Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B02343g8.843ON53753725800.0
YML116W (ATR1)8.843ON54248816860.0
Skud_13.258.843ON53752316390.0
Suva_13.278.843ON55349516260.0
Smik_13.188.843ON54553316230.0
SAKL0D01386g8.843ON52152115720.0
NDAI0E002808.843ON54950915410.0
Kwal_27.102458.843ON51550015220.0
NCAS0B002908.843ON54252815040.0
KLTH0C03806g8.843ON52549814720.0
KNAG0J002608.843ON55051414730.0
NCAS0A02540singletonON53950514610.0
KNAG0G034308.843ON54249714560.0
Kpol_541.168.843ON52850314390.0
NCAS0C004008.843ON51750614370.0
TDEL0B005508.843ON53750614170.0
NDAI0K004008.843ON55348614170.0
CAGL0M03003g8.843ON55851214160.0
Suva_13.4678.843ON54351113860.0
TBLA0D032708.843ON55049513610.0
KAFR0B039408.843ON54750813610.0
TPHA0C047908.843ON55648113610.0
YMR279C8.843ON54053613560.0
KAFR0B03930singletonON55550813550.0
Skud_13.4518.843ON53950813410.0
TBLA0D03280singletonON58050013221e-177
Smik_13.4928.843ON54353313061e-175
KAFR0A028408.843ON52050312831e-172
TBLA0C01160singletonON60048411171e-146
Smik_15.560na 1ON5165108091e-101
KLTH0C10560gna 1ON5155127963e-99
Skud_15.545na 1ON5165107842e-97
YOR378Wna 1ON5155157791e-96
Suva_8.435na 1ON5155147599e-94
KLLA0B00352gna 1ON4984767431e-91
Kwal_23.6547na 1ON5114657232e-88
TDEL0G04950singletonON5125056797e-82
KNAG0D00130na 1ON5655295107e-57
SAKL0C06116gsingletonON1851894469e-52
KAFR0C04860na 1ON5344734027e-42
CAGL0L02519gna 1ON5294523674e-37
NCAS0A05720na 1ON5635093438e-34
NDAI0K02730singletonON6045353139e-30
YKR105C (VBA5)singletonON5822051242e-06
Skud_13.2442.473ON5621181143e-05
KLLA0C18931gna 2ON5532311143e-05
SAKL0A00726gsingletonON5982051134e-05
Kpol_1039.192.242ON5732551135e-05
Skud_15.4748.783ON5222391125e-05
Smik_16.81na 3ON6252091126e-05
SAKL0A08228gsingletonON5691441126e-05
KLLA0E24113g8.570ON5751391101e-04
TDEL0C045802.241ON5572341091e-04
SAKL0C05588gsingletonON6772081091e-04
TDEL0A024902.473ON554781081e-04
NCAS0C03460na 3ON6301301082e-04
NDAI0B037702.242ON5712291072e-04
KLTH0D16962gsingletonON5711271072e-04
TDEL0G03260singletonON6121671063e-04
YGR224W (AZR1)na 3ON6131471063e-04
SAKL0E08756g2.242ON5651391053e-04
KLTH0C10120gsingletonON6511541046e-04
SAKL0E02992g2.473ON570781028e-04
NCAS0G029902.242ON5811391020.001
KLTH0C10142gsingletonON5731301020.001
KLLA0F03311g2.242ON5422281010.001
Skud_7.560na 3ON6421471010.001
SAKL0D04510gna 4ON5311931000.001
TPHA0I017608.570ON6532381000.002
TDEL0D038003.245ON6402051000.002
Smik_11.368singletonON5801961000.002
Smik_6.24na 5ON544458990.002
Kwal_34.15746na 2ON518508980.002
KLLA0A04631g8.272ON57949980.003
YIL121W (QDR2)2.241ON542285980.003
ABL040W2.473ON567112980.003
CAGL0J09944g2.242ON592133980.003
ZYRO0A01474g2.242ON538233970.003
Kwal_14.728singletonON568130970.003
CAGL0G08624g2.242ON583235970.003
KLTH0B00594gsingletonON618144970.004
CAGL0B02079gna 3ON624208960.004
KLTH0B00132gsingletonON568130960.005
Suva_10.11singletonON540214940.009
TPHA0G031502.473ON600133930.011
YOR306C (MCH5)8.783ON521212920.012
Skud_16.503singletonON543134920.015
Skud_18.3singletonON590170920.015
KNAG0K01020singletonON599223910.018
SAKL0F00440gsingletonON544487910.020
TPHA0B037705.284ON520135900.021
YIL120W (QDR1)2.242ON563242900.021
Suva_9.702.242ON565210900.022
YPR198W (SGE1)singletonON543143900.024
Skud_6.16na 5ON549456890.030
Suva_4.2753.245ON683140890.032
KAFR0J009302.242ON566234880.045
NDAI0D010202.242ON592174880.045
Smik_15.4888.783ON522156870.047
AGR076C8.272ON686245880.050
Kpol_543.448.272ON64348870.051
SAKL0E08778g2.241ON600232870.053
Skud_14.2672.242ON562145870.061
Skud_9.482.241ON599249860.064
TBLA0B044808.570ON608165860.065
Suva_8.3588.783ON522187860.067
ZYRO0C01430g8.272ON59082860.069
Smik_14.2622.242ON561137860.076
Kwal_23.48242.242ON553137850.092
TBLA0E037902.241ON550243850.097
YNL065W (AQR1)2.242ON586137840.11
ADL258W2.242ON534132840.11
TBLA0A01270singletonON522184840.13
TBLA0A03460singletonON568116840.14
TDEL0F039908.272ON63173840.14
KLTH0H16214gsingletonON551128830.16
NDAI0D016805.284ON516128830.18
Skud_2.1553.245ON688140820.22
YBR043C (QDR3)3.245ON689140820.24
TBLA0B00840singletonON637116820.25
Smik_2.1613.245ON689140810.29
Kpol_1003.112.241ON581220810.29
KLLA0B06798g3.245ON663206810.30
Suva_14.2762.242ON562137810.30
KNAG0B049005.284ON516128810.30
SAKL0H16808g8.272ON65748810.32
SAKL0B12716gsingletonON632130810.33
Ecym_7258na 6ON638125810.34
Suva_9.712.241ON561220800.34
ACL172C3.245ON631135800.36
Smik_3.206singletonON10953750.36
TDEL0D06610singletonON49767800.38
KLTH0G09372g2.242ON551142800.39
Kwal_26.7984na 6ON612130800.40
TBLA0A03470singletonON578116800.42
TBLA0G025502.242ON613138780.59
SAKL0D04070g3.245ON667204780.60
ZYRO0E10230gsingletonON558233780.62
Skud_3.172na 7ON521157780.64
ZYRO0F08228gsingletonON649140780.71
TBLA0F030408.272ON90699770.88
SAKL0H09328g8.570ON596251770.89
Smik_17.11singletonON544134770.91
TBLA0E038002.242ON608245770.91
NCAS0C036002.242ON572236770.95
KLTH0E13222g8.570ON566244770.99
AGR195W8.570ON619272771.0
SAKL0C02178gsingletonON565183761.1
Kwal_26.9616singletonON562127761.2
Suva_4.4318.570ON572155761.2
KLLA0F17776gna 8ON553166751.4
NDAI0F020606.155ON502144751.5
KLTH0E03234gsingletonON521205751.5
SAKL0E04246gna 8ON565214751.6
Suva_14.4na 7ON518157742.0
ABL210CsingletonON478109742.0
ZYRO0G21890gsingletonON57696742.1
TBLA0A014201.451ON572104742.2
TBLA0A03500singletonON573100742.2
ZYRO0G21868gna 9ON620143732.3
TPHA0A017508.272ON63671732.3
TDEL0C045902.242ON529230732.3
TBLA0A03440singletonON503111732.3
NCAS0B020108.570ON530167732.4
KNAG0D052307.511ON453128722.9
Kwal_23.48142.241ON529168723.1
CAGL0M06281g8.570ON542100723.4
Kpol_1048.458.570ON648146723.5
TBLA0A10540singletonON493115723.7
KLTH0G09350g2.241ON563127723.8
KLTH0D06710gna 6ON611138724.0
KLTH0B10384gsingletonON551118714.2
ZYRO0F14652g8.570ON566106714.3
CAGL0J09020g7.309ON85651714.6
KAFR0J016202.242ON570127714.9
SAKL0D02508gsingletonON579117715.2
TDEL0D06570singletonON566227705.5
TPHA0C031002.241ON602137705.9
Skud_2.423na 10ON560227706.1
Kwal_27.121738.570ON567195706.2
SAKL0F00198gsingletonON537209706.6
Suva_13.174na 11ON541136706.6
NCAS0B064802.241ON587172706.6
KLTH0H05698g6.155ON503127697.1
YBR293W (VBA2)na 10ON474146697.2
Kwal_27.12832singletonON508117698.3
YCR098C (GIT1)na 7ON518157689.2
Smik_2.434na 10ON474182689.3
KLTH0E00132gsingletonON582117689.7
KLTH0A00440gsingletonON582117689.7
Skud_8.1075.284ON522128689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B02343g
         (537 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   998   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   654   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   635   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   630   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   629   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   610   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      598   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   590   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      583   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   571   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   572   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   567   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   565   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   558   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      558   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   550   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               550   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   550   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   538   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   528   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   528   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   528   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   526   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   526   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   521   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   513   e-177
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   507   e-175
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   498   e-172
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   434   e-146
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   316   e-101
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   311   3e-99
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   306   2e-97
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   304   1e-96
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   296   9e-94
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   290   1e-91
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   283   2e-88
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   266   7e-82
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   201   7e-57
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   176   9e-52
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     159   7e-42
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   145   4e-37
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            136   8e-34
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   125   9e-30
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    52   2e-06
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    49   3e-05
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    49   3e-05
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    48   4e-05
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    48   5e-05
Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {...    48   5e-05
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    48   6e-05
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    48   6e-05
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    47   1e-04
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    47   1e-04
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    47   1e-04
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    46   1e-04
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    46   2e-04
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    46   2e-04
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    46   2e-04
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               45   3e-04
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    45   3e-04
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    45   3e-04
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    45   6e-04
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    44   8e-04
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    44   0.001
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    44   0.001
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    44   0.001
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    44   0.001
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    43   0.001
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    43   0.002
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    43   0.002
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    43   0.002
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    43   0.002
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    42   0.002
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    42   0.003
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    42   0.003
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    42   0.003
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    42   0.003
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    42   0.003
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    42   0.003
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    42   0.003
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    42   0.004
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    42   0.004
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    42   0.005
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    41   0.009
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    40   0.011
YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON} ...    40   0.012
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    40   0.015
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    40   0.015
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    40   0.018
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    40   0.020
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               39   0.021
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    39   0.021
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    39   0.022
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    39   0.024
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    39   0.030
Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON...    39   0.032
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    39   0.045
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    39   0.045
Smik_15.488 Chr15 complement(839667..841235) [1569 bp, 522 aa] {...    38   0.047
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    39   0.050
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    38   0.051
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    38   0.053
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    38   0.061
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    38   0.064
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    38   0.065
Suva_8.358 Chr8 complement(630597..632165) [1569 bp, 522 aa] {ON...    38   0.067
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    38   0.069
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    38   0.076
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    37   0.092
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    37   0.097
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    37   0.11 
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    37   0.11 
TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {O...    37   0.13 
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     37   0.14 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    37   0.14 
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    37   0.16 
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    37   0.18 
Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON...    36   0.22 
YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}  ...    36   0.24 
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    36   0.25 
Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON...    36   0.29 
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    36   0.29 
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    36   0.30 
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    36   0.30 
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               36   0.30 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    36   0.32 
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    36   0.33 
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    36   0.34 
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    35   0.34 
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    35   0.36 
Smik_3.206 Chr3 complement(303825..304154) [330 bp, 109 aa] {ON}...    33   0.36 
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    35   0.38 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    35   0.39 
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    35   0.40 
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     35   0.42 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    35   0.59 
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    35   0.60 
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    35   0.62 
Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON...    35   0.64 
ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} simila...    35   0.71 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    34   0.88 
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    34   0.89 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    34   0.91 
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    34   0.91 
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    34   0.95 
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    34   0.99 
AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic ...    34   1.0  
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    34   1.1  
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    34   1.2  
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    34   1.2  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    33   1.4  
NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {O...    33   1.5  
KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {...    33   1.5  
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    33   1.6  
Suva_14.4 Chr14 (4495..6051) [1557 bp, 518 aa] {ON} YCR098C (REAL)     33   2.0  
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    33   2.0  
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    33   2.1  
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    33   2.2  
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    33   2.2  
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    33   2.3  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    33   2.3  
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    33   2.3  
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...    33   2.3  
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     33   2.4  
KNAG0D05230 Chr4 complement(952025..953386) [1362 bp, 453 aa] {O...    32   2.9  
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    32   3.1  
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    32   3.4  
Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON} (1178...    32   3.5  
TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON}             32   3.7  
KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} simila...    32   3.8  
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...    32   4.0  
KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {...    32   4.2  
ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]...    32   4.3  
CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highl...    32   4.6  
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    32   4.9  
SAKL0D02508g Chr4 (197981..199720) [1740 bp, 579 aa] {ON} simila...    32   5.2  
TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa] ...    32   5.5  
TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.2...    32   5.9  
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    32   6.1  
Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]...    32   6.2  
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    32   6.6  
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    32   6.6  
NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa] ...    32   6.6  
KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} simila...    31   7.1  
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    31   7.2  
Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR2...    31   8.3  
YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}  ...    31   9.2  
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    31   9.3  
KLTH0E00132g Chr5 (3262..5010) [1749 bp, 582 aa] {ON} weakly sim...    31   9.7  
KLTH0A00440g Chr1 (37100..38848) [1749 bp, 582 aa] {ON} weakly s...    31   9.7  
Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W ...    31   9.7  

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/537 (92%), Positives = 499/537 (92%)

Query: 1   MGIFRKSGTDSVQQETLXXXXXXXXFKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTL 60
           MGIFRKSGTDSVQQETL        FKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTL
Sbjct: 1   MGIFRKSGTDSVQQETLSSSSSGSSFKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTL 60

Query: 61  KEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISG 120
           KEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISG
Sbjct: 61  KEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISG 120

Query: 121 RIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIV 180
           RIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIV
Sbjct: 121 RIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIV 180

Query: 181 GSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFV 240
           GSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFV
Sbjct: 181 GSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFV 240

Query: 241 LSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXX 300
           LSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAY          
Sbjct: 241 LSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVL 300

Query: 301 XXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHY 360
              AFFIYELHFVNGNPLLPKEVLKSPKTIIVLFAL                 QLNLRHY
Sbjct: 301 LLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHY 360

Query: 361 TPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYF 420
           TPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYF
Sbjct: 361 TPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYF 420

Query: 421 RNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVE 480
           RNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVE
Sbjct: 421 RNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVE 480

Query: 481 QHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKDSAVVEIAK 537
           QHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKDSAVVEIAK
Sbjct: 481 QHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKDSAVVEIAK 537

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/488 (63%), Positives = 377/488 (77%), Gaps = 1/488 (0%)

Query: 38  QCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQ 97
           Q + + +D NQKWQNP YF    +EYLF+ +C +SQLLNQAG  QT  IMNI++DS  S+
Sbjct: 44  QSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSE 103

Query: 98  NGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSF 157
              ++WLMA+FPL+SGSFILISGR+GDIYGLKK LLVGY+ +I+WSLICG+TKY+ SD+F
Sbjct: 104 GNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTF 163

Query: 158 FIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIG 217
           FI+SRAFQGLGI+ +LPN+LGI+G+IY+ G+ RKN+VIS +G MAPIGATLG +F+GLIG
Sbjct: 164 FIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIG 223

Query: 218 TEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFV 277
           TED  QWPWAFY+Y+I A INFVLSI+ IP+TIPTN+H   MDWIGS LGV+GLI+LNFV
Sbjct: 224 TEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFV 283

Query: 278 WNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALX 337
           WNQAPI GW+ AY              F IYE+ F    PLLP+ V+K    I ++ AL 
Sbjct: 284 WNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAK-TPLLPRAVIKDRHMIQIMLALF 342

Query: 338 XXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILF 397
                           QLN+R YT LWAGGTYFMFLIWGI+AAL+VGFTIK V PS+ LF
Sbjct: 343 FGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLF 402

Query: 398 LSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMA 457
            SMVAFN GSI+ SVTP+H+TYFR  LG MIILSFGMDLSFPASSI+ SD LP++YQGMA
Sbjct: 403 FSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMA 462

Query: 458 GSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALML 517
           GSLVNT+VNYSMS CLG+   VE  VN+ GK +LKGYRGA YLGIGLAS+AC+ISG  M+
Sbjct: 463 GSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMV 522

Query: 518 SEIIQGRK 525
              I+GR+
Sbjct: 523 ESFIKGRR 530

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/523 (58%), Positives = 380/523 (72%), Gaps = 5/523 (0%)

Query: 6   KSGTDSVQQETLXXXXXXXXFKQDNND---IVDEKQCDTQAIDGNQKWQNPEYFDSTLKE 62
           +S  DS + E           + D N+    +     +   +D  Q+WQNP YF ++  E
Sbjct: 11  ESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVD-KQRWQNPNYFKNSWHE 69

Query: 63  YLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRI 122
           YLF+ +C +SQLLNQAG  QT  IMNI+A+S  S    + WLMA+FPL+SGSFILISGR+
Sbjct: 70  YLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRL 129

Query: 123 GDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGS 182
           GDIYGLKK L +GY+ +I+WSLICGLTKY+ SD+FFI+SRAFQGLGI+ +LPN+LGI+G+
Sbjct: 130 GDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGN 189

Query: 183 IYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLS 242
           IY++G+ RKN+VISL+G MAP+GATLG +F+GLIGT++  QWPWAFY+Y IT+ IN  LS
Sbjct: 190 IYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALS 249

Query: 243 IWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXX 302
           ++ IPN IPTN+    MDWIGS LGV+GL+++NFVWNQAPI GWD AY            
Sbjct: 250 VYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFL 309

Query: 303 XAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTP 362
             F IYE  F   +PLLP+ VLK    I ++ AL                 QLN+RHY+ 
Sbjct: 310 VVFIIYENRFAK-SPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSA 368

Query: 363 LWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRN 422
           +WAGGTYFMFLIWGI+AAL+VG  IKKV PS+ LFLSM+AFN GSI+ SVTP+H+TYFR 
Sbjct: 369 VWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRT 428

Query: 423 HLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQH 482
            LG MIILSFGMD SFPASSI+ SD LP++YQGMAGSLVNT+VNYSMS CLG+   VE H
Sbjct: 429 QLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETH 488

Query: 483 VNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRK 525
           V+  GK VLKGYRGA YLGIGLAS+ACIISG  M+  II+  K
Sbjct: 489 VDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHK 531

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/495 (61%), Positives = 375/495 (75%), Gaps = 4/495 (0%)

Query: 40  DTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNG 99
           + + +   QKWQNP YF    +EYLF+ +C +SQLLNQ+G  QT  IMNI+ADS  S   
Sbjct: 57  EDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDAN 116

Query: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI 159
            ++WLMA+FPL+SGSFILISGR+GDI+GLK  LL+GY+ +I+WSLICGLTKY+ SD+FFI
Sbjct: 117 SRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFI 176

Query: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE 219
           VSRAFQGLGI+ +LPN+LGI+G++Y+ G+ RKN+VIS IG MAPIGATLG  F+GLIGT 
Sbjct: 177 VSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTM 236

Query: 220 DANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWN 279
           + NQWPWAFY+Y ITA IN +LSI+ IPN IPTNVH   MDWIGSGLGV+GL++LN VWN
Sbjct: 237 NPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWN 296

Query: 280 QAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXX 339
           QAPI GW+ AY              F +YE+HF   +PLLP+ V+K    I ++ +L   
Sbjct: 297 QAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAK-SPLLPQAVMKDRHMIQIMLSLFFG 355

Query: 340 XXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLS 399
                         QLN+RHYTPLWAGG+YFMFLIWGI+AAL+VGF+IK+V PS+ LF +
Sbjct: 356 WGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFA 415

Query: 400 MVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGS 459
           MVAFN GSI+ SVTP+H+TYFR  +G MIILSFGMDLSFPASSI+ SD LP++YQGMAGS
Sbjct: 416 MVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGS 475

Query: 460 LVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSE 519
           LVNT+VNYSMS CLG+   VE  ++  GK +LKGYRGA YLGIGLAS+ACIISG  M+  
Sbjct: 476 LVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVEC 535

Query: 520 IIQGRKNEKDSAVVE 534
            I   K+ +  AV E
Sbjct: 536 YI---KDHRAKAVAE 547

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/533 (58%), Positives = 382/533 (71%), Gaps = 19/533 (3%)

Query: 5   RKSGTDSVQQETLXXXXXXXXFKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYL 64
           +KS  D+  +ETL                      + + ++ NQKWQNP+YF    +EYL
Sbjct: 28  KKSSRDNGSEETLRGTAF--------------TNLEDEMVECNQKWQNPKYFKYAWQEYL 73

Query: 65  FLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGD 124
           F+ +C +SQLLNQAG  QT  IMNI++DS  S+   ++WLMA+FPL+SGSFILISGR+GD
Sbjct: 74  FIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGD 133

Query: 125 IYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIY 184
           IYGLKK LLVGY+ +I+WSLICG+T Y+ SD+FFI+ RAFQGLGI+ +LPN+LGI+G+IY
Sbjct: 134 IYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIY 193

Query: 185 IAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIW 244
           + G+ RKN+VIS +G MAPIGATLG +F+GLIGTE+ NQWPWAFY+++I + INF LSI+
Sbjct: 194 VGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIY 253

Query: 245 LIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXA 304
            IPN IPTN+H   MDWIGS LGV+GLI+LNFVWNQAPI GW  AY              
Sbjct: 254 AIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAV 313

Query: 305 FFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLW 364
           F IYE+ F   +PLLP  V+K    I ++ AL                 QLN+RHYT LW
Sbjct: 314 FIIYEMWFAK-SPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALW 372

