct: 213 KRLNIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLG--------KLNTNPKMCAQW 264

Query: 721 ---ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEE 777
                 +  ++E+LR D   +GE+E +  + +    +V+F +I SAI++V ++ + N   
Sbjct: 265 GADPNEETITEEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLANVNPYY 324

Query: 778 FHKKFNNRYEGLIINYGKDRCGNINK 803
             KK         I YGKDRC  I K
Sbjct: 325 AQKK---------IFYGKDRCAFITK 341

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  172 bits (437), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 126/199 (63%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRT+Y+GN+    K+E+ICN VRGG+LQ++K + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 341 NRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLHG 400

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +H    ++GWG  SGPLP  +ALAV+ GA+RN+Y+   ++A  DK    P + E    
Sbjct: 401 LTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIFTE---- 455

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
                   LR  F  +GE+EQIN+L + +CC++NF NI+SAI  ++ I          K 
Sbjct: 456 ------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI----------KS 499

Query: 783 NNRYEGLIINYGKDRCGNI 801
              ++ L IN+GKDRCGN+
Sbjct: 500 IPTFKDLKINFGKDRCGNV 518

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 109/203 (53%), Gaps = 14/203 (6%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GN+ P    +++ + VR G+++ VK + +K   F++F+E ++A  F +++ +
Sbjct: 100 APSRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAIL 159

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720
             + +    +++GWG  +   P   A     GA RNVY+        +K I      + +
Sbjct: 160 KRLNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLN---TNKDICAQWGVDPN 216

Query: 721 ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHK 780
           E  ++ ++E+LR D + +GE+E +  + +    +V+F +I +AI++V ++ + N     K
Sbjct: 217 E--EVITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANINPYYAQK 274

Query: 781 KFNNRYEGLIINYGKDRCGNINK 803
           K         I YGKDRC  I K
Sbjct: 275 K---------IFYGKDRCAFITK 288

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 36/84 (42%), Gaps = 22/84 (26%)

Query: 593 IAAAMGGDADNRTVYIGNINPRSKVEDIC-------------------NVVRGGILQNVK 633
           +AA +  D   R VYIG +N     +DIC                   ++   G ++NVK
Sbjct: 183 VAAGITNDGATRNVYIGKLNTN---KDICAQWGVDPNEEVITEEKLRNDLSDFGEVENVK 239

Query: 634 FIEDKRICFVTFIEASAAAQFCAN 657
            + +K I FV F    AA +  AN
Sbjct: 240 IVPEKGIAFVHFSSIFAAIKVVAN 263

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  171 bits (432), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 126/199 (63%), Gaps = 23/199 (11%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRT+Y+GN++ R ++E++CNVVRGG+LQ+VKF+ D+ +CFVTF + +AAAQF A + +  
Sbjct: 264 NRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASLHG 323

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +     ++GWG  SGPLP  +A A++ GA+RNVY       F +    DP   E+ E 
Sbjct: 324 LTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFFE- 375

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
                +  LR+  + +GE+EQ+N + +  C +VNF N+ SAI  VE +         KK+
Sbjct: 376 -----ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQV---------KKW 421

Query: 783 NNRYEGLIINYGKDRCGNI 801
             +++ L +NYGKDRCGN+
Sbjct: 422 -PQFQQLKVNYGKDRCGNV 439

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 100/204 (49%), Gaps = 31/204 (15%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI P   + ++ + V+ G++++ +    K   FV+F++ ++A  F +++ +
Sbjct: 36  APSRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAIL 95

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVS-LPEYAFKDKFINDPKYKEY 719
           + + +    +++GW   +   P       + GA RNVY+  LP+                
Sbjct: 96  NRLRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV-------------- 141

Query: 720 HERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFH 779
                  S+ +L KD + YGEI+ +  L      +V+  +I  AI  V ++  +N     
Sbjct: 142 -------SRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDN----- 189

Query: 780 KKFNNRYEGLIINYGKDRCGNINK 803
           K +++R     +++GKDRC  + K
Sbjct: 190 KIYSDRR----VSFGKDRCAYVTK 209

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  172 bits (437), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 125/199 (62%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+GN+    K+E+ICNVVRGGILQ +K + D+ +CFVTFI+  AAAQF A S +  
Sbjct: 402 NRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSLHG 461

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           I +     RVGWG   GPLP +IALAV+ GA+RNVY+   ++           Y++   +
Sbjct: 462 ITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-----------YEDSKRQ 510