Query: 365 AGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHL 424
           AGGTYFMFLIWGI+AAL+VGFTIK V PS+ LF SMVAFN GSI+ SVTP+H+TYFR  L
Sbjct: 373 AGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQL 432

Query: 425 GMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVN 484
           G MIILSFGMDLSFPASSI+ SD LP++YQGMAGSLVNT+VNYSMS CLG+   VE  ++
Sbjct: 433 GTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLD 492

Query: 485 NHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRK----NEKDSAVV 533
             GK +LKGYRGA YLGIGLAS+AC+ISG  M+   I   K     E D A  
Sbjct: 493 PDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATENDCATT 545

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/521 (57%), Positives = 380/521 (72%), Gaps = 16/521 (3%)

Query: 26  FKQDNNDIVDE-KQCDTQAIDG----------NQKW---QNPEYFDSTLKEYLFLCSCFV 71
           FK+ N  +  + K+  TQ+             ++KW   Q+P YF +  KEYLF+ +  +
Sbjct: 3   FKRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMM 62

Query: 72  SQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKT 131
           SQLLNQAG  QT  ++NI++ + DS   +Q WLMA+FPL+SGSFIL+SG+IGDIYGLKKT
Sbjct: 63  SQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKT 122

Query: 132 LLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRK 191
           LLVGY+  I+WSLICGLT Y  S  FFI+SRAFQGLGI+ ILPNI+GIVG+IY+AG+ RK
Sbjct: 123 LLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRK 182

Query: 192 NMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIP 251
           NMVISLIG  APIGAT+G +FSGLIGT  + +W W FY+Y ITAAIN  LSIW+IPNTIP
Sbjct: 183 NMVISLIGACAPIGATMGVLFSGLIGTL-SERWAWTFYAYTITAAINMGLSIWVIPNTIP 241

Query: 252 TNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELH 311
           TNV G  MDWIGSG+G++G+I+ NFVWNQ PI GWD+AY             AFF+YE  
Sbjct: 242 TNVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETK 301

Query: 312 FVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFM 371
           + N +PL+P+  + + + ++ L A+                  LNLR YTPLWAGG+YFM
Sbjct: 302 YAN-DPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFM 360

Query: 372 FLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILS 431
           FLIWGI+AA+ VG+TIK++ PS+ILFLSM+AF+CG I++SVTP+ QTYFR  LGMMIILS
Sbjct: 361 FLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILS 420

Query: 432 FGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVL 491
           FGMDLSFPASSI+LSD+LP++ QGMAGSLV+TM+NYSMS CLG+AG VE  +N +G D+L
Sbjct: 421 FGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLL 480

Query: 492 KGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKDSAV 532
           KGYR A YLGIGLAS+   IS   ML   ++ R+      V
Sbjct: 481 KGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEEV 521

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/509 (56%), Positives = 375/509 (73%), Gaps = 6/509 (1%)

Query: 27  KQDNNDIVDEK----QCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQ 82
           K++NN++ +++    + +   I  + KWQNP+YF +  +EYLF+ SC +SQLLNQA   Q
Sbjct: 36  KEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQ 95

Query: 83  TQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVW 142
           T  IMNI+ DS  S+ GK+ WL+A+FPL+SGSFILISGRIGDIYGLKKTL+ GYLF I+W
Sbjct: 96  TLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIW 155

Query: 143 SLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA 202
           SLI G T Y+H+D FFI+SRAFQGLGI+ ILPN++GIVG+IY   ++RKN+VIS+IG  A
Sbjct: 156 SLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASA 215

Query: 203 PIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWI 262
           PIGA +G++F+GLIGTE+  QWPWAFY++AI +AIN  +SI+ IPN IPTN+HG  MDWI
Sbjct: 216 PIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWI 275

Query: 263 GSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKE 322
           GS + V+GLI+LNFVWNQ PI GW  AY              FF YE+ +   +P+LP E
Sbjct: 276 GSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAK-SPILPVE 334

Query: 323 VLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALV 382
           V K+   I++L AL                  LNLRHY+ LWAG TYFMF IWG VAA++
Sbjct: 335 VTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVI 394

Query: 383 VGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASS 442
           VG  IK++  S+ILF SM+AFN G I++SVTP+ QTYFR +LG MIILSFGMD+SFPA++
Sbjct: 395 VGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAA 454

Query: 443 ILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGI 502
           I+LSD L +QYQGMAGSL NTMVNYSMS CLG+   VE+ +N  GK++LKGYR A YLG+
Sbjct: 455 IILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYLGV 514

Query: 503 GLASMACIISGALMLSEIIQGRKNEKDSA 531
           GLA +  +ISG  M +E++  ++ E+ S+
Sbjct: 515 GLAGLGIVISGIYM-AEVLWAKRKERLSS 542

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/500 (56%), Positives = 372/500 (74%), Gaps = 2/500 (0%)

Query: 28  QDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIM 87
           Q ++   +E+   T+AI    + QNP+YFD   KEY+F+ S  +SQLLNQA   QT P+ 
Sbjct: 16  QSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLF 75

Query: 88  NIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICG 147
           ++++  L+++  +Q WLMA+FPL+SGSFIL+SG++GDIYGLKKTLL GY+ +++WSLICG
Sbjct: 76  DVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICG 135

Query: 148 LTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGAT 207
           L+ YAH+  FF+V+R+FQGLGI+ +LPN++GIVG+IY   ++ KN+V SLIG  APIGAT
Sbjct: 136 LSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGAT 195

Query: 208 LGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLG 267
           LG VFSGLIG    + W W FY+YAITAA+N ++++W+IPN IPTNV+ +KMDWIGS +G
Sbjct: 196 LGCVFSGLIGAR-TDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIG 254

Query: 268 VVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSP 327
           V GLI+ NFVWNQAPI GW SAY             AF  YE+ F    PLLP  VL + 
Sbjct: 255 VFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAK-QPLLPHSVLFNR 313

Query: 328 KTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTI 387
           K +++L +L                  LNLRHY+PLWAGGTYFMF IWGIVA+L+VG+TI
Sbjct: 314 KLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTI 373

Query: 388 KKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSD 447
            K  P++ILFLSMVAF+CG I+++VTP+HQTYFR  LG+MIILSFGMDLSFPA+SI+LSD
Sbjct: 374 HKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSD 433

Query: 448 KLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASM 507
           +LP QYQGMAGSLV+TM++YSMS CLG++G  E  VN +G D+LKGY+ A Y+GIGLAS+
Sbjct: 434 QLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASL 493

Query: 508 ACIISGALMLSEIIQGRKNE 527
             +ISGA M+ +    R+  
Sbjct: 494 GVVISGAFMIEDWWTSRRKR 513

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/528 (57%), Positives = 383/528 (72%), Gaps = 7/528 (1%)

Query: 6   KSGTDSVQQETLXXXXXXXXFKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLF 65
           +S   S+ +ET          ++   D++   Q +T  ++ + KWQNP+YF +  +EYLF
Sbjct: 17  ESAASSITEET--SIIKHGDIEEIEKDVIS--QTETPQLE-HSKWQNPDYFQNQWQEYLF 71

Query: 66  LCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDI 125
           + SC +SQLLNQA   QT  IMNI+ DS +S+ GK+ WL+A+FPL+SGSFILISGRIGDI
Sbjct: 72  IFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDI 131

Query: 126 YGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYI 185
           YGLKKTL+ GY+F I+WS+I GLTKY+HSD+FFIVSRAFQGL I+ ILPN++GIVG+IY 
Sbjct: 132 YGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYK 191

Query: 186 AGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWL 245
             S RKN+VIS+IG  APIGA  G++F+GLIGTED +QWPWAFY++AI +A N  +SI+ 
Sbjct: 192 PDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYS 251

Query: 246 IPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAF 305
           IPN++PTNVHG  MDWIGS L V+GLI+LNFVWNQ PI GW +AY              F
Sbjct: 252 IPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALF 311

Query: 306 FIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWA 365
           F YE+ +   +PLLP EV K+   I++L AL                  LNLRHY+ LWA
Sbjct: 312 FTYEVKYAE-SPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWA 370

Query: 366 GGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLG 425
           G TYFMF IWG VAA++VG  IKK+  + ILF+SMVAFN G I++SVTP+ QTYFR +LG
Sbjct: 371 GTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLG 430

Query: 426 MMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNN 485
            MIILSFGMD+SFPA++I+LSD L +QYQGMAGSL NTMVNYSMS CLG+   VE+ +N 
Sbjct: 431 TMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINK 490

Query: 486 HGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKDSAVV 533
            G D+LKGYRGA YLGIGLA +  II+ A+ L EI+ G++ +  +A V
Sbjct: 491 SGNDLLKGYRGAEYLGIGLAGLGIIIT-AIYLGEILWGKRKQHLAANV 537

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/498 (56%), Positives = 357/498 (71%), Gaps = 2/498 (0%)

Query: 30  NNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNI 89
           +  +VD  +     +    + QNP+YFD   KEYLF+ S  +SQLLNQA A+Q  P+ ++
Sbjct: 18  SRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDL 77

Query: 90  VADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149
           +++ L ++  +QAWLMA+FPL+SGSFIL+SG++GDIYGLKKTLL GY  +++WSLICGL+
Sbjct: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137

Query: 150 KYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLG 209
            YAH+  FFIV+R+FQGLGI+ +LPN+ GIVG+IY   +K KNMV S+IG  APIGATLG
Sbjct: 138 SYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLG 197

Query: 210 AVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVV 269
            +FSGLIGTE +  W W FY+Y I AA+N +++ ++IP+ IPTNVH  KMDW+GS LGV 
Sbjct: 198 CLFSGLIGTE-SEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVC 256

Query: 270 GLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKT 329
           GLIM NFVWNQAP DGWDSAY              F I+E  F    PLLP+ VL + K 
Sbjct: 257 GLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAK-EPLLPRAVLFNRKL 315

Query: 330 IIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKK 389
           +++L +L                  LNLRHYTPLWAGG+YFMF I+G +AA +VG TI K
Sbjct: 316 MMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHK 375

Query: 390 VYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKL 449
             P+IIL  S++AF+ G I++SVTP+ QTYFR  LG M+ILSFGMDLSFPASSI+LSD+L
Sbjct: 376 TGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQL 435

Query: 450 PLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMAC 509
           P QYQGMAGSLVNTM+NYSMS CLGV+G  E+ VN  G D+LKGYR A Y+GIGLAS+  
Sbjct: 436 PSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGI 495

Query: 510 IISGALMLSEIIQGRKNE 527
            +SGA  + +    R+  
Sbjct: 496 FVSGAYAIEDWWTRRRER 513

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/514 (53%), Positives = 356/514 (69%), Gaps = 11/514 (2%)

Query: 9   TDSVQQETLXXXXXXXXFKQDNNDIVDEKQCDTQA----------IDGNQKWQNPEYFDS 58
           T ++ ++ +         K D  ++ ++K C T++           D +  WQNP YF +
Sbjct: 11  TKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFAN 70

Query: 59  TLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILI 118
             +EY F+ +C ++QLLNQAG  Q    MNI+AD+ +S   KQ WLMA+FPL+SGSFIL+
Sbjct: 71  RWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILV 130

Query: 119 SGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILG 178
           SGRIGDIYGLKKTL+ GYL +++WSLICG   Y H+D+FFI+ RAFQGLGI+ ILPN++G
Sbjct: 131 SGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMG 190

Query: 179 IVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAIN 238
           ++G+IY A + RKN VIS +G  APIGA LG V+SGLI  E+  QWPW FY+YAI  AIN
Sbjct: 191 LIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAIN 250

Query: 239 FVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXX 298
            V++I+ IP+T+PTN+HG  MDW GS +GVVG+I+ NFVWNQ PIDGW+  Y        
Sbjct: 251 MVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVS 310

Query: 299 XXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLR 358
                AFFIYE+ F   +PLLP EV+K+    ++L A+                 QLNLR
Sbjct: 311 VFLLIAFFIYEIKFAK-SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLR 369

Query: 359 HYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQT 418
           HY+ +WAGGT+FMF+IWG +AA +V  TIK+V PS++L  SM  F  G I++SVTP+HQ+
Sbjct: 370 HYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQS 429

Query: 419 YFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGV 478
           Y++ +LGM IILSFGMDLSFPASSI+LSD LP QYQGMAGSLVNTMVNYS S CLGV   
Sbjct: 430 YWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGST 489

Query: 479 VEQHVNNHGKDVLKGYRGAFYLGIGLASMACIIS 512
            E  VN +G D LKGYR A Y+GIGL +   +++
Sbjct: 490 AEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVA 523

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/505 (53%), Positives = 358/505 (70%), Gaps = 5/505 (0%)

Query: 27  KQDNNDIVDEKQCDTQA----IDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQ 82
            +D N   +EK+  + +    +D +  WQNP YF S  KEY F+ +C V+ LLNQAG  Q
Sbjct: 23  NEDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQ 82

Query: 83  TQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVW 142
               MN++++S  S +GKQ WLMA+FPL+SGSFILISGRIGDIYGLKKT++ GY+F+I+W
Sbjct: 83  VLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 142

Query: 143 SLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA 202
           SL+CG   + H+D+FFIV RAFQGLGIS ILPN++G++G+IY  G+ RKN+VIS+IG  A
Sbjct: 143 SLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTA 202

Query: 203 PIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWI 262
           P GA +GA++ GLI TE+A QWPW FY+YA+T  +N +++++ +PN IPTNVH   MDWI
Sbjct: 203 PTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWI 262

Query: 263 GSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKE 322
           GS +GVVGLI+ NFVWNQ P+ GWD AY             AF +YEL +   +PLLP E
Sbjct: 263 GSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPI-SPLLPVE 321

Query: 323 VLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALV 382
           V K+ + + +L  L                 QLNLR Y+P+W GGTYFMF+IWG +AAL+
Sbjct: 322 VTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALI 381

Query: 383 VGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASS 442
           V FTIKKV P+I+LF S + F  GS+++SVTPIHQ Y+R +LGM IIL FGMDLSFPASS
Sbjct: 382 VAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASS 441

Query: 443 ILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGI 502
           I+LSD LP+QYQGMAGSLVNT++NY+ S CLG+   VE+ +N  G+D+LKGYR A YL +
Sbjct: 442 IILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAV 501

Query: 503 GLASMACIISGALMLSEIIQGRKNE 527
           GL  +   I+   +   +   R++ 
Sbjct: 502 GLGGLGSCIAFINLCYTLWMKRRDR 526

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/497 (55%), Positives = 354/497 (71%), Gaps = 1/497 (0%)

Query: 35  DEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSL 94
           +E        D N KWQ+  YF +  +EY+F+ +C +SQLLNQA   QT  +MNI+  S 
Sbjct: 41  NETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSF 100

Query: 95  DSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHS 154
            S    Q WLMA+FPL+SGSFILISGR+GDIYGLK +L+ G +F I+W+LI G T Y HS
Sbjct: 101 HSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHS 160

Query: 155 DSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSG 214
           D+FFIVSR+FQGLG++ ILPN++G VG+IY   + RKN+VISLIG  AP+GA +GA F+G
Sbjct: 161 DTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAG 220

Query: 215 LIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIML 274
           LIGT++ + WPW+FY+ AI + +  + +++ IPN IPTNVHG  MDWIGSGL VVGLI+L
Sbjct: 221 LIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILL 280

Query: 275 NFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLF 334
           NFVWNQ PIDGW  AY              FFIYE+H+   +PLLP+ + ++   +++L 
Sbjct: 281 NFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYA-ASPLLPRVITQNRHMVMILM 339

Query: 335 ALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSI 394
           AL                  LNLRHY+ +WAGGTYFMF IWG+VA++VVG +I+K+  SI
Sbjct: 340 ALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASI 399

Query: 395 ILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQ 454
           ILF SM+AF+ G I++SVTP+ QTYFR +LG MIILSFGMD+SFPA++I+LSD LP QYQ
Sbjct: 400 ILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQ 459

Query: 455 GMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGA 514
           GMAGSL NTMVNYSMS CLG+   VE  +N +GKD+LKGYR A YLGIG+AS+A I+S  
Sbjct: 460 GMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLI 519

Query: 515 LMLSEIIQGRKNEKDSA 531
            M   +   RK   +S 
Sbjct: 520 YMCERLWIDRKERMEST 536

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/503 (54%), Positives = 356/503 (70%), Gaps = 4/503 (0%)

Query: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86
           + D +D  DE          N   +NP+YF+ST +EY F+ SC +SQLLN AG  QT  I
Sbjct: 22  RSDCSDANDESPSMELK---NSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSI 78

Query: 87  MNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLIC 146
           MN++   L S +  + WL+A+FPL+SGSFIL+SGR+GDIYGLKK L++GY+ L++WSLI 
Sbjct: 79  MNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLIT 138

Query: 147 GLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206
           GL+ Y+HS  FFI++RAFQGLGISL+LPN+LG++G IY  G+ +KNMVIS++G M+PIGA
Sbjct: 139 GLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGA 198

Query: 207 TLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGL 266
           TLG +FSGL+ TE    WPWAFY+Y + A IN  +S + IPN IPTNV+   MDWIGS  
Sbjct: 199 TLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFT 258

Query: 267 GVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKS 326
           GV+GLI+ NFVWNQAP DGW+SAY             AF IYEL +   NPLLP E++++
Sbjct: 259 GVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAE-NPLLPSEIIRN 317

Query: 327 PKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFT 386
            + I++L A+                  LNLR+Y+PLWAGG+YF+F+I G + A+  GF 
Sbjct: 318 RQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 377

Query: 387 IKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLS 446
           +KK+ P+++L  SMV FN G II SVTP+HQTYFRN LG MIIL  GMDLSFPASSI+LS
Sbjct: 378 MKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILS 437

Query: 447 DKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLAS 506
           D LP Q+QGMAGSLVNT++NYS S  LG+AG VEQH N +G D+L+GYRGA Y GI  + 
Sbjct: 438 DNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSG 497

Query: 507 MACIISGALMLSEIIQGRKNEKD 529
           +A +I+G  M+  I    K+ K+
Sbjct: 498 VAVLIAGLYMVETIFDSYKDRKE 520

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/506 (52%), Positives = 356/506 (70%), Gaps = 5/506 (0%)

Query: 28  QDNNDIVDEKQCDTQAIDG----NQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQT 83
           ++   IV   Q  T + D     +  WQN +YF S LKEY F+ +C  + LLNQAG  Q 
Sbjct: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61

Query: 84  QPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWS 143
              MN++++S  S  G Q WLMA+FPL+SGSFILISGRIGDIYGLKKT++ GY+F+I+W+
Sbjct: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121

Query: 144 LICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAP 203
           L+CG   Y HSD+FFIV RAFQGLGIS ILPNI+G+VG+IY  G+ RKN+VISLIG  AP
Sbjct: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181

Query: 204 IGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIG 263
            GA +GA++ GLI TE + QWPW FY+YA+ A +N +++I+ +P  +PTNVH   MDW+G
Sbjct: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241

Query: 264 SGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEV 323
           + +GVVGLI+ NFVWNQ P++GW   Y             AF IYEL F   +PLLP+EV
Sbjct: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPI-SPLLPREV 300

Query: 324 LKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVV 383
            K+ + + +L  L                 QLNLR+Y+PLWAG T+FMF+IWG +AA +V
Sbjct: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360

Query: 384 GFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSI 443
           GFTI +V P+++LF S + F  GS+++SVTPIHQTY+R ++GM IILSFGMDLSFPASSI
Sbjct: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420

Query: 444 LLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIG 503
           +LSD LP+QYQGMAGSLVNT++NYS S CLG+   VE+ +N  G+++L+GYR A YL +G
Sbjct: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVG 480

Query: 504 LASMACIISGALMLSEIIQGRKNEKD 529
           L  +   ++   +  ++ + RK+  D
Sbjct: 481 LGGLGACVAFLNLCYDLWRKRKSRLD 506

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/506 (51%), Positives = 356/506 (70%), Gaps = 1/506 (0%)

Query: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86
            +++  +  EK+      +    WQ+P YF     E LF+ SC + QLLNQAG+  T   
Sbjct: 28  SREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLST 87

Query: 87  MNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLIC 146
           M ++   LDS + K +WLMA+FPL+SGSFILISGR+GDIYGLKK LL+GY++L +WSLIC
Sbjct: 88  MKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLIC 147

Query: 147 GLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206
           GL+ ++H+D+FFI SRAFQGLGIS +LPN+LGIVG+IY  G++RKN+VISLIG  APIGA
Sbjct: 148 GLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGA 207

Query: 207 TLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGL 266
           T G +F+G++     + WPWAFY+Y I A +  ++S ++IPN+IP NV+   MDWIGS L
Sbjct: 208 TFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSAL 267

Query: 267 GVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKS 326
           GV GL++ NFVWNQ+ + GW + Y              FFI+E+ +    PLLPKEV +S
Sbjct: 268 GVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAK-VPLLPKEVTES 326

Query: 327 PKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFT 386
              I++L +L                  L LR+Y+P+WAGGT+FM  I G +AAL VGF+
Sbjct: 327 RSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFS 386

Query: 387 IKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLS 446
           IK+V P+++LF SM+AF CGSII+SVTP+H+TYFR+ LG M+ILSFGMDLSFPA+SI+LS
Sbjct: 387 IKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILS 446

Query: 447 DKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLAS 506
           D+L +QYQGMAGSLVNT+VNYSMS  LG+ G +E+ +N  G  +L+G+R A Y  IG+ S
Sbjct: 447 DELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGS 506

Query: 507 MACIISGALMLSEIIQGRKNEKDSAV 532
           +  +ISG  +L + +   K+ K++ +
Sbjct: 507 LGILISGVFVLQKELMRSKSRKENEL 532

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/486 (56%), Positives = 349/486 (71%), Gaps = 4/486 (0%)