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
             + + + LRK F  YGE+EQ+N+L + +C +VN+ NI++AI  ++ I          K 
Sbjct: 511 EPIFTADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKI----------KS 560

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCG I
Sbjct: 561 NPLFKNLKINFGKDRCGTI 579

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 106/205 (51%), Gaps = 18/205 (8%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A  +TVY+GNI P   V ++ + VR G+++ VK + +K   F+TF++ SAA  F +++ +
Sbjct: 160 APRKTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAIL 219

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSL--PEYAFKDKFINDPKYKE 718
             + + G  +++GWG  +   P       + GA RNVY+ L   +     +   DP  ++
Sbjct: 220 KRLHIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEK 279

Query: 719 YHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEF 778
             E       E+LR D   +GEI+ +  +++    +++F +I SA+++V ++        
Sbjct: 280 ITE-------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANL-------- 324

Query: 779 HKKFNNRYEGLIINYGKDRCGNINK 803
               N  YE   I YGKDRC  I K
Sbjct: 325 -AGINPYYENKKIYYGKDRCAFITK 348

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  172 bits (437), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 123/199 (61%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+GN+    K+E+ICN VRGG+LQ++K ++D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 457 NRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSLYG 516

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
             +     +VGWG  SGPLP ++ALAV+ GA+RNVY+   ++   D     P + E    
Sbjct: 517 FTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFE-ADSKKEQPIFNE---- 571

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
                   LR  F  YGE+EQIN+L +  CC++NF NI +AI  ++ I          K 
Sbjct: 572 ------TALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKI----------KS 615

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCGN+
Sbjct: 616 NPHFKSLKINFGKDRCGNV 634

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 106/203 (52%), Gaps = 20/203 (9%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI P   ++++ + VR G+++  K + +K   F++F+E S+A  F +++ +
Sbjct: 221 APSRTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAIL 280

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720
             + +    ++VGWG  +   P   +  +  GA RNVY+            ND   KE  
Sbjct: 281 KRLNIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGN--------NDRSSKENK 332

Query: 721 ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHK 780
           E     ++E+LR+D   YGEI+ I  + +    +V+F +IA+AI++V  +   N     K
Sbjct: 333 EPL---TEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKNPFYQEK 389

Query: 781 KFNNRYEGLIINYGKDRCGNINK 803
           K         I YGKDRC  I K
Sbjct: 390 K---------IFYGKDRCAFITK 403

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  172 bits (436), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 124/199 (62%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+GN+    KVE+ICNVVRGG+LQNVK + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 450 NRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSLHG 509

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           I +     RVGWG   G L  ++ALAV+ GA+RNVYV    +  +D    DP + E    
Sbjct: 510 ITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIFTE---- 564

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
                   LR  F  +GE+EQINYL + +CC+VN+ NI++AI  ++ I          K 
Sbjct: 565 ------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKI----------KG 608

Query: 783 NNRYEGLIINYGKDRCGNI 801
           +  ++ L IN+GKDRCGN+
Sbjct: 609 HPVFKDLKINFGKDRCGNV 627

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 110/209 (52%), Gaps = 23/209 (11%)

Query: 600 DADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSF 659
           +A ++TVY+GN      V+++ + VR G++++V+ + DK   FV+F++ SAA  F +++ 
Sbjct: 206 NAPSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAI 265

Query: 660 IDPIVLHGNTLRVGWGNQSGPLPKSIALAVTV-GANRNVYVSLPEYAFKDKFINDPKYKE 718
           +  + + G  +++GWG  + P+   +A AV    A RNVY+         +    PK   
Sbjct: 266 LKRLHIDGRDIKIGWGKPT-PIDPVVATAVANDNATRNVYIG--------QLNTGPKLSS 316

Query: 719 YHERYKLP----SQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNN 774
                 +     ++++LR D   +GEI+ I  +++    +V+F +I +AI+ V ++ + N
Sbjct: 317 QVSPVDVTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLANIN 376

Query: 775 GEEFHKKFNNRYEGLIINYGKDRCGNINK 803
               +KK         I YGKDRC  I K
Sbjct: 377 PYYRNKK---------IFYGKDRCAFITK 396

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  171 bits (432), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 127/200 (63%), Gaps = 23/200 (11%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRT+Y+GN+    K+E+ICN VRGG+LQ++K + D+ +CFVTFI+ +AAAQ  A + +  
Sbjct: 387 NRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLHG 446

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +H    ++GWG  SG L  ++ALAV+ GA+RN+Y            + +  +K   ER
Sbjct: 447 LTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIY------------LGNIDFKADSER 494

Query: 723 -YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKK 781
              + +++ LRK F  YGE+EQIN+L +  CC+VNF NI++AI  ++ I          K
Sbjct: 495 DVPVFTEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKI----------K 544

Query: 782 FNNRYEGLIINYGKDRCGNI 801
            N +++ L IN+GKDRCGN+
Sbjct: 545 SNEQFKDLKINFGKDRCGNV 564

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 109/205 (53%), Gaps = 18/205 (8%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI P  +V ++ + VR G++++V+ + +K   F++F++ S+A  F +++ +
Sbjct: 145 APSRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAIL 204

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSL--PEYAFKDKFINDPKYKE 718
             + + G  ++VGWG  +   P   A     GA RNVY+     +     +F  DP    
Sbjct: 205 KRLNIGGRDIKVGWGKPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP---- 260

Query: 719 YHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEF 778
              R  + ++E+LR D   YGEIE +  + +    +V+F +I SAI++V  +   N    
Sbjct: 261 ---RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSLATVNPYYS 317

Query: 779 HKKFNNRYEGLIINYGKDRCGNINK 803
           +KK         I YGKDRC  + K
Sbjct: 318 NKK---------IFYGKDRCAFVTK 333

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  171 bits (434), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 127/199 (63%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+G++    K+E+ICN VRGG+LQ++K + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 443 NRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLYG 502

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
             +     +VGWG  SGPLP ++ALAV+ GA+RNVYV          F++D    E    
Sbjct: 503 FTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSDSLRDE---- 552

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
            ++ ++  LR  F  YGE+EQIN+L + +CC+VN+ NI++AI  ++ I          K 
Sbjct: 553 -RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKI----------KS 601

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCGN+
Sbjct: 602 NPYFKDLKINFGKDRCGNV 620

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 106/203 (52%), Gaps = 24/203 (11%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GN+ P   V+++ + VR G++++VK I +K   F++F++ SAA  F +++ +
Sbjct: 211 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAIL 270

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720
             + +    +++GWG  +   P   A   T GA RNVY+       ++  +         
Sbjct: 271 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHL--------- 321

Query: 721 ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHK 780
                 S+EQLR D   YGEI+ I  +K+    +++F +I +AI++V ++   N      
Sbjct: 322 ------SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIRNP----- 370

Query: 781 KFNNRYEGLIINYGKDRCGNINK 803
                Y+   I YGKDRC  I K
Sbjct: 371 ----YYQNKRIFYGKDRCAFITK 389

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  171 bits (432), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 128/199 (64%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+G++    K+E+ICN VRGG+LQ++K + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 414 NRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLYG 473

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
             +     +VGWG  SGPLP ++ALAV+ GA+RNVYV   ++A     +ND         
Sbjct: 474 FTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA--SDSLNDE-------- 523

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
            ++ ++  LR  F  YGE+EQIN+L + +CC++N+ NI++AI  ++ I          K 
Sbjct: 524 -RIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI----------KS 572

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCGN+
Sbjct: 573 NPYFKDLKINFGKDRCGNV 591

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 105/203 (51%), Gaps = 24/203 (11%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A  RTVY+GN+ P   V+++ + VR G++++VK I +K   F++F++ SAA  F +++ +
Sbjct: 182 APTRTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 241

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720
             + +    +++GWG  +   P   A   T GA RNVY+       ++  +         
Sbjct: 242 KRLNIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL--------- 292

Query: 721 ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHK 780
                 S+EQLR D   YGEI+ I  +K+    +++F +I +AI++V ++   N      
Sbjct: 293 ------SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNP----- 341

Query: 781 KFNNRYEGLIINYGKDRCGNINK 803
                Y+   I YGKDRC  I K
Sbjct: 342 ----YYQNKRIFYGKDRCAFITK 360

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  170 bits (431), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 126/199 (63%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+G++    K+E+ICN VRGG+LQ++K + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 430 NRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLYG 489

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
             +     +VGWG  SGPLP ++ALAV+ GA+RNVYV          F+ D    E    
Sbjct: 490 FTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGDSLRDE---- 539

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
            ++ ++  LR  F  YGE+EQIN+L + +CC++N+ NI++AI  ++ I          K 
Sbjct: 540 -RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI----------KS 588

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCGN+
Sbjct: 589 NPYFKDLKINFGKDRCGNV 607

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 106/203 (52%), Gaps = 24/203 (11%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GN+ P   V+++ + VR G++++VK I +K   FV+FI+ SAA  F +++ +
Sbjct: 198 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAIL 257