Query: 45  DGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWL 104
           + N  WQNP+YF S+ KEY+F+ +C ++ LLNQAG  Q    MN+++DS  S  G Q WL
Sbjct: 58  ENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWL 117

Query: 105 MAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAF 164
           MA+FPL+SGSFILISGR+GDIYGLK+ ++ G++F+I+WSLICG T YAHSD+FFIV+RAF
Sbjct: 118 MASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAF 177

Query: 165 QGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQW 224
           QGLGIS ILPN++G+VG+IY  G+ RKN+VISLIG MAP G+  GA++ GLI TE+  QW
Sbjct: 178 QGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQW 237

Query: 225 PWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPID 284
           PW FY+YA+ AA+  V+  + +P+ IPTNV+G  MDWIGS LGV+GLI+ NFVWNQ PI 
Sbjct: 238 PWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIV 297

Query: 285 GWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXX 344
           GW+ AY             AFF+YE+ +    PLLPK V ++   + +L  L        
Sbjct: 298 GWEKAYIIVLLIVSVIFLIAFFVYEIKYAK-VPLLPKAVTQNGHILTILTVLFLGWGSFG 356

Query: 345 XXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFN 404
                    QLNLR Y+P+W+GGT+F+F+I+G VAA  V  TIKKV P+I+LF S + F 
Sbjct: 357 IWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFT 416

Query: 405 CGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTM 464
           CGSIIMSVTP+HQTY+RN  GM IIL FGMDL FPASSI+LSD LP+QYQGMA SLVNT+
Sbjct: 417 CGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTI 476

Query: 465 VNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASM-ACIISGALMLSEIIQG 523
           VNYS S CLG+   VE+ +N  G D+LKGYR A Y G+G+A + ACI    L +   I  
Sbjct: 477 VNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACI--AFLNVCHDIWS 534

Query: 524 RKNEKD 529
           ++N KD
Sbjct: 535 KRNAKD 540

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/512 (56%), Positives = 367/512 (71%), Gaps = 6/512 (1%)

Query: 28  QDNND--IVDEKQCDTQAIDGNQK---WQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQ 82
           Q N+D   V  K C     D ++    +QNPEYF++  KE +F+ SC V+QLLNQAG  Q
Sbjct: 46  QSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQ 105

Query: 83  TQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVW 142
           +   MN++AD   S + KQ WLMA+FPL+SGSFILISGR+GDIYGLKK L VGY+ + +W
Sbjct: 106 SLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLW 165

Query: 143 SLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA 202
           S+ICGL KY +SD+FFIV R+FQGLGI+ ILPNI+G+VG+IY  G+ RKN+VIS IGCMA
Sbjct: 166 SIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMA 225

Query: 203 PIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWI 262
           P GA LGA+F GLI TEDA QWPW FY++ I + +N +L+++ IPN +PTN++   MDWI
Sbjct: 226 PAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWI 285

Query: 263 GSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKE 322
           GS LGV GL++LN VWNQAPI GW  AY              F +YE+ +   +PLLP  
Sbjct: 286 GSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYAT-SPLLPPS 344

Query: 323 VLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALV 382
           VL++ K +++L AL                 QLNLR YTPLWAGGT+FMF+IWG VAA V
Sbjct: 345 VLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFV 404

Query: 383 VGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASS 442
           V  TIKKV P+++L  SMVAF+CGSI++SVTP+HQTY+R ++GM IILSFGMDLSFPASS
Sbjct: 405 VALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASS 464

Query: 443 ILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGI 502
           I+LSD LP+QYQGMAGSLVNT+VNYS S CLG+   VEQ  N HG D+LKGYR A YL I
Sbjct: 465 IILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAI 524

Query: 503 GLASMACIISGALMLSEIIQGRKNEKDSAVVE 534
           GLAS    +S   ++++II  R  ++  +  E
Sbjct: 525 GLASAGVCVSLVFLVTDIIAKRHRKRIESECE 556

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/511 (51%), Positives = 356/511 (69%), Gaps = 2/511 (0%)

Query: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86
            +D +         +  +  +  WQ+P YF S  +E +F+ +C ++QLLNQAG      I
Sbjct: 34  SEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTI 93

Query: 87  MNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLIC 146
           MN+++ S +S++ KQAWLMA+FPL++GSFILISGR+GDIYGLKK L++GY+ +IVWSLIC
Sbjct: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLIC 153

Query: 147 GLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206
           GL+KY+++D+FFI  RAFQGLGI+ ILPN++G+VG +Y  GS RKN+VIS IG  AP G 
Sbjct: 154 GLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGG 213

Query: 207 TLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGL 266
             G +F GLI  ED+ QWPW FY++AI   +N +L+ + IPN IPTNVHG  MDW GS L
Sbjct: 214 MFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVL 273

Query: 267 GVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKS 326
            V+GLI+ NFVWNQAP  GW +AY             AFF+YE+ +    PLLP  V K+
Sbjct: 274 AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAK-VPLLPHAVTKN 332

Query: 327 PKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFT 386
              I++L A+                 QLNLRHY+P+W GGTYF+F+I+G +AA +V  +
Sbjct: 333 RHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALS 392

Query: 387 IKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLS 446
           IK+V P+ +L  ++VAF+ GSI+ SV P+ Q++++ + GM  IL FGMDLSFPASSI+LS
Sbjct: 393 IKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILS 452

Query: 447 DKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLAS 506
           D LP++YQGMAGSLVNT++NYS S CLG+   VE  +N +GKD+LKGYRGA YLG+GLAS
Sbjct: 453 DGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLAS 512

Query: 507 MACIISGALMLSEIIQGRKN-EKDSAVVEIA 536
           +  +IS   ML      R++ +KDS + E++
Sbjct: 513 LGVLISFTYMLETFWNNRRDRQKDSVITEMS 543

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/495 (51%), Positives = 345/495 (69%), Gaps = 1/495 (0%)

Query: 30  NNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNI 89
           N+ +      DT   D +  +QNP+YF +  +E+ F+ S  + QLL+QAG  QT  IMN+
Sbjct: 42  NSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNV 101

Query: 90  VADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149
           +A  LDS + +QAWLM++FPL  GSFIL+SGR+GDIYGLKK LL GY+   VWS+ICGL+
Sbjct: 102 LAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLS 161

Query: 150 KYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLG 209
            YAH+D+FFI +RAFQGLG++  LPN++G++G+IY  G  RKNM+IS+IG M+P GATLG
Sbjct: 162 SYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLG 221

Query: 210 AVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVV 269
            +F+GL    D + WPW+FY++ + + +N ++S + IPN+IPTN+HG KMDW+GS LGV 
Sbjct: 222 GLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVF 281

Query: 270 GLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKT 329
           GLI+LNFV+NQAPI GW SAY              F +YE+ +    PL+PK +  +   
Sbjct: 282 GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK-TPLIPKAISSNRGM 340

Query: 330 IIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKK 389
           +++LF+L                 +LNLRHY+PLWAG +YF+F+I G   A+V G TIKK
Sbjct: 341 LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKK 400

Query: 390 VYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKL 449
           + PS++   SM+ F  G+II + TP++QT+FRN LG M +L  GMD SFPASSI+LSD L
Sbjct: 401 IKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSL 460

Query: 450 PLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMAC 509
           P+QYQGMAGSLVNT++NYS S CLG+AG VE   N+HGKD+L GYR A Y  IGLA +A 
Sbjct: 461 PMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAV 520

Query: 510 IISGALMLSEIIQGR 524
            +SG  M+  + + R
Sbjct: 521 CVSGGYMIECLWKDR 535

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/508 (50%), Positives = 343/508 (67%), Gaps = 8/508 (1%)

Query: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86
           K+D   I D+   D  +I  N KWQ+P YF S+ +EY F+ +C ++ LLNQAG  QT   
Sbjct: 41  KKDQISITDD---DVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLST 97

Query: 87  MNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLIC 146
           MN++ADSL+S    + WLMA+F L SGSFIL+SGRIGDIYGLK T + G +   +WS++C
Sbjct: 98  MNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILC 157

Query: 147 GLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206
           G++KY  + +FFI+ RAFQGLG++ +LPN++G+VG+IY  GS RKN+VIS IGCMAP+G 
Sbjct: 158 GVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQ 217

Query: 207 TLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGL 266
           T G ++ GLI   + +QWPW F++ AI   IN ++ I+ IPN +PTN++  KMDWIGS L
Sbjct: 218 TFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLL 277

Query: 267 GVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKS 326
           GV+GLI++NFVWNQAPI GW  AY             AFFIYEL     +PLLP EV K+
Sbjct: 278 GVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAE-SPLLPPEVTKN 336

Query: 327 PKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFT 386
              + ++ +L                  LNLRH++PLWAG T+F+F+I+G + A+ V FT
Sbjct: 337 RHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFT 396

Query: 387 IKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLS 446
           I KV PS++  LS + F CG+II SVT   QTY+RN LGM IIL+ GMDLSFP SSI+LS
Sbjct: 397 INKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILS 456

Query: 447 DKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLAS 506
           D LP+QYQGM+GSLVNT+ NY+ S CLG+    E   NN GKDVLKGYR A Y+ IGL +
Sbjct: 457 DLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGA 516

Query: 507 MACIISGALMLSEI----IQGRKNEKDS 530
           +    S + M  ++     + R+NEK  
Sbjct: 517 LGFAFSFSYMAEDLWIRYRKRRQNEKKE 544

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/481 (52%), Positives = 330/481 (68%), Gaps = 1/481 (0%)

Query: 51  QNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPL 110
           Q P+YF S L E+ F+ +C + QLLNQAG  Q+  IMNI+A+   S+  KQAWL A+FPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 111 ISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGIS 170
           +SGSFIL+ GR GDIYGLKK LL+GY  L +WS+ICGLT Y HSD FFIV++AFQGLG+S
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 171 LILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYS 230
            ILPNI+G+VG+IY  GS +KN+ IS IG MAP+GAT G +FSG++  +D   WPW FY+
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 231 YAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAY 290
           +AI + +  V   + +P+ +PTN +  KMDWIGS +GVVGL++ +FVWNQAP+DGWD AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 291 XXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXX 350
                        AFFIYE+++    PLLPK +  +   I++L A+              
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAE-VPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYY 364

Query: 351 XXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIM 410
               LNLRH++P+W GG YF F++ G   A  VGF IK + PSIIL +S+  F  G++I 
Sbjct: 365 FSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIF 424

Query: 411 SVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMS 470
           +VTP  QTY+RN  GMM++L  GMDLSFPASSI+LSD+LP +YQGMAGSLVNTMVNYS S
Sbjct: 425 AVTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQS 484

Query: 471 FCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKDS 530
           FCLGVA  VE+ +N+ G D+LKGYR AFY G+G+ ++   I+   M        K +   
Sbjct: 485 FCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKL 544

Query: 531 A 531
           A
Sbjct: 545 A 545

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/536 (49%), Positives = 358/536 (66%), Gaps = 7/536 (1%)

Query: 3   IFRKS----GTDSVQQETLXXXXXXXXFKQDNNDIVDEKQCDTQA--IDGNQKWQNPEYF 56
           IF+K     GTDS   E +             ++ V      T++  +  +  WQ+P YF
Sbjct: 4   IFKKKTSVQGTDSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYF 63

Query: 57  DSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFI 116
            S  KE +F+ +C ++QLLNQAG      IMN+++ S +S+   QAWLMA+FPL +GSFI
Sbjct: 64  SSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFI 123

Query: 117 LISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNI 176
           LISGR+GDIYGLKK L+VGY+ +IVWS+I GL+KY++SD+FFI SRAFQG+GI+ ILPNI
Sbjct: 124 LISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNI 183

Query: 177 LGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAA 236
           +G+VG +Y  GS RKN+VIS IG  AP G   G +F GLI TED NQWPW FY++ I   
Sbjct: 184 MGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATF 243

Query: 237 INFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXX 296
           ++ +++ + IPN +PTN+HG  MDW GS L ++GLI+ NFVWNQAPI GWD  Y      
Sbjct: 244 LSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLI 303

Query: 297 XXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLN 356
                  AFF+YE  +    PLLP+ + K+   I++L A+                 QLN
Sbjct: 304 ISVIFLVAFFVYESKYAE-VPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLN 362

Query: 357 LRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIH 416
           LRHY+P+W GGTYF+F+I+G +AA  V F+IK++ P+++L  S++AF+ GSI+ SV P+ 
Sbjct: 363 LRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVE 422

Query: 417 QTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVA 476
           Q+Y++ +  M  IL FGMDLSFPASSI+LSD LP+QYQGMAGSLVNT++NYS S CLG+ 
Sbjct: 423 QSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMG 482

Query: 477 GVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKDSAV 532
           G VE  +N  G D+LKGYR A YLG+GLAS+  +IS   ML  +    +  +D ++
Sbjct: 483 GTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSL 538

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/508 (50%), Positives = 334/508 (65%), Gaps = 12/508 (2%)

Query: 3   IFRKSGTDSVQQETLXXXXXXXXFKQDNNDIVDEKQCDTQAIDG-----------NQKWQ 51
           I   SG    ++  +           D++  V EK       +G           N  WQ
Sbjct: 11  ITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQ 70

Query: 52  NPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLI 111
           NP YF S  KEYLF+ +C +S LLNQAG  Q    MN++  + ++ +  + WLMA+FPL+
Sbjct: 71  NPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLV 130

Query: 112 SGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISL 171
           SGSFIL+SGRIGDIYGLK+T++ G + +I+WSLICG   Y+ S +FFI+ RAFQGLGI+ 
Sbjct: 131 SGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAF 190

Query: 172 ILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSY 231
           +LPN++G+VG+IY  GS RKN+VIS IG  AP GA  GA ++GLI T+   QWPW FY+Y
Sbjct: 191 VLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAY 250

Query: 232 AITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYX 291
           A    +N VL+I+ IP+T+P NVHG  MDW GS +GV+GLI+ NFVWN+API GW+ AY 
Sbjct: 251 AFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYI 310

Query: 292 XXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXX 351
                        FFIYE+ F   +PLLP+ V  +   I++L A+               
Sbjct: 311 IVLLIFSLLIIVVFFIYEIKFAK-SPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYY 369

Query: 352 XXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMS 411
              LNLR YTPL AG ++ MF++WG +AA  V FTIK+V PS++LF SMVAF  GSI++S
Sbjct: 370 AFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLS 429

Query: 412 VTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSF 471
           +TP+HQTY++   GM IIL+FGMDLSFPASSI+LSD LP++YQGMAGSLVNT+VNYS S 
Sbjct: 430 ITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSL 489

Query: 472 CLGVAGVVEQHVNNHGKDVLKGYRGAFY 499
           CLG+    E  VN +G D+LKGYR A Y
Sbjct: 490 CLGMGTTAEIQVNKNGTDLLKGYRAALY 517

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/508 (51%), Positives = 349/508 (68%), Gaps = 9/508 (1%)

Query: 27  KQDNNDIV--DEK------QCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQA 78
           K+++  IV  DE+         +  I  +  WQ+P YF S  KE +F+ +C ++QLLNQA
Sbjct: 25  KEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLNQA 84

Query: 79  GAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLF 138
           G      IMN+++ S  S++  QAWLMA+FPL +GSFILISGR+GDIYGLKK L++GY+ 
Sbjct: 85  GQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVI 144

Query: 139 LIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLI 198
           +IVWS+I GL+KY+++DSFFI  RAFQG+GI+ ILPNI+G+VG +Y  GS RKN+VIS+I
Sbjct: 145 IIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVI 204

Query: 199 GCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHK 258
           G   P GA  G VF GLI TED NQWPW FY++ I   I+ +++ + IPN +PTNVHG  
Sbjct: 205 GACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLS 264

Query: 259 MDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPL 318
           MDW GS L V+GLI+ NFVWN+API GWD AY             AFF+YE+ +    PL
Sbjct: 265 MDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAE-VPL 323

Query: 319 LPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIV 378
           LP  V K+   I++L A+                 QLNLRHY+P+W GGTYF+F I+G +
Sbjct: 324 LPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTI 383

Query: 379 AALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSF 438
           AA  V F+IK++ P+++L  +++AF+ GSI+ SV P+ Q+Y++ +  M  +L FGMDLSF
Sbjct: 384 AAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSF 443

Query: 439 PASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAF 498
           PASSI+LSD LP+QYQGMAGSLVNT++NYS S CLG+   VE  +N  GK+VL+GYR A 
Sbjct: 444 PASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAV 503

Query: 499 YLGIGLASMACIISGALMLSEIIQGRKN 526
           YLGIGLAS+  +IS   ML  +   RK 
Sbjct: 504 YLGIGLASLGVLISVTYMLETVWNERKK 531

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  513 bits (1322), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 247/500 (49%), Positives = 346/500 (69%), Gaps = 1/500 (0%)

Query: 31  NDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIV 90
           + + ++   +++ +    K  +P+YF +   EYLF+ SC VSQ ++QAG  Q   IMNI+
Sbjct: 67  SSVSNDSDINSENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNIL 126

Query: 91  ADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTK 150
           A+ L+++  +QAWLMA+F L  GSFIL+SGR+GDIYGLKK LL GY  L +WSLICG + 
Sbjct: 127 AEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSS 186

Query: 151 YAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGA 210
           Y+H+D+FFI SRAFQGLG++ +LPN LG++G IY  GS +KNM+I  +G M+PIGATLG 
Sbjct: 187 YSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGG 246

Query: 211 VFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVG 270
           +F+G+IGT+D  QWPW+FYS+ I +  N +LS + IPN IPTN++   MDWIG+ LG+ G
Sbjct: 247 LFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFG 306

Query: 271 LIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTI 330
           L++LNFV+NQAPI GW SAY              F +YE+ +    PL+PK +  +   +
Sbjct: 307 LLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK-TPLIPKAISSNRGML 365

Query: 331 IVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKV 390
           ++LFAL                  LN+R YT  WAGG+YF+F++ G   A + GF +KKV
Sbjct: 366 MILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKV 425

Query: 391 YPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLP 450
            PS+IL++SM+ F  G ++++VTPIHQ+YF+N LG+M +L  G+DLSFPA+SI+LSD LP
Sbjct: 426 PPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALP 485

Query: 451 LQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACI 510
           +QYQGMAGSLV T+ NYS S CLG+AG VE + N++G+++LKGYR A      LA +  I
Sbjct: 486 IQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGII 545

Query: 511 ISGALMLSEIIQGRKNEKDS 530
           +SG  M+  +I  R+N K +
Sbjct: 546 VSGIYMVINLITIRENSKST 565

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  507 bits (1306), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 263/533 (49%), Positives = 357/533 (66%), Gaps = 7/533 (1%)

Query: 3   IFRKS----GTD-SVQQETLXXXXXXXXFKQDNNDIVD-EKQCDTQAIDGNQKWQNPEYF 56
           IF+K     GTD  +  +T+           ++ ++       ++  +  +  WQ+P YF
Sbjct: 4   IFKKKMSVQGTDYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYF 63

Query: 57  DSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFI 116
            S  KE +F+ +C ++QLLNQAG      IMN+++ S +S++  QAWLMA+FPL +GSFI
Sbjct: 64  SSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFI 123

Query: 117 LISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNI 176
           LISGR+GDIYGLKK LL+GY+ +I+WS+I GL+KY++SD+FFI  RAFQGLGI+ ILPNI
Sbjct: 124 LISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNI 183

Query: 177 LGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAA 236
           +G+VG +Y  GS RKN+VIS+IG  AP G   G VF GLI TED  QWPW FY+++I   
Sbjct: 184 MGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATF 243

Query: 237 INFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXX 296
           I+ +++ + IPN +PTNVHG  MDW GS L V+GLI+ NFVWNQAPI GW  AY      
Sbjct: 244 ISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLI 303

Query: 297 XXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLN 356
                  AFF+YE+ +    PLLP  V K+   I++L A+                 QLN
Sbjct: 304 LSVFFLIAFFVYEIKYAE-VPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLN 362

Query: 357 LRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIH 416
           LRHY+P+W GGTYF+F+I+G +AA  V F+IK++ P+I+L  +++AF+ GSI+ SV P+ 
Sbjct: 363 LRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVE 422

Query: 417 QTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVA 476
           Q+Y++ +  M  IL FGMDLSFPASSI+LSD LP+QYQGMAGSLVNT++NYS S CLG+ 
Sbjct: 423 QSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMG 482

Query: 477 GVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKD 529
             VE+ +N  G+++LKGYR A YLGIGLAS+  +IS   ML       K  + 
Sbjct: 483 VTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEK 535

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  498 bits (1283), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 258/503 (51%), Positives = 349/503 (69%), Gaps = 5/503 (0%)

Query: 32  DIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVA 91
           D    ++C+   +    KWQ+P YF ++ +EYLF+ SC  +QLLNQA   QT  IMN+++
Sbjct: 20  DKSSNEKCEV-IVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLS 78

Query: 92  DSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKY 151
           DS +S    Q WL+A+FPL++GSFILISGRIGDIYGLKKTL+ GY+FLI+WSLICG T Y
Sbjct: 79  DSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYY 138

Query: 152 AHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAV 211
           + SD+F I++RAFQGLGI+  LPN++G +G+IY  GS RKNMVISLI   AP+GA +G  
Sbjct: 139 SKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGA 198

Query: 212 FSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGL 271
           F+GLI TE  +QWPW+FY++AI  + N ++SI+ IP+ IPTNV+G KMDWIGS L V GL
Sbjct: 199 FAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGL 258

Query: 272 IMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTII 331
           I+ NF WNQ PI GWD AY             AF  YE++F   +PL+ +E+  S   II
Sbjct: 259 ILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAP-SPLIAREITHSRNMII 317

Query: 332 VLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVY 391
            +F L                  LNLRHY+P+WAGG+YF+F I+G++A+  VG +IKK+ 
Sbjct: 318 TIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKIT 377

Query: 392 PSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPL 451
             +IL  SMV F  G+ ++SV P+ Q+YF+  L  M IL  G+D SFPA++I+LSD LP+
Sbjct: 378 APVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPM 437

Query: 452 QYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACII 511
           +YQGMAGSL  TMVNYSMS CLG+   VE+ +N  G+DVLKGYR A YLGIGL+ +  ++
Sbjct: 438 EYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIGLSGLGLLL 497

Query: 512 SGALMLSEIIQGRKNE---KDSA 531
           +  L++ +++   +N+   K+SA
Sbjct: 498 ACILVIDKLVAKYRNKNSIKNSA 520

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  434 bits (1117), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 216/484 (44%), Positives = 303/484 (62%), Gaps = 1/484 (0%)

Query: 44  IDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAW 103
           I  +Q  + P+ F +  +E+ F+    + Q L+Q G  Q    MNI+A+ L +   +Q W
Sbjct: 104 ITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPW 163

Query: 104 LMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRA 163
           LMAAFPL  G  ILISGR+GDI+GLKK LL+GY+   +W+LICG + YAHSD  FIVSR 
Sbjct: 164 LMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRT 223

Query: 164 FQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQ 223
           FQGLG++  LPN+  ++G IY     +KNM+  +IG M+PIGATLG +F+GL    +   
Sbjct: 224 FQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKN 283

Query: 224 WPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPI 283
           WPW+FYS+AI A +N +++ + IPN I  N  G KMDWIGS LG+ GL++LNFV+NQ PI
Sbjct: 284 WPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPI 343

Query: 284 DGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXX 343
           DGW SAY              F IYEL   N  PL+PK +  + + I++L  L       
Sbjct: 344 DGWSSAYLIVLLVVSVVALILFVIYELTMANF-PLIPKGIHSNYRLILILLTLFCGWGGF 402

Query: 344 XXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAF 403
                     QLNLRHY+PLWA  + F+ +I G +  ++    ++++ P I+LF SM+ F
Sbjct: 403 AIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGF 462

Query: 404 NCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNT 463
             G+I+ +VTPIHQT+FRN  G M +   GM  SFP++S++ ++ LP  Y+ MAGSLVN 
Sbjct: 463 LGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNV 522

Query: 464 MVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQG 523
            +NY+ S C+G+AG    + NNHG+D+L G+R A YL IGL+  +  +SG  M+  I   
Sbjct: 523 AINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTD 582

Query: 524 RKNE 527
           R  +
Sbjct: 583 RNQK 586

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  316 bits (809), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/510 (37%), Positives = 282/510 (55%), Gaps = 26/510 (5%)

Query: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86
           K+D+  + DE   D Q        + PE   S L E  F+     +QL+ QAG  Q+   
Sbjct: 20  KKDDEVLSDE--FDVQE-------EKPE---SLLWESAFVGVLCSAQLMTQAGLGQSLAP 67

Query: 87  MNIVADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145
           ++I+ DS  + N G+ +W  +A+ L  G+FILI+GR+GDI+G KK  ++G+ +  +WSL+
Sbjct: 68  LHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127

Query: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIG 205
            G + Y++   FF   RAFQG+G + +LPN + I+G  Y  G +RKNMV SL G  AP G
Sbjct: 128 AGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMVFSLFGASAPGG 185

Query: 206 ATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHG------HKM 259
             LGAVFS ++G      WPWA++   I   +  V   +LIP+T   N          ++
Sbjct: 186 FVLGAVFSSMLG--QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERI 243

Query: 260 DWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLL 319
           D+ GS  GVVGLI+ NF WNQ P+ GW + Y              F   E       PLL
Sbjct: 244 DFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR--AAFPLL 301

Query: 320 PKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVA 379
           P   L S  T  VL  +                   + R  TPL +   +    I G  A
Sbjct: 302 PFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360

Query: 380 ALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFP 439
           AL+ GF +    PS ++F +M AF  G+I+++  P+HQTY+      +I++ +GMD+SFP
Sbjct: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 440 ASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFY 499
           A++I+LSD +P ++QG+A SLVNT+VNYS+S  LG+AG +E +VN+ G +VLKGYR ++Y
Sbjct: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480

Query: 500 LGIGLASMACIISGALMLSEIIQGRKNEKD 529
           LGIGL+     ++    +S  ++ +K   +
Sbjct: 481 LGIGLSGFGIFVAATYAVSTFMKSKKRVSE 510

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  311 bits (796), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 186/512 (36%), Positives = 283/512 (55%), Gaps = 21/512 (4%)

Query: 28  QDNNDIVDEKQCDTQAIDGNQKWQNPEY-----FDSTLKEYLFLCSCFVSQLLNQAGAIQ 82
           ++ N   D+        D  Q+   P +      +S L E  F+     +QL+ QAG  Q
Sbjct: 6   KEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQAGLGQ 65

Query: 83  TQPIMNIVADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIV 141
           +   ++I+ DS  ++N G+ +W  AA+ L  G+FILI+GR+GD+YG KK  ++G+ +  +
Sbjct: 66  SIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYAL 125

Query: 142 WSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCM 201
           WSL+ G + Y++   FF   RAFQG+G +L+LPN + I+G  Y+ G +RK M++SL G  
Sbjct: 126 WSLLAGFSVYSN-QIFFDCCRAFQGIGPALLLPNAIAILGRTYVPG-RRKAMILSLFGAT 183

Query: 202 APIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPN----TIPTNVHGH 257
           AP G  LGAVFS + G      WPWA+++  I      V  I +IP      + T+V  +
Sbjct: 184 APAGFVLGAVFSSIFG--QLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVSTY 241

Query: 258 -KMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGN 316
            ++D  GS  GV+GL++LNF WNQ P+ GW + Y              F   E      +
Sbjct: 242 QRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR--APH 299

Query: 317 PLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWG 376
           PLLP   L S     VL  +                    LR ++PL     +    I G
Sbjct: 300 PLLPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISG 358

Query: 377 IVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDL 436
           + AAL  GF I +V  S+++  +M AF  G I+++  P+ Q Y+      +I++ +GMD+
Sbjct: 359 LCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDM 418

Query: 437 SFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRG 496
           SFPA++I+LSD +P ++QG+A SLVN +VNYS+S  LG+AG VE  VNN G ++LKGYRG
Sbjct: 419 SFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRG 478

Query: 497 AFYLGIGLASMACIISGALMLSEIIQGRKNEK 528
           A+Y+GIGL+    +I+    + E    +K++K
Sbjct: 479 AWYMGIGLSGFGILIA---FMYEYHTFKKSKK 507

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  306 bits (784), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 182/510 (35%), Positives = 277/510 (54%), Gaps = 26/510 (5%)

Query: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86
           K+D+  ++DE   D Q           E   S L E  F+     +QL+ QAG  Q+   
Sbjct: 20  KKDDEVVLDE--FDIQ----------DETPGSLLWETAFVGVLCSAQLMTQAGLGQSLAP 67

Query: 87  MNIVADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145
           ++I+  S  + N G+ +W  +A+ L  G+FILI+GR+GDI+G KK  ++G+ +  +WSL+
Sbjct: 68  LHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLL 127

Query: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIG 205
            G + Y++   FF   RAFQG+G + +LPN + I+G  Y +G KRKNMV SL G  AP G
Sbjct: 128 AGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSG-KRKNMVFSLFGACAPGG 185

Query: 206 ATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHG------HKM 259
             LGAVFS L+G      WPWA++   I      +   ++IP+T   + H        ++
Sbjct: 186 FVLGAVFSSLLG--QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERV 243

Query: 260 DWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLL 319
           D+ GS  GV+GLI+ NF WNQ P+ GW + Y              F   E       PLL
Sbjct: 244 DFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR--AAFPLL 301

Query: 320 PKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVA 379
           P   L S  T  VL  +                   + R  TPL +   +    + G  A
Sbjct: 302 PFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCA 360

Query: 380 ALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFP 439
           AL  G+ + +  PS ++  +M AF  G+I+++  P+HQTY+      +I++ +GMD+SFP
Sbjct: 361 ALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 440 ASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFY 499
           A++I+LSD +P ++QG+A SLVNT+VNYS+S  LG+AG +E +VN+ G   LKGYR ++Y
Sbjct: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY 480

Query: 500 LGIGLASMACIISGALMLSEIIQGRKNEKD 529
           +GIGL+ +   ++     S   + +K   +
Sbjct: 481 MGIGLSGLGIFVAAIYAWSTFKKSKKRTSE 510

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  304 bits (779), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/515 (35%), Positives = 281/515 (54%), Gaps = 27/515 (5%)

Query: 29  DNNDIVDEKQCDTQAIDGNQKWQNPEYFD-------STLKEYLFLCSCFVSQLLNQAGAI 81
             +  V +K  DT A    ++ +    FD       S L E  F+     +QL+ QAG  
Sbjct: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLG 61

Query: 82  QTQPIMNIVADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLI 140
           Q+   ++I+ +S  + N G+ +W  +A+ L  G+FILI+GR+GDI+G KK  ++G+ +  
Sbjct: 62  QSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYA 121

Query: 141 VWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGC 200
           +WSL+ G + Y++   FF   RAFQG+G + +LPN + I+G  Y  G +RKNMV SL G 
Sbjct: 122 LWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMVFSLFGA 179

Query: 201 MAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNT-IPTNVHG--- 256
            AP G  LGAVFS ++G      WPWA++   I   +  V   ++IP+T +P+       
Sbjct: 180 SAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFK 237

Query: 257 --HKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVN 314
              ++D+ GS  GVVGLI+ NF WNQ P+ GW + Y              FF+    ++ 
Sbjct: 238 LLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVG-----TFFLVIFAYIE 292

Query: 315 GN---PLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFM 371
                PLLP   L S  T  VL  +                   + R  TPL +   +  
Sbjct: 293 SRAAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSP 351

Query: 372 FLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILS 431
             I G  AA+  GF +    PS ++  +M AF  G+I+++  P+HQTY+      +I++ 
Sbjct: 352 VAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMP 411

Query: 432 FGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVL 491
           +GMD+SFPA++I+LSD +P ++QG+A SLVNT+VNYS+S  LG+AG +E  VN+ G   L
Sbjct: 412 WGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPL 471

Query: 492 KGYRGAFYLGIGLASMACIISGALMLSEIIQGRKN 526
           KGYR ++Y+GIGL+ +   ++     S  ++ +K 
Sbjct: 472 KGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKR 506

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  296 bits (759), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 176/514 (34%), Positives = 273/514 (53%), Gaps = 14/514 (2%)

Query: 28  QDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIM 87
           Q N +   E       +  NQ     E   S + E  F+     +QL+ QAG  Q+   +
Sbjct: 9   QKNLETSAETTKTDDEVLLNQFELQDETPGSLVWEAAFVGVLCSAQLMTQAGLGQSIAPL 68

Query: 88  NIVADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLIC 146
           +I+ DS  + N G+ +W  +++ L  G+FILI+GR+GDI+G +K  ++G+ +  +WSL+ 
Sbjct: 69  HIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLA 128

Query: 147 GLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206
           G + Y++   FF   RAFQG+G + +LPN + I+G  Y  G KRKNMV SL G  AP G 
Sbjct: 129 GFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-KRKNMVFSLFGASAPGGF 186

Query: 207 TLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNT------IPTNVHGHKMD 260
            LGAVFS ++G      WPWA++   I   +  V   ++IP+        P+     ++D
Sbjct: 187 VLGAVFSSMLG--QLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVD 244

Query: 261 WIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLP 320
           + GS  GV+GLI+ NF WNQ P+ GW++ Y              F   E       PLLP
Sbjct: 245 FAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR--AAYPLLP 302

Query: 321 KEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAA 380
              L S     VL  +                     R  +PL +   +    I G  AA
Sbjct: 303 FAALSS-DAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAA 361

Query: 381 LVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPA 440
           +  GF +     S ++  +M AF  G I+++  P+HQTY+      +I++ +GMD+SFPA
Sbjct: 362 VTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPA 421

Query: 441 SSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYL 500
           ++I+LS+ +P ++QG+A SLVNT+VNYS+S  LG+AG +E  VN+ G + LKGYR ++Y+
Sbjct: 422 ATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWYM 481

Query: 501 GIGLASMACIISGALMLSEIIQGRKNEKDSAVVE 534
           GIGL+ +   ++     S  ++ +K   +   +E
Sbjct: 482 GIGLSGLGIFVAAVYASSTFLKSKKKASEKQYIE 515

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  290 bits (743), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 171/476 (35%), Positives = 265/476 (55%), Gaps = 19/476 (3%)

Query: 34  VDEKQCDTQAIDGNQKWQNPEYFDSTLKE---YLFLCSCFVSQLLNQAGAIQTQPIMNIV 90
           +  K+ ++     +   QN   + S LKE    + LCS   +QL+ QAG  Q+   + I+
Sbjct: 1   MSSKKLNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCS---AQLMTQAGLAQSIVPLQII 57

Query: 91  ADSLDSQN-GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149
            DS   +N G+ +W  +AF L  G+FILI+GR+GD +G KK  ++G+L+  +WS++ G +
Sbjct: 58  GDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFS 117

Query: 150 KYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLG 209
            Y++   FF   RAFQG+G +  LPN + I+   Y  G +++NM+ SL G  AP G  +G
Sbjct: 118 VYSN-QIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPG-RKQNMIFSLFGACAPSGFVVG 175

Query: 210 AVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHG-----HKMDWIGS 264
           AVFS L+   +   WPWA++   IT  +  V    +IP+  P +         ++D  GS
Sbjct: 176 AVFSSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGS 233

Query: 265 GLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVL 324
             GVVGLI+ NF WNQ P+ GW+++Y             AF   E      +PLLP   L
Sbjct: 234 VTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR--AKHPLLPVRKL 291

Query: 325 KSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVG 384
            S  TI V+  +                   NLR   PL +   +    I G+ AA+   
Sbjct: 292 SS-DTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTE 350

Query: 385 FTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSIL 444
           F + +  PS ++ ++M+AF  GSI+++  P+ QTY+      +I++ +GMD+SFPA++I+
Sbjct: 351 FLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATII 410

Query: 445 LSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYL 500
           LS  +P  +QG+A SLVNT++NYS+S  LG AG +E  +++   D+LKGYRGA+Y+
Sbjct: 411 LSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYM 466

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  283 bits (723), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 165/465 (35%), Positives = 257/465 (55%), Gaps = 13/465 (2%)

Query: 54  EYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQN-GKQAWLMAAFPLIS 112
           E   S ++E LF+     +QL+ QAG  Q+   + I+ +S    N G+ +W  AA+ L  
Sbjct: 31  EKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTV 90

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           G+FILI+GR+GD++G KK  +VG+L+  +WSL+ G + Y++   FF   RA QG+G + +
Sbjct: 91  GTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFL 149

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYA 232
           LPN + I+G  Y  G KRK MV S+ G  AP G  LG+VFS +        WPWA+++  
Sbjct: 150 LPNSIAILGRTYTPG-KRKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMG 206

Query: 233 ITAAINFVLSIWLIPNTIPTNVH-----GHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWD 287
               +  V  I +IP   P  +        ++D  G+  G++GL ++NF WNQ P+ GW 
Sbjct: 207 TACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQ 266

Query: 288 SAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXX 347
           + Y              F + E       PLLP   L S     VL  +           
Sbjct: 267 TPYTYALLIVGFVFLLVFSLIESR--ARFPLLPFAAL-STDLAYVLGCIAAGWSSFGIWI 323

Query: 348 XXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGS 407
                   + R  +PL     +    I G+ AAL  G+ +  V    ++ ++M+AF  G 
Sbjct: 324 FYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGG 383

Query: 408 IIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNY 467
           ++++  PI+QTY+      +II+ +GMD+SFPA++I++S+ +P ++QG+A SLVNT+VNY
Sbjct: 384 VLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNY 443

Query: 468 SMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIIS 512
           S+S  LG AG +E  VNN G + L+GYRGA+Y+GIGL+ +  +++
Sbjct: 444 SISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVA 488

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  266 bits (679), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 171/505 (33%), Positives = 275/505 (54%), Gaps = 31/505 (6%)

Query: 27  KQDNND-IVDEKQCDTQAIDGNQK----------WQNPEYFDSTLKEYLFLCSCFVSQLL 75
           K D  D  V   +C  ++I  NQ+          W     F    KEY F+ +  ++Q  
Sbjct: 4   KHDKEDQYVFFSECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAF 63

Query: 76  NQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVG 135
           NQAG     P++N+++DS   +     +L+ ++P++ GSF+LI GR+G+++G K+TLL G
Sbjct: 64  NQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGG 118

Query: 136 YLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSK--RKNM 193
           Y+ LI+ SL+ GL++Y+ S  F+++ RAFQG+G++LILPN        Y + +K  RK +
Sbjct: 119 YIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTI 178

Query: 194 VISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTN 253
           + ++IGC A  GA LG   SG+  T   + W WA+Y+Y I A +   LS + +P+ I   
Sbjct: 179 LSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNIT-- 236

Query: 254 VHGHKMDWIGSGLG-----VVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIY 308
               K     +GLG       GL+MLN   N A +   + ++              F ++
Sbjct: 237 ---KKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVF 293

Query: 309 ELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGT 368
           EL F + +P+  KE+  +    +VL ++                  LNLR+Y+PL AG T
Sbjct: 294 ELKF-SEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGST 352

Query: 369 YFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMI 428
           Y   +I G VA + +   +K+  P + L  S + F C  II+SVTPIHQ+YFR+ LG MI
Sbjct: 353 YLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMI 412

Query: 429 ILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGK 488
            L+ G+D SFP+S+I+L ++LP +Y  M   L N + NY++SF  G+     + +++   
Sbjct: 413 FLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSS--I 470

Query: 489 DVLKGYRGAFYLGIGLASMACIISG 513
           +++K YR  +Y  IGL+++    +G
Sbjct: 471 ELIKYYRYVYYFAIGLSAIGLFAAG 495

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  201 bits (510), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 154/529 (29%), Positives = 247/529 (46%), Gaps = 36/529 (6%)

Query: 26  FKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFD------------STLKEYLFLCSCFVSQ 73
           F   ++     +  D    D N+    PE  D            S L E +F+     SQ
Sbjct: 30  FNGGDDSSKTRRDSDDNVSDINKSAPAPEEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQ 89

Query: 74  LLNQAGAIQTQPIMNIVADSLD-SQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTL 132
           +L  AGA+Q  P M+++ +    +      W    +    GSF+LI+G++GD+ G K   
Sbjct: 90  VLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMF 149

Query: 133 LVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKN 192
           L+GY +L +WSL+ G ++Y  S  FF   RA QG+G +    + L I+G  Y    KRKN
Sbjct: 150 LIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSY-PPCKRKN 208

Query: 193 MVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPT 252
            + S  G     G  LG VFS L  T+ A  W WA++S AI   +  +LSI+ IP  +  
Sbjct: 209 FIFSFFGACGSFGVVLGMVFSALF-TQLA-HWSWAYWSMAIACVVIIILSIFFIPGDV-- 264

Query: 253 NVHGHK------MDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFF 306
            V  H+       D++G+ L V GL++ +  WNQAP  G+   Y             A  
Sbjct: 265 -VEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTY-VYVLLIVSVVILALA 322

Query: 307 IYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAG 366
           +Y    V+ +PLLP   + S  T+ VL A+                  L  +  T L A 
Sbjct: 323 MYVETKVD-DPLLPWTHI-SANTLKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAA 380

Query: 367 GTYFMFLIWGIVAALVVGFTIK-KVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLG 425
                  + G+ AAL     +   V   I + +S++AF    I+M+     QTY+     
Sbjct: 381 AKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFV 440

Query: 426 MMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQH--- 482
             I++SFG+D+SFP++++LLS+++P +++G+  SLV  ++NY+ +     A  V ++   
Sbjct: 441 TTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCP 500

Query: 483 --VNNHGKDVLKGYRGAFYLGIGLASMACIIS--GALMLSEIIQGRKNE 527
             + + G    K      Y+GIG A +  +++  G +     + G+K E
Sbjct: 501 DCMAHKGNAFTKTINIIGYVGIGTAGLGTLVAIFGVITEYPKVAGKKGE 549

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  176 bits (446), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 118/189 (62%), Gaps = 34/189 (17%)

Query: 71  VSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKK 130
           +SQLLNQ G  QT P++N+++   +S   +Q  L+A+ PL+SGSFIL+SG++GDIYGLK 
Sbjct: 2   MSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLKN 61

Query: 131 TLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKR 190
           TLL GY  +IVWS ICGLT+YA S  FF+++RAFQGLG++ +LPN++G V ++YIAGS R
Sbjct: 62  TLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSIR 121

Query: 191 KNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTI 250
           KNMV                                  Y+Y +  ++N  L +W +P  I
Sbjct: 122 KNMV----------------------------------YAYTVAVSLNMALCVWALPWNI 147

Query: 251 PTNVHGHKM 259
           PTNV G  M
Sbjct: 148 PTNVRGQAM 156

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 448 KLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVL 491
            +P   +G A      M+ YSM  CLG+AG VE  V+  G D L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  159 bits (402), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 134/473 (28%), Positives = 227/473 (47%), Gaps = 29/473 (6%)

Query: 73  QLLNQAGAIQTQPIMNIVADSLD---SQNGKQAWLMAAFPLISGSFILISGRIGDIYGLK 129
           Q ++  GA+Q  P M  +A +      QN +  W  AA+   + +F++I+G++GDI G K
Sbjct: 59  QFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHK 118

Query: 130 KTLLVGYLFLIVWSLICGLTKYAHSDS-FFIVSRAFQGLGISLILPNILGIVGSIYIAGS 188
              + GY +L +WSL+ G +KYA +++ FF   R  QG+G + + P  L ++G  Y    
Sbjct: 119 NMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHY-PPC 177

Query: 189 KRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIP- 247
           KRKN V S  G   P G   G+VFS L        W W ++S A+T  I  +LS   IP 
Sbjct: 178 KRKNYVFSFYGACGPFGIVAGSVFSALF--TQLTTWAWTYWSMAVTCLIITILSYIFIPK 235