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720
             + +    +++GWG  +   P   A   T GA RNVY+       ++  +         
Sbjct: 258 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL--------- 308

Query: 721 ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHK 780
                 S+EQLR D   YGEI+ I  +K+    +++F +I +AI++V ++   N      
Sbjct: 309 ------SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNP----- 357

Query: 781 KFNNRYEGLIINYGKDRCGNINK 803
                Y+   I YGKDRC  I K
Sbjct: 358 ----YYQNKRIFYGKDRCAFITK 376

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  170 bits (431), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 129/199 (64%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+G++    K+E+ICN VRGG+LQ++K + D+ +CFVTFI+ +AAAQF A S +  
Sbjct: 432 NRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLYG 491

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
             +     +VGWG  SGPLP ++ALAV+ GA+RNVYV   +Y      ++D    E    
Sbjct: 492 FTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDY------VSDSVRDE---- 541

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
            ++ ++ +LR  F  YGE+EQIN+L + +CC++N+ NI++AI  ++ I          K 
Sbjct: 542 -RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI----------KS 590

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCGN+
Sbjct: 591 NPYFKDLKINFGKDRCGNV 609

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 105/203 (51%), Gaps = 24/203 (11%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GN+ P   V+++ + VR G++++VK I +K   F++F++ SAA  F +++ +
Sbjct: 200 AQSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 259

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYH 720
             + +    +++GWG  +   P   A   T GA RNVY+       ++  +         
Sbjct: 260 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL--------- 310

Query: 721 ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHK 780
                 S EQLR D   YGEI+ I  +K+    +++F +I +AI++V ++   N      
Sbjct: 311 ------SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRNL----- 359

Query: 781 KFNNRYEGLIINYGKDRCGNINK 803
                Y+   I YGKDRC  I K
Sbjct: 360 ----YYQNKRIFYGKDRCAFITK 378

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  168 bits (426), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 125/199 (62%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRT+Y+GN+    K+E+ICNVVRGG+LQ++K + D+ +CFVTFI+ +AAAQ  A + +  
Sbjct: 385 NRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASLHG 444

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
           + +H    ++GWG  SG L  ++ALAV+ GA+RN+Y+   ++   D     P + E    
Sbjct: 445 LTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSETEHPIFTE---- 499

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
                 + LR  F  +GE+EQIN+L + +CC+VNF NI++AI  ++ I          K 
Sbjct: 500 ------QNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKI----------KN 543

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N ++  L IN+GKDRCGN+
Sbjct: 544 NPQFSDLKINFGKDRCGNV 562

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 110/205 (53%), Gaps = 18/205 (8%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI P  +   + + VR G++++++ + +K   F++F++ S+A  F +++ +
Sbjct: 143 APSRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAIL 202

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSL--PEYAFKDKFINDPKYKE 718
             + + G  +++GWG  +   P   +     GA RNVY+     + +F  +   DP    
Sbjct: 203 KRLNIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADP---- 258

Query: 719 YHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEF 778
              R ++ ++++LR D + YGEIE +  + +    +V+F +I SAI++V  +   N    
Sbjct: 259 ---RDEVVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAAVNPYYA 315

Query: 779 HKKFNNRYEGLIINYGKDRCGNINK 803
           +KK         I YGKDRC  I K
Sbjct: 316 NKK---------IFYGKDRCAFITK 331

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  167 bits (423), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 85/199 (42%), Positives = 121/199 (60%), Gaps = 21/199 (10%)

Query: 603 NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           NRTVY+GN+    ++EDICN +R G+LQN+K + D+ +CFVTFI+  +AAQF A S I  
Sbjct: 414 NRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIYG 473

Query: 663 IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722
            VL     +VGWG  SGPL   + LAV+ GA+RNVY+   ++             +  +R
Sbjct: 474 FVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFT-----------ADGTKR 522

Query: 723 YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782
            +  +   LR+ F+ YGE+EQIN+L   +CC+VN+ NI +AI  ++ I          K 
Sbjct: 523 ERYFTDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKI----------KN 572

Query: 783 NNRYEGLIINYGKDRCGNI 801
           N  ++ L IN+GKDRCGNI
Sbjct: 573 NPTFKNLKINFGKDRCGNI 591

 Score =  103 bits (256), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 115/207 (55%), Gaps = 15/207 (7%)

Query: 601 ADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFI 660
           A +RTVY+GNI P     D+ + VR G+++ VK + +K   F++F++ +++  F +++ +
Sbjct: 165 APSRTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAIL 224