Query: 248 NTIPTNVHG--HKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAF 305
           +  P       +  D++G   G+ G+I+ + VWNQAP+  + + Y               
Sbjct: 236 DNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMA 295

Query: 306 FIYELHFVNGNPLLPKEVLKSP--KTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPL 363
            I +      +PL+P + + S   K +IV+F                    L  ++ + L
Sbjct: 296 LIIDSRV--KDPLIPWKSMCSNVIKALIVVF---FGFLGFTIWLFYSWRFYLVAKNDSLL 350

Query: 364 WAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMV-AFNCGSIIMSVTPIHQTYFRN 422
            A   +    I GI AA      + K  P  +  L+ V AF   +I++S   + +TY+ N
Sbjct: 351 LAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGN 410

Query: 423 HLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQH 482
                +I++ G+D++FP++++LLS+ +  + QG+A +L  T +NY  +   GVA ++   
Sbjct: 411 AFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLI--- 467

Query: 483 VNNHGKDVLKGYRGAF--------YLGIGLASMACIISGALMLSEIIQGRKNE 527
           +     D L    G F        Y+ IG A +A +++    ++E  + R ++
Sbjct: 468 ITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMDD 520

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  145 bits (367), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/452 (25%), Positives = 209/452 (46%), Gaps = 31/452 (6%)

Query: 60  LKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLD---SQNGKQAWLMAAFPLISGSFI 116
           ++E   +     SQL+   GA+Q  PI   + +      ++ G   W  A++ L S   +
Sbjct: 36  IREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMV 95

Query: 117 LISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSD-SFFIVSRAFQGLGISLILPN 175
           LI+G++GD+ G K+ ++ G+++L +WSLI G + Y   + +F+  +RA QG+G   I+PN
Sbjct: 96  LIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPN 155

Query: 176 ILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITA 235
            L I+G  Y     +K ++ S+ G M   G  +G  FS L       +W W +++ A   
Sbjct: 156 SLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFA--QLTKWAWNYWALACVC 213

Query: 236 AINFVLSIWLIPNTIPTN-VHG-------HKMDWIGSGLGVVGLIMLNFVWNQAPIDGWD 287
            +  V +I  IP   P N VH         + D++G+  GV GL++ +  + QA   GW 
Sbjct: 214 VLYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWS 270

Query: 288 S--AYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXX 345
               Y              F  + +     +PL+P + L++   +I++            
Sbjct: 271 PPHTYITLIIGVILILIAMFVDWRVD----DPLVPLQHLRADVVVILICVYFGFLSFVIW 326

Query: 346 XXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIK----KVYPSIILFLSMV 401
                   +L + + +PL          I  I AA+   FT+      +    ++ +SMV
Sbjct: 327 ANWFWQFYEL-VHNDSPLRIAAKLVPLAIGSIPAAI---FTVTCLQLNIKAPTMMVISMV 382

Query: 402 AFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLV 461
            F   +I+M+    + TY+       II  F +D++ P +++L SD +  + QG+A SL+
Sbjct: 383 CFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLI 442

Query: 462 NTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKG 493
            T+++Y++S       +V  +V   G D   G
Sbjct: 443 ITVISYAISIGPSYTAMVMWYVAPLGNDSTPG 474

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  136 bits (343), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 137/509 (26%), Positives = 231/509 (45%), Gaps = 47/509 (9%)

Query: 36  EKQCD----TQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVA 91
           ++QC      QA D  +   NP    S L+E +F+     SQ ++ A A Q    M+ + 
Sbjct: 42  KEQCSNLQPAQAQDQLES-MNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDAIT 100

Query: 92  D--SLDSQNGKQA-WLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGL 148
               L +    +A W  AAF +  G+FI+ +G++ D+ G K   + GY +  +WSL+ G+
Sbjct: 101 AWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGI 160

Query: 149 TKYAHS--DSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206
           ++YA     +FF   R  QG+G + + P+ L ++G  Y   S +KN+V SL G   P+G 
Sbjct: 161 SRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGK-YYPPSCKKNIVFSLYGFCVPLGV 219

Query: 207 TLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNV------------ 254
            +G VFS +  T+ A+ W W ++S AI +A   ++S + IP   P  +            
Sbjct: 220 VVGGVFSAIF-TQLAH-WSWNYWSMAIVSAFFTLISCFYIP---PDEIIKSEEQKKKRAW 274

Query: 255 -HGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFV 313
            H  K D++G+ L V  L++    WNQA    + S               A  I E  F 
Sbjct: 275 FHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVE--FY 332

Query: 314 NGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFL 373
             +P++P   +  P+TI  L  +                    +R+ T L     +    
Sbjct: 333 VDDPIIPARKIH-PQTIKALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLS 391

Query: 374 IWGIVAALVVGFTIKKVYP-SIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSF 432
           I G +AAL     I    P  I L     +F    I+       ++Y+      +II+S 
Sbjct: 392 IAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISI 451

Query: 433 GMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKD--- 489
           G+D+SFP++++LLS+ +P + +G++ +LV T +NY      G+   + Q +  +  D   
Sbjct: 452 GLDISFPSATLLLSNGVPQELRGISAALVGTALNYGT----GIGPPIAQTIIGYQCDKCM 507

Query: 490 -------VLKGYRGAFYLGIGLASMACII 511
                   +K    A  +GIG + +A ++
Sbjct: 508 ASGDMDQFVKAIHIAAAVGIGASGIAVVV 536

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  125 bits (313), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 124/535 (23%), Positives = 233/535 (43%), Gaps = 82/535 (15%)

Query: 48  QKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLD-------SQNGK 100
           QK Q+P   +S L + +F+     SQ +  A A  +Q I+ +  DSL        +   +
Sbjct: 59  QKLQSPT--NSYLNDIIFIFLICSSQFITLASA--SQAILQM--DSLSVWFKIPPTSTLQ 112

Query: 101 QAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI- 159
             W+ A+F +  G+FI+++G++ DI   +   + GY++  +W+LI G   Y   +  F+ 
Sbjct: 113 LGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLY 172

Query: 160 VSRAFQGLGISLILPNILGIVGSIYIAGS------------------------------- 188
           + R  QG+G +L+ P+ L ++   Y                                   
Sbjct: 173 ICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDD 232

Query: 189 ---------------KRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAI 233
                            K++  SL G  AP+G  +G +FS  I T+ A  WPW ++S +I
Sbjct: 233 NDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSA-IFTQLAT-WPWNYWSMSI 290

Query: 234 TAAINFVLSIWLIPNTIP-----TNVHGHK----MDWIGSGLGVVGLIMLNFVWNQAPID 284
              +  +LS + +   IP     +N +  K     D++G  LG+  LI+    W+QA + 
Sbjct: 291 VTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMY 350

Query: 285 GWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXX 344
            + + +             A  I+E +F   NP++P   +  P TI  L  +        
Sbjct: 351 KFKTIHVYLTLLFSLVSFIAMIIWEYYF--NNPIIPIRQIH-PGTIKALLVVFFSYISFT 407

Query: 345 XXXXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAA-LVVGFTIKKVYPSIILFLSMVAF 403
                       ++  +P+     +    + GI++A   +   +K+V   I L     +F
Sbjct: 408 QWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSF 467

Query: 404 NCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNT 463
               I++    +  +Y+      +I +S G+D+SFP++++LL++ +P + QG+  +LV +
Sbjct: 468 LLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGS 527

Query: 464 MVNYSMSFCLGVAGVVEQH------VNNHGKDV-LKGYRGAFYLGIGLASMACII 511
           ++NY  +    +A  + Q+       + H K   LKG   A  +G+G + +A +I
Sbjct: 528 VLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLI 582

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 89/205 (43%), Gaps = 22/205 (10%)

Query: 35  DEKQCDTQAIDG--------NQKWQNPEYFDSTLKEYLFLCSCFVSQLL--NQAGAIQTQ 84
           + K    Q I+G        N +  N    DS +   L+LC   ++ +L       +   
Sbjct: 3   ETKYSSQQEIEGACGSDASLNARGSN----DSPMGLSLYLCLASLTLVLFITALDILIVG 58

Query: 85  PIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSL 144
            I+++VA+   + + K  WL+  + L +    LI GR   I G + +L++  L     SL
Sbjct: 59  TIIDVVAEQFGNYS-KTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 145 ICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPI 204
           I  L   A S +  I  R   G+G S  L  +  ++G   + G + + +VIS++ C   +
Sbjct: 118 IAAL---ASSMNMLIFGRVVAGVGGSG-LQTLCFVIGCTMV-GERSRPLVISILSCAFAV 172

Query: 205 GATLGAVFSGLIGTEDANQWPWAFY 229
            A +G +  G   T     W W FY
Sbjct: 173 AAIVGPIIGGAFTTHVT--WRWCFY 195

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 51  QNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPL 110
           Q    ++  L ++  L S ++   L+   +     IMN VA+   S++ ++ W+  +F L
Sbjct: 24  QKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLL 82

Query: 111 ISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLG 168
            + +F  + G++ DI G K  LL+   F   + L C LT +A + + F ++RA  G+G
Sbjct: 83  TNTAFQPLYGKLSDITGRKSALLIAQFF---FGLGCLLTCFARNVTEFSIARAICGIG 137

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 100/231 (43%), Gaps = 20/231 (8%)

Query: 55  YFDSTLKEYLFLCSCFVSQL-LNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISG 113
           +   TLK   F+C      L L   GA+    ++  +    +  + +  W + ++ +   
Sbjct: 15  FHQDTLKHLKFICILIACGLDLASVGAMIV--LVTDIETRFNVSHTQSGWALTSYVITFA 72

Query: 114 SFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLIL 173
            FI   GR+GDI G    + V  +   ++SL+C +     +   F V RAFQG+  + I+
Sbjct: 73  GFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLCAVVPNFIA---FTVFRAFQGMAGAGIV 129

Query: 174 PNILGIVGSIYIAGSKRKNMVI--SLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSY 231
           P    +V  ++   + ++   I  S+I  MA +G  +G  F    G        + ++ +
Sbjct: 130 PCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAF----GETALGYKSFFYFLF 185

Query: 232 AITAAINFVLSIWLIPNTIPTNVHG--------HKMDWIGSGLGVVGLIML 274
           A + A   V+ + +    +  N H         +K+D IG  L + G I+L
Sbjct: 186 AASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFISGSILL 236

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 88/205 (42%), Gaps = 11/205 (5%)

Query: 28  QDNN--DIVDEKQCDT-QAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQ 84
           +DN+  ++  + +  T + ++ N+K  + +        Y  L S  ++  L+    +   
Sbjct: 5   EDNSSKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVS 64

Query: 85  PIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSL 144
            I+  V+   + +  K  WL+  + L +    L+ GR   I G K ++L+  +   V SL
Sbjct: 65  TIIETVSRDFN-EYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSL 123

Query: 145 ICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPI 204
           +  L   A+S +  I  R   G+G S +      I+ +  +   + + M IS++ C   +
Sbjct: 124 VSAL---ANSMNMLIGGRVISGVGGSGLQTLCFLIIST--LVNERSRGMAISVLSCSFAV 178

Query: 205 GATLGAVFSGLIGTEDANQWPWAFY 229
            + +G    G   T     W W FY
Sbjct: 179 ASIVGPFLGGAFTTHVT--WRWCFY 201

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 101/255 (39%), Gaps = 23/255 (9%)

Query: 2   GIFRKSGTDSVQQETLXXXXXXXXFKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLK 61
           GI++  GT S  Q            + + +D+  E   D + I  +Q++  P    S  +
Sbjct: 53  GIYKVDGTLSRTQTR----------EVEESDL--ESADDVKTIKDSQEYVAPYTLFSYSQ 100

Query: 62  EYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGR 121
           +++ +    +    +  G+    P +  +    D         +  + L  G    + G 
Sbjct: 101 KWIMVGLLTMCGFWSSLGSPIYYPALRQLEKQFDIDENLVNVTVVVYLLFQGISPTVCGG 160

Query: 122 IGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVG 181
           + DIYG +  +L G L  IV S+       A+S    I  R  Q  GIS I+    G VG
Sbjct: 161 LADIYGRRPVILFGMLVYIVASIALAC---ANSYGVIIFLRCLQSCGISPIIAISSGCVG 217

Query: 182 SIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAITAAINF 239
             +   ++R   V ++ G +      LG  F  LIG   A  W W   F+  AI A    
Sbjct: 218 D-FTMKAERGTFVGAVSGLV-----LLGQAFGSLIGAALAAAWDWRAIFWFLAIGAGCCL 271

Query: 240 VLSIWLIPNTIPTNV 254
            + I ++P T  T V
Sbjct: 272 FVGILVLPETKRTIV 286

>Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 103/239 (43%), Gaps = 36/239 (15%)

Query: 38  QCDTQAIDGNQKWQN-PEYFDSTLKEYLFLCSCFVS-----QLLNQAGAIQTQPIMNIVA 91
           + D++  D N + +N PE     LK ++    CF+       LLN  G I++    N +A
Sbjct: 85  ESDSEEGDSNGEAENFPE---GGLKAWVVTFGCFLGLIACFGLLNSTGVIESHLQDNQLA 141

Query: 92  DSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKY 151
           +   S  G   WL + F  +  +  +ISG   D  G +  ++VG +F +      GL   
Sbjct: 142 NESVSTIG---WLFSLFLFVCFASCIISGTYFDRNGFRTIMIVGTVFHVA-----GLFAT 193

Query: 152 AHSDSF--FIVSRAF-QGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATL 208
           A+S  +  FI+S A   G G  ++L  ++ +    +    KR+   ++    MA IG ++
Sbjct: 194 ANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHYFF---KRRGTALA----MATIGGSV 246

Query: 209 GAV---------FSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHK 258
           G V         FS  + T+ +  + W   +          LSI L+   +P  + G K
Sbjct: 247 GGVVFPIMLRSFFSMKLDTDPSYGFVWGIRTLGFLDLALLALSIVLVKERLPHVIEGSK 305

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 91/209 (43%), Gaps = 15/209 (7%)

Query: 27  KQDNNDIVDEK------QCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGA 80
           +Q     VD+K      + D  +I  +   +N E    ++  Y+ L +  +S  L     
Sbjct: 20  EQKRQFAVDQKFAHTSSEHDETSIPEDNVKKNVELSKGSIL-YVSLVAVALSLFLAALDV 78

Query: 81  IQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLI 140
           +    I+  VA  L S + +  WL   + L +   +LI GRI    G K T+L   +   
Sbjct: 79  MIVSTIIEEVAKQLGSYS-EIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFE 137

Query: 141 VWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGC 200
           + SLI  L   A S +  I  R   G+G    + ++  ++GS  +  SKR  M+I+++  
Sbjct: 138 IGSLISAL---ASSMNMLIGGRVIAGIG-GCGIQSLSFVIGSTLVEESKR-GMLIAILSS 192

Query: 201 MAPIGATLGAVFSGLIGTEDANQWPWAFY 229
              I + +G    G+  +  +  W W FY
Sbjct: 193 SFAIASVVGPFLGGVFTS--SVTWRWCFY 219

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 66/144 (45%), Gaps = 8/144 (5%)

Query: 86  IMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145
           I+N +AD  ++ + K  WL+  + L +  F L+ GR   I+G K TL+V  +   + SL+
Sbjct: 43  ILNTIADKFNAYS-KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLV 101

Query: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIG 205
             ++   +S    I  R   G G S I   +  I  S  +     +  +++L+     + 
Sbjct: 102 IAVS---NSMDMIIGGRVIAGCGASGIQTLVFAIATS--LVDEHTRGTIVTLLSLSYAVA 156

Query: 206 ATLGAVFSGLIGTEDANQWPWAFY 229
           + LG    G + TE    W W FY
Sbjct: 157 SALGPYIGGAL-TEYVT-WRWCFY 178

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 68/139 (48%), Gaps = 10/139 (7%)

Query: 126 YGLKKTLLVGYLFLIVWSLICGLTKYA---HSDSFFIVSRAFQGLGISLILPNILGIVGS 182
           +G +K L   Y+F ++ +LI  +   A   H  + +I+ R FQ +G S ++P  +G V  
Sbjct: 173 FGGRKFL---YIFSLMIALIANVLLAAVPKHLAALYIL-RVFQAIGTSAVIPLGVGTVSD 228

Query: 183 IYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLS 242
           +    ++ K +   ++G    +G  LG +F GLI   + NQW W F   +IT  +  +L 
Sbjct: 229 LISPMNRAKGVSYFMLG--PNMGPILGPIFGGLI-LMNGNQWRWLFGFTSITTGVGLILI 285

Query: 243 IWLIPNTIPTNVHGHKMDW 261
           +  +P T+   V      W
Sbjct: 286 VTFLPETLRCIVGNGDPRW 304

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 98/234 (41%), Gaps = 17/234 (7%)

Query: 29  DNNDI----VDEKQC-DTQAIDGNQKWQNPEYFDSTLKE-YLFLCSCFVSQLLNQAGAIQ 82
           DN  +    V++  C  T++      + +P Y     +E +L +  C  +   +   A  
Sbjct: 30  DNESMCSIDVEQSSCTRTKSARLEPHYTSPPYSRFGRREKFLLVVQCAFTGFFSTIAAAI 89

Query: 83  TQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVW 142
             P++ ++ D  D    K    +  + +  G    + G + D  G +  +++    L+ +
Sbjct: 90  YYPVLTVIEDLFDISEEKVNITVVVYFIFQGISPTLMGGLADYLGRRPIVILS--VLVYF 147

Query: 143 SLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA 202
           S   GL   + S +  I  R  Q  GIS ++    GI+G +    ++R   V  + GC  
Sbjct: 148 SACVGLA-CSQSYAQIIALRCLQAAGISPVIAINSGIMGDV-TTRAERGGYVGYVSGCQV 205

Query: 203 PIGATLGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNV 254
                +G+ F  LIG   +++W W   F+  AI +    V ++  +P T  T V
Sbjct: 206 -----VGSAFGALIGAGLSSRWGWRSIFWFLAIGSGACLVATVLFLPETKRTVV 254

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 84/208 (40%), Gaps = 13/208 (6%)

Query: 27  KQDNNDIVDEKQCDT-----QAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAI 81
           + +N D   E  C T     +A+          +  + +K Y  + S  +   L     +
Sbjct: 77  QMNNGDKDAESHCTTLETYPEAVQTPPGISRSLHTMAGIKLYTTIGSLTLVLFLAALDVL 136

Query: 82  QTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIV 141
                + ++A+     + K  W+++ + L      L+ GR   I G K +LLV  L    
Sbjct: 137 IISASIEVIAEQFKDYS-KSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEA 195

Query: 142 WSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCM 201
            SLI  ++   +S +  I  R   G+G S I    L  V +  +   + + ++IS++ C 
Sbjct: 196 GSLISAIS---NSMNMLIGGRVVAGIGGSGI--QSLCFVIASTLTPDRSRVIIISVLSCS 250

Query: 202 APIGATLGAVFSGLIGTEDANQWPWAFY 229
             + A +G    G + T     W W FY
Sbjct: 251 YAVAAVVGPFLGGALTTHVT--WRWCFY 276

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 4/78 (5%)

Query: 86  IMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145
           IMN VA+   S++ K+ W+  +F L + +F  + G++ D+ G K  LL+ Y FL++    
Sbjct: 58  IMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG--- 113

Query: 146 CGLTKYAHSDSFFIVSRA 163
           C LT  A + + F V+RA
Sbjct: 114 CLLTCLARNVTEFAVARA 131

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 7/130 (5%)

Query: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI 159
           K  W+ A + L +    L+ GRI  I G K  +L   +   + SLI G+   A+S +  I
Sbjct: 114 KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGV---ANSMNMLI 170

Query: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE 219
             R   G+G S I  ++  ++GS  +   +R+ ++I+ +     + + +G    G   T 
Sbjct: 171 GGRVIAGVGGSGI-QSLAFVIGS-NLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTH 228

Query: 220 DANQWPWAFY 229
               W W FY
Sbjct: 229 AT--WRWCFY 236

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 97/229 (42%), Gaps = 15/229 (6%)

Query: 31  NDIVDEKQ-CDTQAIDGNQKWQNPEY--FDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIM 87
           +DI  + Q C T++        +P Y  F +T K  L +   F     + AGAI   P++
Sbjct: 44  SDINPKNQLCQTKSNQNEPDIASPPYSRFGTTEKMILVIQCAFTGFFSSIAGAIY-YPVL 102

Query: 88  NIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICG 147
           +++ +  +         +  + +  G    I G + D  G +  +L   L   V+   C 
Sbjct: 103 SVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGLADSMGRRPVVLSSVL---VYCCACI 159

Query: 148 LTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGAT 207
               +H+ +  IV R  Q  GIS ++    GI+G I    ++R   V  + G        
Sbjct: 160 GLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDI-TTRAERGGYVGYVSGFQV----- 213

Query: 208 LGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNV 254
           +G+ F  LIG   +  W W   F+  AI + +  V SI ++P T  T V
Sbjct: 214 IGSAFGALIGAGLSATWSWRSIFWFLAIGSGVCLVASIIILPETKRTVV 262

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 103 WLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSR 162
           WLMA + L +  F+L+ GRI  + GLK +L+   +     SL+ G    A+S    I +R
Sbjct: 46  WLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMAG---AANSMGMLIGAR 102

Query: 163 AFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDAN 222
              G G S I   + G+  S  I   K +  VI+++G    +    G    G  G  +  
Sbjct: 103 VISGFGGSGIESLVYGVGTS--IVEEKHRARVITVLGIAYMLAEGAGPFVGG--GLAEHV 158

Query: 223 QWPWAFY 229
            W W FY
Sbjct: 159 SWRWCFY 165

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 76/167 (45%), Gaps = 10/167 (5%)

Query: 66  LCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNG---KQAWLMAAFPLISGSFILISGRI 122
           L +C +S +L+   A     I++ + +++  + G   K  W+ A + L S    LI GRI
Sbjct: 54  LYACVISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRI 113

Query: 123 GDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGS 182
             + G K ++L   +   V SL+  L   A+S    I  R   GLG S I   +  ++ S
Sbjct: 114 AAVCGFKSSMLTAIIIFEVGSLVAAL---ANSMDMLIGGRVIAGLGGSGI-QTLCFVIIS 169

Query: 183 IYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFY 229
             +  SKR  ++I+ +G    I + +G    G   T     W W F+
Sbjct: 170 TLVEESKR-GLLIACMGSAFGIASVVGPFLGGAFTTHVT--WRWCFW 213

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 69/147 (46%), Gaps = 10/147 (6%)

Query: 86  IMNIVADSLDSQNGKQA---WLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVW 142
           I++ + + +  Q G  +   WL   + L +    LI GRI    G K+T+L   +   + 
Sbjct: 86  IVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIG 145

Query: 143 SLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA 202
           SLI  L   A+S S  I  R   G+G    + ++  ++GS  +  S+R  ++I+++ C  
Sbjct: 146 SLISAL---ANSMSMLIGGRVIAGVG-GCGIQSLSFVIGSTLVEESQR-GILIAVLSCSF 200

Query: 203 PIGATLGAVFSGLIGTEDANQWPWAFY 229
            I + +G    G+     +  W W FY
Sbjct: 201 AIASVVGPFLGGVF--TSSVTWRWCFY 225

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 68/139 (48%), Gaps = 15/139 (10%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVS--RAFQGLGISLILPN 175
           ISG + D+YG +  +L G L  +V S+  GL   A S+S+ ++   R  Q  GIS ++  
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GL---ACSNSYGVIVFLRCVQSAGISPLIAI 206

Query: 176 ILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGT--EDANQWPWAFYSYAI 233
             G+VG  +   S+R + V ++ G      A +G  F  LIG     A  W   F+   I
Sbjct: 207 SSGVVGD-FTTKSERGSFVGAVSGF-----ALMGQAFGSLIGAGLTAAYDWRAIFWFLTI 260

Query: 234 TAAINFVLSIWLIPNTIPT 252
                FV++ +L+P T  T
Sbjct: 261 GCGTCFVINFFLLPETKRT 279

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 69/154 (44%), Gaps = 16/154 (10%)

Query: 103 WLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSR 162
           WL+  + L S  F L+ GR+  + GLK  L++  L   + SLI  ++   +S    I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVS---NSMGMLIAGR 138

Query: 163 AFQGLGISLILPNILGIVGSIYIAG----SKRKNMVISLIGCMAPIGATLGAVFSGLIGT 218
              G G S       GI   +YI G    S+R   ++ ++   A +G+  G    G    
Sbjct: 139 VVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGPILGGALN 191

Query: 219 EDANQWPWAFY-SYAITAAINFVLSIWLIPNTIP 251
           E A+ W W F+ +  I  A  F+L +   P+  P
Sbjct: 192 EHAS-WRWCFFINLPIGGAAAFMLFLCYNPSGKP 224

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 4/78 (5%)

Query: 86  IMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145
           IMN VA+     + KQ W+  +F L + +F  + G++ DI G K  LLV + F   + L 
Sbjct: 74  IMNRVAEEFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTF---FCLG 129

Query: 146 CGLTKYAHSDSFFIVSRA 163
           C LT +A + + F ++RA
Sbjct: 130 CLLTCFARNVTEFSIARA 147

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 65/139 (46%), Gaps = 11/139 (7%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNIL 177
           ISG + D++G +  +L+G L  +V S+  GL   A S    +  R  Q +GIS  +    
Sbjct: 145 ISGGLADVFGRRPVILIGMLIYVVASI--GLA-CAPSYGVIVFLRIIQSIGISPTIAISS 201

Query: 178 GIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAITA 235
           G+VG   +     K+   + +G  + +   LG  F  LIG   A  W W   F+   I  
Sbjct: 202 GVVGDFTL-----KHERGTFVGATSGL-VLLGQCFGSLIGAVLAAAWNWRAIFWFLTIGC 255

Query: 236 AINFVLSIWLIPNTIPTNV 254
             +F+++  L+P T  T V
Sbjct: 256 GTSFIIAFLLLPETKRTLV 274

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 7/130 (5%)

Query: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI 159
           +  WL+  + L +  F L+ GR+  I GLK +L    +   + SLI  ++   +S    I
Sbjct: 43  RIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVS---NSMGMII 99

Query: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE 219
             R   G G S I  +++ +VG+  +   + + MVI+++G    +   +G V  G   TE
Sbjct: 100 GGRVVAGCGGSGI-QSLVFVVGTSLVE-ERNRGMVITVLGLAFAVAFAVGPVIGGAF-TE 156

Query: 220 DANQWPWAFY 229
           + + W W FY
Sbjct: 157 NVS-WRWCFY 165

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 90/228 (39%), Gaps = 15/228 (6%)

Query: 5   RKSGTDSVQQETLXXXXXXXXFKQDNNDIVDEKQCDTQAI-DGNQKWQNPE----YFDST 59
           +K   D+   E+          + D +D+V  +  D ++  DG+++ Q  E    Y   T
Sbjct: 18  KKKNCDNTGSESSVFRTVTRELRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPYTLLT 77

Query: 60  LKEYLFLCSCFVSQ-LLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILI 118
            ++  F+ +   S    +  G+    P +  +    D         +  + L  G    I
Sbjct: 78  YRQKWFMVALLTSAGFWSSLGSPIYYPALKELEAEFDVNEELINITVVVYLLFQGIAPTI 137

Query: 119 SGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILG 178
           SG + D+YG +  +L+G L  ++ S+    +K   +  F    R  Q  GIS I+    G
Sbjct: 138 SGGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL---RCLQSAGISPIIAINSG 194

Query: 179 IVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPW 226
           + G  +   S+R   V ++ G        +G  F  LIG      + W
Sbjct: 195 VAGD-FTVKSERGTFVGAVSGF-----TLMGQAFGSLIGAALTAAYDW 236

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 68/147 (46%), Gaps = 10/147 (6%)

Query: 86  IMNIVADSLDSQNGKQA---WLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVW 142
           I++ + + +  Q G  +   WL   + L +    LI GRI    G K+T+L   +   V 
Sbjct: 95  IVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVG 154

Query: 143 SLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA 202
           SLI  L   A+S +  I  R   G+G    + ++  ++GS  +  S R  ++I+++ C  
Sbjct: 155 SLISAL---ANSMNVLIGGRVIAGVG-GCGIQSLSFVIGSNLVEESNR-GVLIAILSCSF 209

Query: 203 PIGATLGAVFSGLIGTEDANQWPWAFY 229
            I + +G    G+  +     W W FY
Sbjct: 210 AIASVVGPFLGGVFTSRVT--WRWCFY 234

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 80/193 (41%), Gaps = 9/193 (4%)

Query: 59  TLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILI 118
           + K++LF+ S F S              +  ++   D    +  W +    ++     ++
Sbjct: 70  SYKQWLFILSAFASFTWEAFDFFTVTLNVKKISHDFDVTTKQVTWGITLVLMLRVVGAVL 129

Query: 119 SGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILG 178
            G IGD YG K + ++   F++V  +I G  K  H+  +F+++RAF G+ +  I  N   
Sbjct: 130 FGYIGDRYGRKVSFIINLFFMMVLEIITGFIK--HNFKYFLIARAFFGVVLGGIFGN--S 185

Query: 179 IVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAIN 238
                     +  + +         +G  L  +F+  +     ++W   F+     A I 
Sbjct: 186 AAQCFDDCPPEAHSFISGFFQQGYTLGYLLAVIFTRALADTTKDRWRSCFW---FAAGIT 242

Query: 239 FVLSIW--LIPNT 249
           F+L I+  L+P T
Sbjct: 243 FLLIIFRALLPET 255

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 102/238 (42%), Gaps = 11/238 (4%)

Query: 29  DNNDI--VDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86
           DN+D   VD ++C  +A D + ++    +F  T +  +F    +V  L   +G I   P 
Sbjct: 78  DNDDTSDVDLEKCTKEAGDIDIEYS---FFTKTQRMVMFFIVIYVGFLGPMSGNIYI-PA 133

Query: 87  MNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLIC 146
           +  +  +  +        ++AF  +     +  G   D+ G K   L   + + V +L+ 
Sbjct: 134 LPTLQKAFHTNTTVINATVSAFMGVFAVGPIFWGVYADVCGRKWLYLCSLILVTVINLLL 193

Query: 147 GLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206
            +   A+  S F++ R FQ  G S ++    G V  I     + K +   ++G    +G 
Sbjct: 194 AVLP-ANLASLFVL-RVFQAFGSSSVITLGSGTVTDITPMKHRGKAIAYFMLG--PNMGP 249

Query: 207 TLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGS 264
            LG + +GLI   + + W W F    I +AI F+L +  +P T+   V      W  S
Sbjct: 250 ILGPIIAGLILI-NGDYWRWLFGFTCIMSAIGFLLVLIFLPETLRCIVGNGDPRWRNS 306

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 94/205 (45%), Gaps = 14/205 (6%)

Query: 49  KWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAF 108
           ++++P  + +++K+ + L   F S +   A +I   P +N + +SLD+        +  +
Sbjct: 76  EFKDPRDYPASIKKLIVLIIAFSSLMGPMATSI-VFPAINPITESLDTTTFMVNISVGVY 134

Query: 109 PLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLG 168
            L  G F L      +++G +   +V ++ L  + +   L+    S   FI+ R   G  
Sbjct: 135 SLSLGIFPLWWSSFSEMHGRRSVYVVSFIMLFGFCIGAALSPNISS---FIILRVLCGAA 191

Query: 169 ISLILPNILGIVGSIYIAGSKRKNMVISLIG-CMAPIGATLGAVFSGLIGTEDANQWPWA 227
            + +     G V  +YI   + +N+ I  +G  MAP+ A + A  SGL+      +W W 
Sbjct: 192 SASVQSVGAGTVSDLYIPEDRGRNLGIYYMGPLMAPLIAPIIA--SGLV-----TRWSWR 244

Query: 228 FYSY--AITAAINFVLSIWLIPNTI 250
              +   I A  + +L ++ +P T+
Sbjct: 245 STQWFMVILAGFDVLLLVFFLPETL 269

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/196 (19%), Positives = 78/196 (39%), Gaps = 9/196 (4%)

Query: 35  DEKQCDTQAIDGNQKWQ-NPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADS 93
           +  Q + +A D + +   N       +  YL L S  +   +     +    I+++VA+ 
Sbjct: 6   NSSQAEVKAYDSDTELNVNSSDERGGISLYLCLTSLTLVLFITALDILIVGTIIDVVAEQ 65

Query: 94  LDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAH 153
             + + K  WL+  + L +    L+ GR   I G + +L++  L     SL+  L    +
Sbjct: 66  FGNYS-KTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLVAALANSMN 124

Query: 154 SDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFS 213
                ++            L  +  ++G   +   + + +VIS++ C   + A +G +  
Sbjct: 125 ----MLIVGRVVAGVGGSGLQTLCFVIGCTMV-NERSRPLVISILSCAFAVAAIVGPIIG 179

Query: 214 GLIGTEDANQWPWAFY 229
           G   T     W W FY
Sbjct: 180 GAFTTHVT--WRWCFY 193

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 83/458 (18%), Positives = 161/458 (35%), Gaps = 43/458 (9%)

Query: 73  QLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTL 132
            LLN A  I    +++ +A   +      +W + ++ +    FI   GR+GDI G     
Sbjct: 41  DLLNVASMIS---LIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLF 97

Query: 133 LVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKN 192
            +      + SL+C +     +   F V RA QG+  + ++P    ++    +A  ++  
Sbjct: 98  TISCSCFAILSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIP--ILAPKEKVQ 152

Query: 193 MVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLI------ 246
              S++ C       LG +  G             + ++A+ + I+ +   +        
Sbjct: 153 KYFSIVSCGFSSTIGLGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFD 212

Query: 247 --PNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXA 304
             P  I        +D+IGS + V G I++     +   + W+                 
Sbjct: 213 KKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLIIGILLFFG 271

Query: 305 FFIYEL------------------HFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXX 346
           FF++                    +F     L+P +VL     I ++ A           
Sbjct: 272 FFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFSC 331

Query: 347 XXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCG 406
                         +PL AG      +I  +V   +  F   K+ P + + L       G
Sbjct: 332 LYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSLALAG 391

Query: 407 SIIMSVTPIH----QTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVN 462
           SII+    +H      +++       ++ FG+ + +P +  +     P Q +G+A  +  
Sbjct: 392 SIIL--IQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQ 449

Query: 463 TMVNYSMSFCLGVAGVVEQHVNN-HGK-DVLKGYRGAF 498
           T     +     V   V   +N   GK D ++ +R  F
Sbjct: 450 TFGQLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGF 487

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 93/508 (18%), Positives = 185/508 (36%), Gaps = 55/508 (10%)

Query: 49  KWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAF 108
           K QN  Y        +F    F   LLN AG I    ++  + ++        +W + ++
Sbjct: 18  KCQNSRYQLGINITLIFFGCTF--DLLNVAGVIS---VIEDLGETYKLGYTGASWALTSY 72

Query: 109 PLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLG 168
            +    FI   GR+GDI G      +      ++SL+C + +   +   F V RA QG+ 
Sbjct: 73  AITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPT---FAVFRALQGIS 129

Query: 169 ISLILPNILGIVGSIYIAGSKRKNMVISLIGC----MAPIGATLGAVF-------SGLIG 217
            + I+P    ++    +A  +      S++ C       IG  +G  F       +G+  
Sbjct: 130 AAGIVPCGYALIP--LLAEPQDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFY 187

Query: 218 TEDANQW----PWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIM 273
              A         +FY+Y I       + +  IP+  P       +D++GS + V G ++
Sbjct: 188 LSFAGMLVVSIAASFYTYRIEERKFLEVKVEDIPHDHP---KVASLDFVGSLIFVSGSVL 244

Query: 274 LNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFV------------------NG 315
           +     +   + W                 +FFI+  ++                   N 
Sbjct: 245 IVAGLTEGG-ESWRRPVAYVPFSIGVLLFCSFFIWNCYYQKMVSRLKAVGFNTPQYLNNV 303

Query: 316 NPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXXXXXXXQLNLRHYTPLWAGGTYFMFLIW 375
             L+PK+VL  P  I ++ +                     +   +PL AG      ++ 
Sbjct: 304 QVLVPKDVLFMPNFIPIILSFACNNACLFSVIYIIDQYSQYVEKNSPLIAGVRLIPLIVS 363

Query: 376 GIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIM-SVTPIHQTYF-RNHLGMMIILSFG 433
            ++          ++ P + + L  +   CGSII+  +  I    F +      I +  G
Sbjct: 364 MVIGNTTCAIRSLQLRPKVGVVLGFLFMLCGSIILIQLHTIENGIFWKLFFCSQISVGLG 423

Query: 434 MDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNN-----HGK 488
             + +P +  L+    P   +G+A  +  T   + +     V   V  ++ +     + +
Sbjct: 424 AAIFYPYALKLVVGGAPDGAKGIASGMTQTFAQFGVEVTFSVMVSVLGNITDVKETLNSQ 483

Query: 489 DVLKG-YRGAFYLGIGLASMACIISGAL 515
           +  K  ++   Y  + +A++  I++  L
Sbjct: 484 ETFKDRFQNCAYFSVAVAALGLILTLCL 511

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 32/49 (65%)

Query: 102 AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTK 150
           +W+  A+ L S +F  + G+I DI+G +  +++  LF I+  LICGL+K
Sbjct: 99  SWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147

>YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin; may have a role in potassium uptake
          Length = 542

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 111/285 (38%), Gaps = 16/285 (5%)

Query: 8   GTDSVQQETLXXXXXXXXFKQDNNDIVDE-KQCDTQAIDGNQKWQNPEY--FDSTLKEYL 64
            T S+ +E           +  N +  D+     T+++    +   P +  F  + K  L
Sbjct: 4   ATSSIIRENDFEDELAESMQSYNRETADKLALTRTESVKPEPEITAPPHSRFSRSFKTVL 63

Query: 65  FLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGD 124
                F       AGAI   P+++++    D         +  + +  G      G   D
Sbjct: 64  IAQCAFTGFFSTIAGAIY-YPVLSVIERKFDIDEELVNVTVVVYFVFQGLAPTFMGGFAD 122

Query: 125 IYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIY 184
             G +  +LV    ++++   C     A + +  IV R  Q  GIS ++    GI+G + 
Sbjct: 123 SLGRRPVVLVA---IVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDV- 178

Query: 185 IAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLS 242
              ++R   V  + G        LG+ F  LIG   +++W W   F+  AI + I F+ S
Sbjct: 179 TTRAERGGYVGYVAGFQ-----VLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGICFLAS 233

Query: 243 IWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWD 287
             ++P T   N+ G+      S L    +++L  V     +D  D
Sbjct: 234 FLILPET-KRNISGNGSVTPKSYLNRAPILVLPTVRKSLHLDNPD 277

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 4/112 (3%)

Query: 51  QNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPL 110
           Q  +  + +L +   L S ++   L    A     IMN +A+     + KQ W+  +F L
Sbjct: 32  QRCQEHNRSLPKAPILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQ-WMATSFLL 90

Query: 111 ISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSR 162
            + +F  + GR  DI G K  LL+   F ++ +L   LT +A + + F ++R
Sbjct: 91  TNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTL---LTCFARNVTEFAIAR 139

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 59/133 (44%), Gaps = 11/133 (8%)

Query: 119 SGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILG 178
           SG + D +G +  LL+G L  +V S+  GL   A S    +  R  Q +GIS  +    G
Sbjct: 155 SGGLADKFGRRPVLLIGMLIYVVASI--GLA-CAPSYGVIVFLRCVQSIGISPSIAISSG 211

Query: 179 IVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAITAA 236
           +VG  +   S+R   V +  G +      LG  F  LIG   A  W W   F+   I   
Sbjct: 212 VVGD-FTVKSERGTFVGATSGFV-----LLGQAFGSLIGAALAAAWDWRAIFWFLTIGCG 265

Query: 237 INFVLSIWLIPNT 249
            +F +   L+P T
Sbjct: 266 ASFAICFALLPET 278

>ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 538

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 92/233 (39%), Gaps = 20/233 (8%)

Query: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCS-CFVSQLLNQAGAIQTQP 85
           ++D+N +    Q    ++ G        Y     ++ L L + C  + L +   A    P
Sbjct: 15  QKDSNSLKTSDQKSDGSLAGKDNESEIPYSRFKRRDKLLLVAQCASTGLFSSIAASIYFP 74

Query: 86  IMNIVADSL---DSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVW 142
           ++  V       + Q      +   F  +S SF+   G + D  G +  +LV  L   V 
Sbjct: 75  VLTTVERKFHITEEQANITVVVYYVFQGLSPSFM---GNMADTLGRRPVILVSVLIYFVA 131

Query: 143 SL-ICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCM 201
            L I     Y+      I  R  Q  GIS ++    G++  I    ++R   V    GC 
Sbjct: 132 CLGIASCNTYSQ----LIGLRCLQAAGISPVIAINSGMMTDI-TTRAERGGYVGYTSGCQ 186

Query: 202 APIGATLGAVFSGLIGTEDANQWPW--AFYSYAITAAINFVLSIWLIPNTIPT 252
                 LG+ F  LIG   +++W W   F+  +I + I  V+S  L+P T  T
Sbjct: 187 V-----LGSAFGALIGAGLSSRWGWRSVFWFLSIGSGICLVISTLLLPETKRT 234

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 56/130 (43%), Gaps = 7/130 (5%)

Query: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI 159
           K  W++  + L +  F L+ GRI    G + +++   +     SLI  L   A S +  I
Sbjct: 79  KSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSLISAL---ARSMNMLI 135

Query: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE 219
             R   G+G S +    L +V    +   K + +V+SL+ C   I + +G    G   T 
Sbjct: 136 AGRVVSGVGGSGL--QTLSLVIGCQLVDEKSRPLVLSLLNCTFAIASIIGPFIGGAFTTH 193

Query: 220 DANQWPWAFY 229
               W W FY
Sbjct: 194 VT--WRWCFY 201

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 95/235 (40%), Gaps = 19/235 (8%)

Query: 27  KQDNNDIVDEKQCDTQAIDGNQKWQN-PEY--FDSTLKEYLFLCSCFVSQLLNQAGAIQT 83
           K + ++ V E    T++        N P Y  FD+  K  L L   +       AGAI  
Sbjct: 43  KTNEDEAVKEPIYRTRSNQTEPDIANAPPYSRFDAKYKMALVLQCAYTGLFSTMAGAIY- 101

Query: 84  QPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLL--VGYLFLIV 141
            P+++++              +  + +  G    + G + D  G +  +L  V   F   
Sbjct: 102 YPVLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLGRRPVVLFAVTVYFGAC 161

Query: 142 WSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCM 201
             L C  T YA      +V R  Q  GIS ++    GI+G +    ++R   V  + G  
Sbjct: 162 IGLACAQT-YAQ----IVVLRCLQAAGISPVIAINSGIIGDV-TTRAERGGYVGYISGFQ 215

Query: 202 APIGATLGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNV 254
                 LG+ F  LIG   +++W W   F+  AI + +  V SI ++P T  T V
Sbjct: 216 -----VLGSAFGALIGAGLSSRWGWRSIFWFLAIGSGVCLVFSIIMLPETKRTIV 265

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 59/144 (40%), Gaps = 8/144 (5%)

Query: 86  IMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145
           IM  VA   +  +    WL+  + L +    L+ GR G + G K ++L+  +   V SLI
Sbjct: 98  IMETVAAKFNGYS-MTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLI 156

Query: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIG 205
                 A S +  I  R   G+G S I    L  V +  +   + +   IS++ C   + 
Sbjct: 157 AAA---ATSMTMLIGGRVISGIGGSGI--QTLCFVITSTLVTDRTRGTAISILSCAFAVA 211

Query: 206 ATLGAVFSGLIGTEDANQWPWAFY 229
           +  G    G   T     W W FY
Sbjct: 212 SVAGPFLGGAFATHVT--WRWCFY 233

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 82/208 (39%), Gaps = 15/208 (7%)