Query: 661 DPIVLHGNTLRVGWGNQSGPLPKSIALAV-TVGANRNVYVSLPEYAFKDKFINDPKYKEY 719
             + + G  +++GWG  S PL   IA +V T GA RN+++        +K   D     Y
Sbjct: 225 KRLNIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNK-QKDNDATIY 282

Query: 720 H---ERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGE 776
           H   +   + ++E+LRKD   YG+I+ I   K+    +V+F +I SAI++V +++++N  
Sbjct: 283 HGSDDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSNPY 342

Query: 777 EFHKKFNNRYEGLIINYGKDRCGNINK 803
              KK         I YGKDRC  I K
Sbjct: 343 YSKKK---------IYYGKDRCAFITK 360

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 94/231 (40%), Gaps = 24/231 (10%)

Query: 576 NKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFI 635
           N  +T S ED L         +  +   + + +GNI  R+ +  I   +  G L+N+   
Sbjct: 164 NIYVTSSSEDEL---------LENNVRPKAIVLGNIPKRTGIASILAQIHAGPLENIIVH 214

Query: 636 EDKRICF----VTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTV 691
            D         + F+   AA  F      +   ++G  L   WG  S    K        
Sbjct: 215 TDDEQALKKIELDFLTHEAAYSFMKYGRTNMFKINGQHLTPEWGKSSEHKTKK-GNEWDD 273

Query: 692 GANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQE-----QLRKDFTTYGEIEQIN- 745
             + +            K+IN  K  +Y E YK    E     ++++DF T+GEI +I  
Sbjct: 274 QQSSSDDQDFCRSLIMKKYINCTKRTKYSEAYKESPLEPLNLSEIKQDFGTFGEILEITP 333

Query: 746 YLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKD 796
            +    C  +NF N+ SA++ +++  + N  + HK + N +    I YGKD
Sbjct: 334 VVSRKLCISINFFNMESAMKAMKEYENPNS-DLHKAYFNNW---AIWYGKD 380

>NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.670
           YOR242C
          Length = 358

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 89/210 (42%), Gaps = 31/210 (14%)

Query: 600 DADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKR------ICFVTFIEASAAAQ 653
           D   R + I NI   + +  I   + GG ++N  F +  +      +  + FI +  A Q
Sbjct: 158 DKQRRMIIIRNIPKETGIHSIVAQISGGPIENFNFYQQHKLSSPSNVLKIAFIASEGAQQ 217

Query: 654 FCANSFIDPIVLHGNTLRVGWGNQSG-PLPKSIALAVTV----GANRNVYVSLPEYAFKD 708
           F      +   ++G  L+  W   S   +P     + T+    G  R ++  + +   KD
Sbjct: 218 FMKYGNTNLFKVNGIHLKPEWFVDSNLCIPSKTVPSKTLLNYNGKCRCLF--MKQLPLKD 275

Query: 709 KFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSH-CCWVNFINIASAIRLV 767
             + +  Y            +++R DF  +GEI  I+ L     C ++ F +I SA+R++
Sbjct: 276 HLVLNSLY-----------LKRIRSDFECFGEIVDISPLISRRPCLYIQFYDIYSAVRVL 324

Query: 768 EDINHNNGEEFHKKFNNRY-EGLIINYGKD 796
           E       E+ H + + +Y E   I YGKD
Sbjct: 325 EAY-----EDRHSRIHQQYFEKWSIYYGKD 349

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 91/216 (42%), Gaps = 32/216 (14%)

Query: 600 DADNRTVYIGNINPRSKVEDICNVVRGGILQNVKF---------IEDKRICFVTFIEASA 650
           D   R + I NI   + +  + + V GG L+N+ F         +E+ R+ F+T   A A
Sbjct: 163 DTSKRNIVIKNIPSGTGLASVMSQVCGGPLENISFQTAEKSINILENVRLSFLT---ADA 219

Query: 651 AAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANR-------NVYVSL-- 701
           A  F   S      ++G  L   W     PL +     +  G  +       N+  SL  
Sbjct: 220 ADAFMNYSKTRLFKVNGFNLITEWA----PLKQQPINNIYSGLEKQQAQFSTNICRSLIM 275

Query: 702 PEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQIN-YLKDSHCCWVNFINI 760
            +Y  K +     K+ E       PS   + +DF  +G I+++   +    C  VN+ NI
Sbjct: 276 KKYPQKKEIKKYCKWMENTMDDFDPSI--IVEDFGQFGRIQEVTPIISRKLCVAVNYYNI 333