Query: 29  DNNDIVDEKQCDTQAIDGNQKWQNP-------EYFDSTLKEYLFLCSCFVSQLLNQAGAI 81
           D + ++ + + D  ++      + P       + F + ++ +  L S  +   L     +
Sbjct: 2   DKDSVIADTRGDASSVSTGSVKEEPVRTNAFGQRFPTGVELWAPLGSLVLCLFLAALDVM 61

Query: 82  QTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIV 141
               I+  V+      + K  WL   + L +   +LI GRI  + G K + L   +   V
Sbjct: 62  TVSTIIEEVSQKFGDYS-KVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEV 120

Query: 142 WSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCM 201
            SL+  L   A+S    I  R   G+G S +    L  V S  +   + + ++I+++   
Sbjct: 121 GSLVSAL---ANSMDMLIGGRVIAGIGGSGV--QSLVFVISSTLVEERNRGLIIAVMSSS 175

Query: 202 APIGATLGAVFSGLIGTEDANQWPWAFY 229
             I + +G    G   T     W W FY
Sbjct: 176 FGIASVVGPFLGGAFTTHVT--WRWCFY 201

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 57/130 (43%), Gaps = 7/130 (5%)

Query: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI 159
           K  W++  + L +  F L+ GR+  + G + +++   +     SLI  L K   S +  I
Sbjct: 80  KSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLISALAK---SMNMLI 136

Query: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE 219
             R   G+G S +    L +V    +   K + +V+SL+ C   + + +G    G   T 
Sbjct: 137 SGRVIAGVGGSGL--QTLSLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTH 194

Query: 220 DANQWPWAFY 229
               W W FY
Sbjct: 195 VT--WRWCFY 202

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 85/214 (39%), Gaps = 24/214 (11%)

Query: 73  QLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTL 132
            LLN A  I    +++ +A   D      +W + ++ +    FI   GR+GDI G     
Sbjct: 41  DLLNVASMIS---LIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILF 97

Query: 133 LVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKN 192
            V   F  + SL+C +     +   F V RA QG+  + ++P    ++  +      +K 
Sbjct: 98  TVSCFFFAILSLLCAVMPNFPA---FAVFRAIQGISAAGLVPCAYALIPMLAPEEEVQKY 154

Query: 193 MVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLI------ 246
             I   G  + IG  LG +  G         +   FY   +T A+ F++SI         
Sbjct: 155 FSIVSCGFSSTIG--LGLIIGGAFAATKIG-YKGIFY---LTFAVMFLISIVAFFFTYGV 208

Query: 247 ------PNTIPTNVHGHKMDWIGSGLGVVGLIML 274
                 P           +D+IGS + V G I++
Sbjct: 209 ENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILI 242

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 7/133 (5%)

Query: 31  NDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIV 90
           N IV     D+   +   K      ++ +L +   L S ++   L+   A     IMN V
Sbjct: 37  NSIVSGASSDS---NNKPKLDPITKYNLSLSKGPILTSLWLGSFLSALDATIVAVIMNRV 93

Query: 91  ADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTK 150
           A+  ++ N KQ W+  ++ L + +F  + GR+ DI G K T L+   F  + S    LT 
Sbjct: 94  AEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSF---LTT 149

Query: 151 YAHSDSFFIVSRA 163
           ++ +   F ++RA
Sbjct: 150 FSKTLPQFALARA 162

>YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON}
           MCH5Plasma membrane riboflavin transporter; facilitates
           the uptake of vitamin B2; required for FAD-dependent
           processes; sequence similarity to mammalian
           monocarboxylate permeases, however mutants are not
           deficient in monocarboxylate transport
          Length = 521

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 88/212 (41%), Gaps = 29/212 (13%)

Query: 59  TLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILI 118
           T   +L L +CF   LLN  G I++    N ++    S  G   WL + F  +  +  +I
Sbjct: 110 TFGCFLGLIACF--GLLNSTGVIESHLQDNQLSSESVSTIG---WLFSLFLFVCSASCII 164

Query: 119 SGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSF--FIVSRAF-QGLGISLILPN 175
           SG   D  G +  ++VG +F +      GL   A+S  +  FI+S A   G G  ++L  
Sbjct: 165 SGTYFDRNGFRTIMIVGTVFHVA-----GLFATANSTKYWHFILSFAIVCGFGNGIVLSP 219

Query: 176 ILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAV---------FSGLIGTEDANQWPW 226
           ++ +    +    KR+   ++    MA IG ++G V         FS    T+    + W
Sbjct: 220 LVSVPAHYFF---KRRGTALA----MATIGGSVGGVVFPIMLRSFFSMKSDTDPTYGFVW 272

Query: 227 AFYSYAITAAINFVLSIWLIPNTIPTNVHGHK 258
              +          LSI L+   +P  +   K
Sbjct: 273 GIRTLGFLDLALLTLSIILVKERLPHVIENSK 304

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 13/134 (9%)

Query: 99  GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFF 158
           G   WL+  + L +  F+L+ GR+ +I G  + L++  +   V SLI  L+   +S    
Sbjct: 43  GNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALS---NSMGTL 99

Query: 159 IVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA---PIGATLGAVFSGL 215
           I  R   G G S I  ++  +VG+  +  + R  M+ +L         +G  +G  F+  
Sbjct: 100 ISGRLIAGFGGSGI-ESLAFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAFN-- 156

Query: 216 IGTEDANQWPWAFY 229
               +   W W FY
Sbjct: 157 ----EHLSWRWCFY 166

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 68/170 (40%), Gaps = 8/170 (4%)

Query: 60  LKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILIS 119
           L  YL L S  +   +     +    I+++VA    + + K  WL+  + L +    L+ 
Sbjct: 42  LSLYLCLASLTLVLFITALDILIVGTIIDVVAKQFGNYS-KTGWLVTGYSLPNAVLSLLW 100

Query: 120 GRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGI 179
           GR   I G + +L++  L     SL+  L    +     ++            L  +  +
Sbjct: 101 GRFASIIGFQHSLILAVLIFEAGSLVAALANSMN----MLIVGRVVAGVGGSGLQTLCFV 156

Query: 180 VGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFY 229
           +G   +   + + +VIS++ C   + A +G +  G   T     W W FY
Sbjct: 157 IGCTMV-DERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVT--WRWCFY 203

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 91/223 (40%), Gaps = 22/223 (9%)

Query: 34  VDEKQCDTQAIDGNQKWQNP-EY--FDSTLKEYLFLCSC----FVSQLLNQAGAIQTQPI 86
           VD  Q  T   D  Q  +   EY  F   L + + L +C     ++  L     +    I
Sbjct: 22  VDSVQVHTSKTDTAQTLEEEVEYNEFGQPLPKGIILWACTGALALANFLAALDIMIVTTI 81

Query: 87  MNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIG-DIYGLKKTLLVGYLFLIVWSLI 145
           +N V    D+   K  W++A + L +    L+ GRI     G K  +L   +   + SLI
Sbjct: 82  INDVGAHFDAY-AKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEIGSLI 140

Query: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISL---IGCMA 202
           C L   A+S    I  R   G+G S I  ++  ++GS  ++   R  ++  +    G  +
Sbjct: 141 CAL---ANSMDMLIGGRVIAGIGGSGI-QSLSFVIGSTLVSPRGRGFIIAFMSASFGIAS 196

Query: 203 PIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWL 245
            IG  +G  F+  +       W W F+      A+  V+  W+
Sbjct: 197 VIGPFIGGAFTSHV------TWRWCFWINLPVGAVALVIFTWV 233

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 88/487 (18%), Positives = 176/487 (36%), Gaps = 51/487 (10%)

Query: 86  IMNIVADSLDSQNGKQ------AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFL 139
           +  +++ + D +N  Q      +W + A+ +    FI   GR+GDI G    L V   FL
Sbjct: 41  VTAVLSATRDIENTYQIEFTTASWALTAYAITFAGFIAFLGRVGDIIG-NSVLFVSSCFL 99

Query: 140 I-VWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLI 198
             + SLIC +    ++   F V RA QG+  + I+P+   ++ +  ++         +++
Sbjct: 100 FSILSLICAV---VNNFGTFAVFRALQGIAAAGIVPSGYALIPT--LSDEHEVQSFFAIV 154

Query: 199 GCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFV--LSIWLIPNTIPTNVHG 256
            C       +G +  G             + ++A+   I+ +   SI    N  P     
Sbjct: 155 SCGFSTSFGIGFIIGGAFTLTRIGYKGIFYLTFAVMLVISIISYFSIGTSANQKPCTKDS 214

Query: 257 HK---------MDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFI 307
            K         +D+IGS + +   I++     +   + W                  FFI
Sbjct: 215 PKTTKWSDALSLDFIGSFMFISSTILIVVGLTEGG-ESWKKPSAYVTLIVGIALFVLFFI 273

Query: 308 YEL-------------------HFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXXXX 348
           + +                   +F     L+PK+VL     I +  A+            
Sbjct: 274 WNICYGVLVKNLKSASNPKVYNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLY 333

Query: 349 XXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSI 408
                   +   +PL A       ++  ++  +V+      + P   + L       GSI
Sbjct: 334 IVNQYCQYVSKNSPLLAAVKLLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSI 393

Query: 409 IMSVTPIH----QTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTM 464
           I+    +H      Y++       +++FG  + FP S  +L    P +Y+G+A  ++ T 
Sbjct: 394 IL--IQLHLITDNLYWKIFFCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTF 451

Query: 465 VNYSMSFCLGVAGVVEQHVNN-HGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQG 523
             + +     V   +  ++N   GK    G     +      ++A  + G +  +  ++ 
Sbjct: 452 GQFGVEVTFSVMTSILGNINELSGKSGSAGIYKTRFQNCTYFTLASSVVGLISTAFFVKE 511

Query: 524 RKNEKDS 530
            K   D+
Sbjct: 512 NKPTDDT 518

>TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON} 
          Length = 520

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 60/135 (44%), Gaps = 22/135 (16%)

Query: 122 IGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILG--- 178
           + ++YG +KT ++   F IVW  +             I S+  +G+     L    G   
Sbjct: 137 LSELYGRRKTFIISLFFSIVWQCLV------------IWSKTIEGVMFGRFLSGFFGSAF 184

Query: 179 --IVGSIYIAGSKRKNMVISL-IGCMAP-IGATLGAVFSGLIGTEDANQWPWAFYSYAIT 234
             + G ++    ++KN+ I + I   +P +G  LG + SG +       + W F +  + 
Sbjct: 185 LSVAGGLFTDIFEKKNIGIPITIYTTSPMLGPALGPIISGAL---HGTNYKWTFITMLLA 241

Query: 235 AAINFVLSIWLIPNT 249
           + ++F+  I L+P T
Sbjct: 242 SGLSFICVILLVPET 256

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 91/242 (37%), Gaps = 29/242 (11%)

Query: 28  QDNNDIVDEKQCDT------QAIDGNQKWQNPEYFD-------STLKEYLFLCSCFVSQL 74
            DNN+ VD    D       +  + + +  N   FD       S  ++ L +  C  +  
Sbjct: 22  SDNNN-VDRSSSDAISDNDAERSNSHSEIDNESNFDMVPYSRFSHKQKMLLVVQCAFTGF 80

Query: 75  LNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLV 134
            +        P++ I+    +         +  + +  G    I G + D +G +  +L 
Sbjct: 81  FSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGRRPIVLW 140

Query: 135 GYL--FLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKN 192
             L  F     L C     AH+ +  +  R  Q  GIS ++    GI+G   +     + 
Sbjct: 141 AILAYFCACIGLAC-----AHNYAQILALRCLQAAGISPVIAINSGIMGD--VTTKVERG 193

Query: 193 MVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTI 250
             + L+     +G   GA    LIG   +++W W   F+  AI + I  V S  L+P T 
Sbjct: 194 GYVGLVAGFQVVGTAFGA----LIGAGLSSKWGWRAIFWFLAIGSGICLVFSTLLMPETK 249

Query: 251 PT 252
            T
Sbjct: 250 RT 251

>Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W
           (REAL)
          Length = 565

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 87/210 (41%), Gaps = 29/210 (13%)

Query: 78  AGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYL 137
           AGAI   P+++++    D         +  + +  G      G   D  G +  +LV  L
Sbjct: 77  AGAIY-YPVLSVIEKKFDINEQLVNVTVVVYFVFQGLAPTFMGGFADSLGRRPVVLVAIL 135

Query: 138 FLI--VWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVI 195
             +     L C  T YA      IV R  Q  GIS ++    GI+G I    ++R   V 
Sbjct: 136 IYLGACVGLACAQT-YAQ----IIVLRCLQAAGISPVIAINSGIMGDI-TTRAERGGYVG 189

Query: 196 SLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTN 253
            + G        LG+ F  LIG   +++W W   F+  AI + + F+ S+ ++P T   N
Sbjct: 190 YVAGFQ-----VLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGVCFLGSLLVLPET-KRN 243

Query: 254 VHGHKMDWIGSGLGVVGLIMLNFVWNQAPI 283
           + G+            G I     +N+API
Sbjct: 244 IAGN------------GSITPKLYFNRAPI 261

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 60/143 (41%), Gaps = 7/143 (4%)

Query: 99  GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFF 158
           G   WL+  + L +  F+L+ GR+ +I G K+ L++  +   + SLI  L+   +S +  
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALS---NSMATL 99

Query: 159 IVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGT 218
           I  R   G G S I    L  V    I     + ++I+ +     I   +G    G    
Sbjct: 100 ISGRVVAGFGGSGI--ESLAFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAF-- 155

Query: 219 EDANQWPWAFYSYAITAAINFVL 241
            +   W W FY      A  F++
Sbjct: 156 NEHLSWRWCFYINLPIGAFAFII 178

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 79/456 (17%), Positives = 162/456 (35%), Gaps = 39/456 (8%)

Query: 73  QLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTL 132
            LLN A  I    +++ +A + +      +W + ++ +    FI   GR+GDI G     
Sbjct: 41  DLLNVASMIS---LIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 133 LVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKN 192
            +      V SL+C +     +   F V RA QG+  + ++P    ++    +A  ++  
Sbjct: 98  TISCSCFAVLSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIP--ILAPKEKVQ 152

Query: 193 MVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLI------ 246
              S++ C       LG +  G   T         + ++A+   I+ +   +        
Sbjct: 153 KYFSIVSCGFSSTIGLGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLN 212

Query: 247 --PNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXA 304
             P     +     +D+IGS + V G I++     +   + W+                 
Sbjct: 213 KKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLVIGIILFFG 271

Query: 305 FFIYEL------------------HFVNGNPLLPKEVLKSPKTIIVLFALXXXXXXXXXX 346
           FF++                    +F     L+P +VL     I ++ A           
Sbjct: 272 FFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIVLAFALNNACLFSC 331

Query: 347 XXXXXXXQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCG 406
                         +PL AG      +I  ++   +  F   K+ P + + +       G
Sbjct: 332 LYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFFLALAG 391

Query: 407 SIIMSVTPI--HQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTM 464
           SII+    +     +++       ++ FG+ + +P +  +     P + +G+A  +  T 
Sbjct: 392 SIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQTF 451

Query: 465 VNYSMSFCLGVAGVVEQHVNN-HGK-DVLKGYRGAF 498
               +     V   V  ++N   GK + ++ +R  F
Sbjct: 452 GQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGF 487

>Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON}
           YBR043C (REAL)
          Length = 683

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 60/140 (42%), Gaps = 11/140 (7%)

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           G F L    + ++ G + T +  +  L  +S+   L    +S   FI  R   G   + +
Sbjct: 157 GVFPLWWSSLSELEGRRTTYITSFAMLFAFSIGSALAPDINS---FIALRMLCGAASASV 213

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSY- 231
                G V  +YI+  + KN+    +G +      L  + S +IG+   N+WPW    + 
Sbjct: 214 QSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIIGSLLVNRWPWRSTQWF 267

Query: 232 -AITAAINFVLSIWLIPNTI 250
             I +  N +L   L+P T+
Sbjct: 268 MVILSGCNVILLTVLLPETL 287

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 94/234 (40%), Gaps = 23/234 (9%)

Query: 30  NNDIVDEKQCDTQA----IDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQP 85
           ++D   E   D Q     ++G Q +  P    +  +++  +    ++   +  G+    P
Sbjct: 55  DDDTSSECSHDEQEQQHIVEGEQNY--PHTLLTYRQKWFMVFLMTITGFWSSLGSPIYYP 112

Query: 86  IMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145
            +  +    +    K    +  + L  G    ISG + D+YG +  +L G L  +V S+ 
Sbjct: 113 ALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI- 171

Query: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMV-----ISLIGC 200
            G+ K A S    +  R  Q +GIS  +    G+V S +    +R   V     + LIG 
Sbjct: 172 -GIAK-APSYGVIVFLRCIQSIGISPTIAISSGVV-SDFTVKRERGTFVGATSGLVLIG- 227

Query: 201 MAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNV 254
              IG  LGAV +       A  W   F+   I      ++  +L+P T  T V
Sbjct: 228 -QGIGPLLGAVITA------ALHWRAVFWFLTIGCGSCMIIGFFLLPETKRTIV 274

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 77/174 (44%), Gaps = 15/174 (8%)

Query: 85  PIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSL 144
           P +  +    +    K    +  + L  G    +SG + D++G +  +L G +  +V S+
Sbjct: 123 PALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASI 182

Query: 145 ICGLTKYAHSDSFFIVS--RAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA 202
             GL   A + S+ ++   R  Q +GIS  +    G+VG   +     K+   + +G  +
Sbjct: 183 --GL---ACAPSYGVICFLRCIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATS 232

Query: 203 PIGATLGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNV 254
            +   LG  F  LIG     +W W   F+  AI + +  +++ + +P T  T V
Sbjct: 233 GL-VLLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIV 285

>Smik_15.488 Chr15 complement(839667..841235) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 20/156 (12%)

Query: 59  TLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILI 118
           T   +L L +CF   LLN  G +++    N +A    S  G   WL + F  +  +  +I
Sbjct: 111 TFGCFLGLVACF--GLLNSTGVLESHLQDNQLASESVSTIG---WLFSLFLFVCFASCII 165

Query: 119 SGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSF--FIVSRAF-QGLGISLILPN 175
           SG   D  G +  ++VG +F +      GL   A+S  +  FI+S A   G G  +IL  
Sbjct: 166 SGTYFDRNGFRTIMIVGTVFHVA-----GLFATANSTKYWHFILSFAIVCGFGNGIILSP 220

Query: 176 ILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAV 211
           ++ +    +    KR+   ++    MA IG ++G V
Sbjct: 221 LVSVPAHYFY---KRRGTALA----MATIGGSVGGV 249

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 97/245 (39%), Gaps = 37/245 (15%)

Query: 102 AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVS 161
           +W+  A+ L S +F  + G++ DI+G +  L+   L   + +LICG++K   +    ++ 
Sbjct: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSK---NLWVLVLG 234

Query: 162 RAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDA 221
           R   G+G   +    +  + +  I   + + +   +      +G   G +  GL   + A
Sbjct: 235 RFVAGIGGGGL--TSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGLFA-DRA 291

Query: 222 NQWPWAF-----YSYAITAAINFVLSIWLIPNTIPTNVHGHK---------------MDW 261
             W  AF      +   T AI   L       T+P  V  HK               +DW
Sbjct: 292 VGWRMAFLVQVPLTLLSTTAIQLFL-------TLPKPVDAHKGAGQRSIPWTTKLRMVDW 344

Query: 262 IGSGLGVVGLIMLNFVWNQAPIDGWDSAYXXXXXXXXXXXXXAFFIYELHFVNGNPLLPK 321
            G+   VV L     V +   + G D  +             ++FIY   +V  +P+LP 
Sbjct: 345 TGTVTLVVFLFCFTLVCS---LYGEDLPH-LYLIFVVILLSGSYFIYHELYVATDPILPI 400

Query: 322 EVLKS 326
             L++
Sbjct: 401 RFLEN 405

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%)

Query: 102 AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149
           +W+  A+ L S +F  I G+I DI+G K  L+   +   V SLICGL+
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 95/232 (40%), Gaps = 15/232 (6%)

Query: 28  QDNNDIVDEKQCDTQAIDGNQK-WQNPEY--FDSTLKEYLFLCSCFVSQLLNQAGAIQTQ 84
            DN  ++++    + A   N+K  Q P Y  F  + K  L +  C  + L +   A    
Sbjct: 42  DDNQKVIEQISKPSSANPNNEKTCQEPPYSRFGKSEKSILAVL-CASAGLFSTISAPIYY 100

Query: 85  PIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSL 144
           P + I+ +  +         +  + ++ G   ++ G + D  G +  +L     + ++++
Sbjct: 101 PALTIIEEDFNISQEMVNITVVVYFILQGLAPMLMGGLADKVGRRPIVLCS---IALYAV 157

Query: 145 ICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPI 204
            C     A +    +  R  Q  GIS ++    GI+G I     +        +G MA  
Sbjct: 158 ACIGLASAQNYGEVLFLRCLQSAGISPVVAVNNGIIGDITTKAERG-----GYLGLMAGT 212

Query: 205 GATLGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNV 254
              +G+ F  LIG     +W W   F+  AI +  +  ++ +L+P T  T V
Sbjct: 213 -QVIGSAFGALIGAGITARWGWRAIFWFLAIGSGFSLAVASFLLPETKRTVV 263

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 62/145 (42%), Gaps = 11/145 (7%)

Query: 110 LISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGI 169
           L  G    ISG + D +G +  +L G L  +V S+  GL   A S    I  R  Q +GI
Sbjct: 147 LFQGVSPTISGGLADCFGRRPIILAGMLIYVVASI--GLA-CAPSYGVIIFLRCIQSIGI 203

Query: 170 SLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA-- 227
           S  +    G+VG  +    +R   V +  G +      LG  F  LIG     +W W   
Sbjct: 204 SPTIAISSGVVGD-FTLKHERGTFVGATSGFVL-----LGQCFGSLIGAVLTARWDWRSI 257