Query: 761 ASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKD 796
            SA++ +E     N  E H+K+   Y+   I +GKD
Sbjct: 334 LSALKAIESYEDPNS-ELHRKY---YKSWAIWFGKD 365

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 84/188 (44%), Gaps = 15/188 (7%)

Query: 565 EPISGPPFNHTNKVITQSIEDRLNTSARIAAAMGG-DADNRTVYIGNINPRSKVEDICN- 622
           EP S  P +       QS E++ ++    +A  GG +  +R +Y+GN++ +S  ED+   
Sbjct: 43  EPESADPVSEAPAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLD-KSINEDLLKQ 101

Query: 623 -VVRGGILQNVKFIEDKR-----ICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGN 676
               GG + +VK + DK+       F+ ++++  A    A   ++ I + G T+R+ W  
Sbjct: 102 YFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDAN--VALQTLNGIQIEGKTVRINWAF 159

Query: 677 QSGPLPKS-IALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDF 735
           QS     S     + VG   ++ V + +      F   P Y + H  + + +       F
Sbjct: 160 QSQQTTNSDDTFNLFVG---DLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGF 216

Query: 736 TTYGEIEQ 743
            ++ + EQ
Sbjct: 217 VSFADQEQ 224

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 85/213 (39%), Gaps = 22/213 (10%)

Query: 599 GDADNRTVYIGNINPRSKVEDICNVVRGGILQNV-----KFIEDKRICFVTFIEASAAAQ 653
           G  D   V + +    + ++ + N V+GG L+++     K     +   + F+    A  
Sbjct: 162 GLQDKCLVVLRDFPTGTGLKSVLNQVQGGALKHITPQYKKETNQLKSVELEFLCPEDAQH 221

Query: 654 FCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYV-SLPEYAFKDKFIN 712
           F          ++G  LR  WG QS       +L        N+Y  S      K +   
Sbjct: 222 FMEYGRHAVFQINGVHLRPRWGIQSLSENFEASLNANQRDRLNLYAPSSRCLLLKKQGSK 281

Query: 713 DPKYKEYHERYKLPSQ-------EQLRKDFTTYGEIEQIN-YLKDSHCCWVNFINIASAI 764
           +PK+   H  Y  P         ++L+KDF+ +G I  I+  +    C  +NF +I SA+
Sbjct: 282 NPKHSTCH--YPSPRSHICDLNVQELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAM 339

Query: 765 RLVEDINHNNGEEFHKKFNNRY-EGLIINYGKD 796
             ++   + N        N +Y E   I YGKD
Sbjct: 340 DALQSYKNANSP-----LNRKYAESWTIGYGKD 367

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 86/215 (40%), Gaps = 22/215 (10%)

Query: 600 DADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRIC-----FVTFIEASAAAQF 654
           + + R V I  +     ++ + + V GG L+ V   +D+R        + F+    A  F
Sbjct: 202 NGEERVVEILELPQDVGIQSLLSQVYGGPLEKVNVSKDQRGAPARGARLHFLFNEDAKSF 261

Query: 655 CANSFIDPIVLHGNTLRVGWGNQSG---------PLPKSIALAVTVGANRNVYVSLPEYA 705
            +    +   ++G+ ++  W  +S           +   ++     G             
Sbjct: 262 ISYGLSNNFRINGHIVKPQWAPKSTCSLSNMNFDEVKDMVSANACAGRQEGTRARRCIVV 321

Query: 706 FKDKFINDPKYKEYHE-RYKLPS--QEQLRKDFTTYGEIEQIN-YLKDSHCCWVNFINIA 761
            K      P+ ++ H  R  L S   + LRKDF  +GEI +I+  +    C  V+F ++ 
Sbjct: 322 KKTGCTKSPRSRQLHSNRQNLCSFDYKDLRKDFEQFGEISEISPMISRKLCVSVSFYDVR 381

Query: 762 SAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKD 796
           SAI  +E     +    HKK+N  +    + YG+D
Sbjct: 382 SAINALESFGEPD-SFMHKKYNRDW---TMAYGRD 412

>NCAS0B01600 Chr2 complement(261098..262219) [1122 bp, 373 aa] {ON}
           Anc_8.670 YOR242C
          Length = 373

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 86/205 (41%), Gaps = 21/205 (10%)

Query: 602 DNRTVYIGNINPRSKVEDICNVVRGGILQNVKFI--EDKRICFVT----FIEASAAAQFC 655
           D R+V I NI   + +  I N + GG L+   +   E+ R    T    F+ ++ A  F 
Sbjct: 171 DRRSVTIENIPTYTGMYSILNQISGGPLEKFCYYRNENSRQATYTMTLNFLSSNNAQDFM 230

Query: 656 ANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNV---YVSLPEYAFKDKFIN 712
                +   ++G  L+  W +  G +      A +  A       Y+ L  ++ K     
Sbjct: 231 KFGKTNLFKVNGFHLQPKWSSVEGSVSSQTNSAKSKLAKTGCICRYIILKRHSGKTTCTK 290

Query: 713 DPKYKEYHERYKLPSQEQLRKDFTTYGEIEQIN-YLKDSHCCWVNFINIASAIRLVEDIN 771
            P   EY +       +++RKDF  YG I +I   +    C  + + +I SA+R +    
Sbjct: 291 VPIL-EYVD------IQEIRKDFGCYGGIVEITPVISKKVCLSIGYYDIYSAVRAMVAY- 342

Query: 772 HNNGEEFHKKFNNRYEGLIINYGKD 796
            N+  + HKK+   ++   + YG D
Sbjct: 343 ENSSTDLHKKY---FQSWTLWYGND 364

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score = 38.5 bits (88), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 10/89 (11%)

Query: 594 AAAMGGDADNRTVYIGNINPRSKVEDICN--VVRGGILQNVKFIEDKR-----ICFVTFI 646
           A   G +  +R +Y+GN++ +S  ED+       GG +QNVK IED +       FV +I
Sbjct: 48  ATKGGRETSDRVLYVGNLD-KSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYI 106

Query: 647 EASAAAQFCANSFIDPIVLHGNTLRVGWG 675
            +  A    A   ++ + L   TL++ W 
Sbjct: 107 RSHDAN--VALQTLNGVQLENKTLKINWA 133

>TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {ON}
           Anc_8.670 YOR242C
          Length = 394

 Score = 38.1 bits (87), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 731 LRKDFTTYGEIEQINYLKDSHCCW-VNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGL 789
           L+ DF  YG I  +  +     C+ V+F N+ASAIR ++      G E +KK+  R+   
Sbjct: 323 LKNDFKKYGTILDVTPIVSRKLCFAVHFANVASAIRAMQAFEL-KGTELNKKYYKRW--- 378

Query: 790 IINYGKD 796
            + YGKD
Sbjct: 379 AMWYGKD 385

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 60/135 (44%), Gaps = 19/135 (14%)

Query: 547 PNNGLPVG---GFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIAAAMGGDADN 603
           P  G+P G   G  AP   P++ + GPP    + V  Q++E  +  + +           
Sbjct: 224 PFRGMPQGPHLGGAAPAG-PMQ-LQGPPV--PSPVNPQAVEAMIRRAPQRVT-------- 271

Query: 604 RTVYIGNINPRSKVEDICNVVRG-GILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
            T YIGNI   ++  D+  +++  G + + K   +K  CF+ +     AA  C  +  + 
Sbjct: 272 -TAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCCFIKYDTHDQAA-LCIVALAN- 328

Query: 663 IVLHGNTLRVGWGNQ 677
               G TLR GWG +
Sbjct: 329 FPFQGRTLRTGWGKE 343

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 66/164 (40%), Gaps = 11/164 (6%)

Query: 593 IAAAMGGDADNRTVYIGNINPRSKVEDICNVVR-GGILQNVKFIEDK-----RICFVTFI 646
           +A   G +  +R +Y+GN++       +    + GG + NVK + DK        FV + 
Sbjct: 24  LATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYR 83

Query: 647 EASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAF 706
           +   A    A   +D   +  N +++ W  QS  +       + VG   ++ V + +   
Sbjct: 84  QPRDAN--VAFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVG---DLNVDVDDETL 138

Query: 707 KDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDS 750
              F   P + + H  + + S       F ++GE E+     D+
Sbjct: 139 SSTFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDA 182

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 7/102 (6%)

Query: 604 RTVYIGNINPRSKVEDICNV-VRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662
           RTVY+GNI+PR   ED+  + V+ G ++ + +  DK    +   +  A  +F  +S +D 
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDK---VLDTHQGYAFIEFLNDSTVDY 63

Query: 663 IV-LHGNTLRVGWGNQSGPLPKSI--ALAVTVGANRNVYVSL 701
           ++ L GNT  V    +S  + KS     A   G N+N+ V +
Sbjct: 64  VLKLFGNTNLVSLYERSLKIRKSENGKEANANGTNKNIDVDM 105

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 729 EQLRKDFTTYGEIEQIN-YLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYE 787
           ++L KDF  +GE+ +I   +    C  + F +I+SA+R +E+        ++K F     
Sbjct: 297 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSYLYNKYFKT--- 353

Query: 788 GLIINYGKD 796
              I YGKD
Sbjct: 354 -WTIWYGKD 361

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 729 EQLRKDFTTYGEIEQIN-YLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYE 787
           ++L KDF  +GE+ +I   +    C  + F +I+SA+R +E+        ++K F     
Sbjct: 298 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSYLYNKYFKT--- 354

Query: 788 GLIINYGKD 796
              I YGKD
Sbjct: 355 -WTIWYGKD 362

>Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON}
           YDL209C (REAL)
          Length = 348

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 5/71 (7%)

Query: 728 QEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFH--KKFNNR 785
           + ++R  F+  G+I++I Y++D  C +V F + ASA    ++   N     H  K++++R
Sbjct: 157 ESRVRFVFSRLGDIDRIRYVEDKSCAFVKFKHQASA-EFAKEAMSNQTLLLHSDKEWDDR 215

Query: 786 YE--GLIINYG 794
            E  GL++ + 
Sbjct: 216 KEGTGLLVKWA 226

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 730 QLRKDFTTYGEIEQIN-YLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRY-E 787
           +L KDF  +GEI +I   +    C  + F +I+SA+R +E+      E+     NN+Y +
Sbjct: 299 ELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAMEEY-----EQKGSGLNNKYFK 353

Query: 788 GLIINYGKD 796
              I YGKD
Sbjct: 354 TWTIWYGKD 362

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 75/188 (39%), Gaps = 14/188 (7%)

Query: 585 DRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVR-GGILQNVKFIEDK----- 638
           D+   +  +A   G +  +R +Y+GN++     + +    + GG + NVK + DK     
Sbjct: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103

Query: 639 RICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVY 698
              FV + +   A    A   +D   + GN +++ W  QS  +       + VG   ++ 
Sbjct: 104 NYAFVEYHQPHDAN--VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVG---DLN 158

Query: 699 VSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFI 758
           V + +      F   P + + H  + + S       F ++ E +      +S      FI
Sbjct: 159 VDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQ---GFI 215

Query: 759 NIASAIRL 766
               AIR+
Sbjct: 216 LNGRAIRI 223

>TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa]
           {ON} Anc_8.670 YOR242C
          Length = 378

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 730 QLRKDFTTYGEIEQIN-YLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEG 788
           ++R DF  +G+++ I   +    C  ++F ++ SAIR ++D    +   + K F N    
Sbjct: 306 EIRHDFGIFGKVQDIAPIVSRKLCISISFYSVHSAIRAMDDYEDPSSALYKKYFKN---- 361

Query: 789 LIINYGKD 796
             + YGKD
Sbjct: 362 WAVWYGKD 369

>Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 729 EQLRKDFTTYGEIEQIN-YLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYE 787
           ++L KDF  +GE+ +I   +    C  + F +I+SA+R +E+     G   + K+   ++
Sbjct: 298 QELEKDFRNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYGQ-KGSYINTKY---FK 353

Query: 788 GLIINYGKD 796
              I YGKD
Sbjct: 354 AWTIWYGKD 362

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 600 DADNRTVYIGNINPRSKVEDICNVVRG-GILQNVKFIEDKRICFVTF---IEASAAAQFC 655
           D  N TV++GN+N +   +++  V    G ++ VK    K+  FV F   I+A A+    
Sbjct: 318 DPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGL 377

Query: 656 ANSFIDPIVLHGNTLRVGW 674
              F+      G+ +R+ W
Sbjct: 378 QGYFV-----AGSPIRISW 391

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 9/81 (11%)

Query: 603 NRTVYIGNINPRSKVEDICNV-VRGGILQNVKFIEDKRICFVTF---IEASAAAQFCANS 658
           N TV+IG +  +     + ++ +  G + NV+  + K   FV F   I+A AA Q     
Sbjct: 366 NTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQG---- 421

Query: 659 FIDPIVLHGNTLRVGWGNQSG 679
            +   ++ GN +R+ WG  SG
Sbjct: 422 -MQGFIVGGNPIRLSWGRSSG 441

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 112,485,143
Number of extensions: 5236179
Number of successful extensions: 15138
Number of sequences better than 10.0: 169
Number of HSP's gapped: 15624
Number of HSP's successfully gapped: 241
Length of query: 1050
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 930
Effective length of database: 39,721,479
Effective search space: 36940975470
Effective search space used: 36940975470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)