Query: 228 FYSYAITAAINFVLSIWLIPNTIPT 252
           F+   I     F+++  ++P T  T
Sbjct: 258 FWFLTIGCGSCFLIAFLVLPETKRT 282

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 99/249 (39%), Gaps = 31/249 (12%)

Query: 41  TQAIDGNQKWQNPEY--FDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQN 98
           T+++    +   P +  F  + K  L     F       AGAI   P+++++    +   
Sbjct: 60  TESVKPEPEITAPPHSRFSRSFKTVLIAQCAFTGFFSTIAGAIY-YPVLSVIERKFNIDE 118

Query: 99  GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYL--FLIVWSLICGLTKYAHSDS 156
                 +  + +  G    + G   D  G +  +L+  +  F     L C  T YA    
Sbjct: 119 QLVNVTVVVYFVFQGLAPTLMGGFADSLGRRPVVLIAIIIYFGACVGLACTQT-YAQ--- 174

Query: 157 FFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLI 216
             IV R  Q  GIS ++    GI+G I    ++R   V    G        LG+ F  LI
Sbjct: 175 -IIVLRCLQAAGISPVIAINSGIMGDI-TTRAERGGYVGYAAGFQ-----VLGSAFGALI 227

Query: 217 GTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIML 274
           G   +++W W   F+   I + I F+ S+ ++P T   N+ G+            G +M 
Sbjct: 228 GAGLSSRWGWRAIFWFLTIGSGICFLASLLILPET-KRNISGN------------GSVMP 274

Query: 275 NFVWNQAPI 283
             + N+API
Sbjct: 275 KSLLNRAPI 283

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 12/165 (7%)

Query: 104 LMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRA 163
           L A  PL+ G F    GR        K L +  LF+   + I   +  A+  + ++V R 
Sbjct: 182 LFAFMPLVWGMFADFGGR--------KFLYIISLFIFTVANILLASLPANIIALYLV-RV 232

Query: 164 FQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQ 223
            Q +G S  +    G V  I     + K++ + ++G    +G  +  + +GLI   ++NQ
Sbjct: 233 LQVVGASAAISLGTGTVADISPPKHRGKSVALFMLG--PNMGPIIAPIIAGLI-LMNSNQ 289

Query: 224 WPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGV 268
           W W F   AI   +  ++ I ++P T+   V  +   W  S  G 
Sbjct: 290 WRWLFGFSAICTGVALMIVIVILPETLRCIVGNNDPKWSRSQRGT 334

>Suva_8.358 Chr8 complement(630597..632165) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 81/187 (43%), Gaps = 26/187 (13%)

Query: 28  QDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIM 87
            DN     E + D+    G + W        T   ++ L +CF   LLN  G +++    
Sbjct: 86  SDNEKEDSEDEADSFPEGGAKAWI------VTFGCFMGLVACF--GLLNSTGVMESHLQD 137

Query: 88  NIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICG 147
           N +A    S  G   WL + F  +  +  +ISG   D  G +  +++G +F +      G
Sbjct: 138 NQLAKESVSTIG---WLFSLFLFVCFASCIISGTYFDRNGFRTIMIIGTVFHVA-----G 189

Query: 148 LTKYAHSDSF--FIVSRAF-QGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPI 204
           L   A+S  +  FI+S A   G G  ++L  ++ +    +    KR+   +++    A I
Sbjct: 190 LFATANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHYFF---KRRGTALAV----ATI 242

Query: 205 GATLGAV 211
           G ++G V
Sbjct: 243 GGSVGGV 249

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 68  SCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYG 127
           S ++   L  A       IM  +A   + +  + +W+  A+ L S +F  + G++ DI+G
Sbjct: 84  SMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFG 142

Query: 128 LKKTLLVGYLFLIVWSLICGLT 149
            K  L++  +  +V  L+CGLT
Sbjct: 143 RKPLLMLNNIVFLVGCLMCGLT 164

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 60/137 (43%), Gaps = 11/137 (8%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNIL 177
           +SG + D +G +  +L G L  +V S+  GL   A S    I  R  Q +GIS  +    
Sbjct: 154 VSGGLADCFGRRPIILAGMLIYVVASI--GLA-CAPSYGVIIFLRCIQSIGISPTIAISS 210

Query: 178 GIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAITA 235
           G+VG  +    +R   V +  G +      LG  F  LIG     +W W   F+   I  
Sbjct: 211 GVVGD-FTLKHERGTFVGATSGFVL-----LGQCFGSLIGAVLTARWDWRSIFWFLTIGC 264

Query: 236 AINFVLSIWLIPNTIPT 252
              F+++  ++P T  T
Sbjct: 265 GSCFLIAFLILPETKRT 281

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 17/137 (12%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVS--RAFQGLGISLILPN 175
           ISG + D+YG +  +L+G L       +C     A S+S+ ++   R  Q  GIS I+  
Sbjct: 141 ISGGLADVYGRRPVILIGMLI-----YVCASIGLACSNSYGVIVFLRCLQSAGISPIIAI 195

Query: 176 ILGIVGSIYIAGSKRKNMVISLIGCMAPIGATL-GAVFSGLIGT--EDANQWPWAFYSYA 232
             G+VG   +   +      + +G ++  G TL G  F  LIG     A  W   F+   
Sbjct: 196 NSGVVGDFTVKQERG-----TFVGAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLT 248

Query: 233 ITAAINFVLSIWLIPNT 249
           I      +++  L+P T
Sbjct: 249 IGCGTCMLVNFLLLPET 265

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 102/243 (41%), Gaps = 32/243 (13%)

Query: 29  DNNDIVDEKQCDTQAIDGNQKWQN--------PEY--FDSTLKEYLFLCSCFVSQLLNQA 78
           D++D  +    DT       K QN        P Y  FD   K +L +   F   L + A
Sbjct: 57  DDDDDEEGNHHDTTNGMYKTKSQNRDEPDIDSPPYSWFDKKEKAFLVVQCAFTGLLSSLA 116

Query: 79  GAIQTQPIMNIVADSL---DSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVG 135
           G+I   P+++++       + Q      +   F  +S + +   G + D  G ++ +++ 
Sbjct: 117 GSIY-YPVLSVLEVKFHITEEQINISVVVYYVFQAVSPTLM---GGLADSLG-RRPVIIT 171

Query: 136 YLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVI 195
            +FL   + I GL    ++ S  I  R  Q  GIS ++    G++G +     +      
Sbjct: 172 SVFLYFCACI-GLA-CCNNYSQLIGLRCLQATGISPVIAVNSGLMGDVTTKAERG----- 224

Query: 196 SLIGCMAPIGAT--LGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIP 251
              G M  +  T  LG  F  LIG    ++W W   F+   I + +  VLS++++P T  
Sbjct: 225 ---GYMGLVSGTQVLGTAFGALIGAALFSRWGWRSIFWFLVIGSGVCLVLSLFILPETKR 281

Query: 252 TNV 254
           T V
Sbjct: 282 TVV 284

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 60/137 (43%), Gaps = 11/137 (8%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNIL 177
           +SG + D +G +  +L G L  ++ S+  GL   A S    I  R  Q +GIS  +    
Sbjct: 155 VSGGLADCFGRRPIILAGMLIYVIASI--GLA-CAPSYGVIIFLRCIQSIGISPTIAISS 211

Query: 178 GIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAITA 235
           G+VG  +    +R   V +  G +      LG  F  LIG     +W W   F+   I  
Sbjct: 212 GVVGD-FTLKHERGTFVGATSGFVL-----LGQCFGSLIGAVLTARWDWRAIFWFLTIGC 265

Query: 236 AINFVLSIWLIPNTIPT 252
              F+++  ++P T  T
Sbjct: 266 GSCFLIAFLILPETKRT 282

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 122 IGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIV--SRAFQGLGISLILPNILGI 179
           + D YG +  +L+G L  IV S+       A S+SF +V   R  Q  GIS I+    G+
Sbjct: 128 LADTYGRRPVILMGMLIFIVSSI-----GIACSNSFALVIALRCIQSSGISPIIAINSGV 182

Query: 180 VGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE--DANQWPWAFYSYAITAAI 237
           VG  +   S+R   + ++ G        LG  F  LIG     A  W   F+   I   +
Sbjct: 183 VGD-FTLKSERGTFIGAVSGL-----TLLGQAFGSLIGASLTAAYNWRAVFWFMTIGCGV 236

Query: 238 NFVLSIWLIPNT 249
            F+ +   +P T
Sbjct: 237 CFLANFLFLPET 248

>TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {ON} 
          Length = 522

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 83/184 (45%), Gaps = 30/184 (16%)

Query: 36  EKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVS-----QLLNQAGAIQTQPIMNIV 90
           EKQ DT  ID    + N EY +  L+ +L +  CF        LLN  G ++T    N +
Sbjct: 88  EKQ-DT--ID----FTNIEYPEGGLRSWLVVLGCFCGLFTCLGLLNAIGIVETYIQENQL 140

Query: 91  ADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTK 150
           ++   S  G   W+ +    ++ S  + SG   D  G K  ++VG +       +CGL  
Sbjct: 141 SNESSSSIG---WIFSLLLFVNFSSCIFSGTYFDRNGFKIPVIVGTIL-----HVCGLVA 192

Query: 151 YAHSDSF--FIVSRAFQ-GLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGAT 207
            A+S     FI+S +   GLG   I+  ++      +   +KR+ +  +L    A +G +
Sbjct: 193 MANSTKLWQFILSLSIAVGLGNGFIMSPLISAPSHYF---NKRRGLATAL----ATLGGS 245

Query: 208 LGAV 211
           +G V
Sbjct: 246 IGGV 249

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 55/116 (47%), Gaps = 13/116 (11%)

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           GSF L  GR+GDIYG +  L+V     IV ++I   +  A     +++ R   GLG  LI
Sbjct: 127 GSFFL--GRLGDIYGRRIGLIVASFIFIVGTVIQIASVKAWYQ--YMIGRIVAGLGCGLI 182

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGC---MAPIGATLGAVFS-GLIGTEDANQW 224
                 I+  + I+    KNM  +++ C   M  +G  LG   + G     D+ QW
Sbjct: 183 -----AILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKRYHDSTQW 233

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 96  SQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSD 155
           +Q  K +W+  ++ L S +F  + G++ DI+G K  L+   +  ++  L+CGL+K   S 
Sbjct: 143 NQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSK---SF 199

Query: 156 SFFIVSRAFQGLG 168
            + +++R   G+G
Sbjct: 200 WWLVIARFVAGVG 212

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 8/128 (6%)

Query: 47  NQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMA 106
            ++ QN +Y        +FL   F   LLN AG I    ++  + ++   +    +W + 
Sbjct: 20  RRRCQNSKYQLIINMALIFLGCTF--DLLNVAGVIS---VIEDLGETYGLEYTTASWALT 74

Query: 107 AFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQG 166
           ++ +     I   GR+GDI G      +   F  ++ L+C +     +   F V RA QG
Sbjct: 75  SYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNFPA---FAVLRALQG 131

Query: 167 LGISLILP 174
           +  + ++P
Sbjct: 132 IAAAGLVP 139

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 54/128 (42%), Gaps = 8/128 (6%)

Query: 122 IGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVG 181
           I ++YG + T +      I+W     LT ++H+    +  R   G   S  L    G + 
Sbjct: 134 ISELYGRRLTFIFSMTLSIIWQC---LTTWSHNVVGMMFGRFLSGFFGSAFLSIAGGSIS 190

Query: 182 SIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVL 241
            I+   +    M +  + C    G  LG + SG +  E+   + W F +  I + +  VL
Sbjct: 191 DIFDKATITIPMSLYTLSCF--YGPVLGPIVSGALYREN---YRWVFATLLIASGVCLVL 245

Query: 242 SIWLIPNT 249
            I+ IP T
Sbjct: 246 IIFTIPET 253

>Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON}
           YBR043C (REAL)
          Length = 688

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 60/140 (42%), Gaps = 11/140 (7%)

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           G F L    + ++ G + T +  +  L  +++      +A   + FI  R   G   + +
Sbjct: 157 GVFPLWWSSMSELEGRRTTYITSFALLFAFNIGSA---FAPDINSFIALRMLCGAASASV 213

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSY- 231
                G V  +YI+  + KN+    +G +      L  + S +IG+   N+WPW    + 
Sbjct: 214 QSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIIGSLLVNRWPWRSTQWF 267

Query: 232 -AITAAINFVLSIWLIPNTI 250
             I +  N +L   L+P T+
Sbjct: 268 MVILSGCNVILLTVLLPETL 287

>YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}
           QDR3Multidrug transporter of the major facilitator
           superfamily, has a role in polyamine homeostasis;
           expression is upregulated under polyamine stress;
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin
          Length = 689

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 59/140 (42%), Gaps = 11/140 (7%)

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           G F L    + ++ G + T +  +  L  +++   L    +S   FI  R   G   + +
Sbjct: 157 GVFPLWWSSLSELEGRRTTYITSFALLFAFNIGSALAPDINS---FIALRMLCGAASASV 213

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSY- 231
                G V  +YI+  + KN+    +G +      L  + S + G+   N+WPW    + 
Sbjct: 214 QSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIFGSLLVNRWPWRSTQWF 267

Query: 232 -AITAAINFVLSIWLIPNTI 250
             I +  N +L   L+P T+
Sbjct: 268 MVILSGCNVILLTVLLPETL 287

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 13/116 (11%)

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           GSF L  GR+GDIYG +  L+V  +  I+ ++I   +  A     +++ R   GLG  LI
Sbjct: 134 GSFFL--GRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQ--YMIGRIIAGLGCGLI 189

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGC---MAPIGATLGAVFS-GLIGTEDANQW 224
                 I+  + I+    KNM  +++ C   M  +G  LG   + G     ++ QW
Sbjct: 190 -----AILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKKYHNSRQW 240

>Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON}
           YBR043C (REAL)
          Length = 689

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 59/140 (42%), Gaps = 11/140 (7%)

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           G F L    + ++ G + T +  +  L  +++   L    +S   FI  R   G   + +
Sbjct: 157 GVFPLWWSSLSELEGRRTTYITSFALLFAFNIGSALAPDINS---FIALRMLCGAASASV 213

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSY- 231
                G V  +YI+  + KN+    +G +      L  + S + G+   N+WPW    + 
Sbjct: 214 QSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIFGSLLVNRWPWRSTQWF 267

Query: 232 -AITAAINFVLSIWLIPNTI 250
             I +  N +L   L+P T+
Sbjct: 268 MVILSGCNVILLTVLLPETL 287

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 90/220 (40%), Gaps = 15/220 (6%)

Query: 40  DTQAID-GNQKWQNPEY--FDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDS 96
            TQ++  G     +P Y  F  T K  L +   F     + AGAI   P++ ++    + 
Sbjct: 75  KTQSVKLGPNTTDSPPYSRFGRTEKSLLIIQCAFTGFFSSVAGAIY-YPVLTVIEKKFNI 133

Query: 97  QNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDS 156
                   +  + +  G      G + D  G +  +L     ++V+   C     + + +
Sbjct: 134 TEELVNITVVVYFIFQGLAPSFMGGLADSLGRRPVVLFS---ILVYCCACIGLALSQNYT 190

Query: 157 FFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLI 216
             +V R  Q  GIS ++    GI G I    ++R   V  + G +      +G+ F  LI
Sbjct: 191 QIVVLRCLQAAGISPVIAINSGICGDI-TTRAERGAYVGYVSGFIV-----IGSAFGALI 244

Query: 217 GTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNV 254
           G   ++ W W   F+   I + I  ++SI ++P T  T V
Sbjct: 245 GAGLSSTWGWRSIFWFLTIGSGICLMISIIVLPETKRTLV 284

>KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 663

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 87/206 (42%), Gaps = 19/206 (9%)

Query: 53  PEYFDST-----LKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAA 107
           PEY DS      LK ++ L   + + +     +I    I  +VAD  D+        +  
Sbjct: 96  PEYKDSREYPRHLKSFIVLIIAYGAVMGPMGTSIIFPAIGPLVAD-FDTSTIMVDVSVGI 154

Query: 108 FPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGL 167
           + L  G F +    + +I G +   ++ +  L  +++   L+    + S FIV R  QG 
Sbjct: 155 YLLSLGIFPIWWSSLSEIEGRRTVYVLSFTLLTAFTIGSALSP---NISAFIVFRMLQGA 211

Query: 168 GISLILPNILGIVGSIYIAGSKRKNMVISLIGC-MAPIGATLGAVFSGLIGTEDANQWPW 226
             + +     G +  ++I   + KN+    +G  MAP+        S +IG    N+W W
Sbjct: 212 SSASVQSVGAGTISDLFIPEERGKNLGYYYLGTLMAPL-------LSPIIGALLVNRWSW 264

Query: 227 AFYSY--AITAAINFVLSIWLIPNTI 250
               +   I A +N +L   L+P T+
Sbjct: 265 RSTQWFMVILAVVNVLLFTLLLPETL 290

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 60/137 (43%), Gaps = 11/137 (8%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNIL 177
           + G + D +G +  +L G L  +V S+  GL   A S    I  R  Q +GIS  +    
Sbjct: 155 VCGGLADCFGRRPIILGGMLVYVVASV--GLA-CAPSYGVIIFLRCVQSIGISPTIAISS 211

Query: 178 GIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAITA 235
           G+VG  +    +R   V +  G +      LG  F  LIG     +W W   F+   I  
Sbjct: 212 GVVGD-FTLKHERGTFVGATSGFVL-----LGQCFGSLIGAVLTARWDWRSIFWFLTIGC 265

Query: 236 AINFVLSIWLIPNTIPT 252
              F+++ +++P T  T
Sbjct: 266 GTCFLIAFFILPETKRT 282

>KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON} 
          Length = 516

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 8/128 (6%)

Query: 122 IGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVG 181
           I ++YG + T +      IVW     LT ++ + +  +  R   G   S  L    G + 
Sbjct: 134 ISELYGRRATFIFSLTLSIVWQC---LTTWSRTLTGVMFGRFLSGFFGSSFLSVAGGAIS 190

Query: 182 SIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVL 241
            I++    +  + +SL    A +G +LG + SG + T D   + W F ++ I + +  V 
Sbjct: 191 DIFL--KSQITVPMSLYTTAAMMGPSLGPIISGALYTVD---FRWTFVTFIIASGVCLVA 245

Query: 242 SIWLIPNT 249
            +  IP T
Sbjct: 246 IVVTIPET 253

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 102 AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149
           +W+  A+ L S +F  + G+I DI+G K  L+   +   +  LICGL+
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 56/130 (43%), Gaps = 7/130 (5%)

Query: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI 159
           K  W+++ + L      L+ GR   I+G K +LL+  L     SLI  ++   +S +  I
Sbjct: 77  KSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAVS---NSMNVLI 133

Query: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE 219
             R   G+G S I    L  V +  +   + + + IS++ C   + A  G    G   T 
Sbjct: 134 GGRVVAGIGGSGI--QSLCFVIASTLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTH 191

Query: 220 DANQWPWAFY 229
               W W FY
Sbjct: 192 --VTWRWCFY 199

>Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}
           similar to Ashbya gossypii AGL069C
          Length = 638

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 7/125 (5%)

Query: 125 IYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIY 184
           ++G +   LVG L  ++ S+ C  +    S ++ ++SR   G G+S +       +  IY
Sbjct: 177 LFGKRLVYLVGILIFMIGSIGCACST---SFNWLLISRVVSGFGLSTVESLPSATIAEIY 233

Query: 185 IAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIW 244
            A  +   + I  +  +   G  L  +   L+    +  W   F+   I A  NFVL + 
Sbjct: 234 FAHERAYRLGIYTLLLLG--GKNLVPLLGSLVFEHLSTHW--LFWILTIIAGSNFVLHLL 289

Query: 245 LIPNT 249
            +P T
Sbjct: 290 FVPET 294

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 88/220 (40%), Gaps = 15/220 (6%)

Query: 40  DTQAIDGNQ---KWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDS 96
           ++Q+  GN+   + +    F  T K  L +   F       AG+I   P++ ++    + 
Sbjct: 40  NSQSEVGNESDFELEPYSRFSHTQKMLLVVQCAFTGFFSTVAGSIY-YPVLTVIEKKFNI 98

Query: 97  QNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDS 156
                   +  + +  G    I G + D +G +  +L   L    +   C     +H+ +
Sbjct: 99  TEELANVTIVVYFVFQGLAPSIMGGLADTFGRRPVVLWAVL---TYCCACIGLASSHNYA 155

Query: 157 FFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLI 216
             +  R  Q  GIS ++    GI+G +       +   + L+     +G   G     LI
Sbjct: 156 QILALRCLQAAGISPVIAINSGIMGDV--TTKVERGGYVGLVSGFQVVGTAFG----ALI 209

Query: 217 GTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNV 254
           G   +++W W   F+  AI + I  V+S  L+P T  T V
Sbjct: 210 GAGLSSRWGWRAIFWFLAIGSGICLVVSALLLPETKRTLV 249

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 63/135 (46%), Gaps = 13/135 (9%)

Query: 122 IGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVG 181
           + D  G +   ++ +  L+V+S+    T ++ +   FI+ R   G   + +     G + 
Sbjct: 154 LADKNGRRTVYVLSFALLVVFSVG---TAFSRNIETFIILRILCGAASASVQSVGAGTIA 210

Query: 182 SIYIAGSKRKNMVISLIG-CMAPIGATLGAVFSGLIGTEDANQWPWAFYSY--AITAAIN 238
            +Y+   + +N+    +G  MAP+   L  + S L+     N+W W    +   I AA+ 
Sbjct: 211 DLYVPEERGRNLGYYYLGPLMAPL---LSPIVSSLL----VNRWSWRSTQWFMVILAALT 263

Query: 239 FVLSIWLIPNTIPTN 253
           F+L ++ +P T+ T 
Sbjct: 264 FLLLVFALPETLRTQ 278

>Smik_3.206 Chr3 complement(303825..304154) [330 bp, 109 aa] {ON}
           YBR008C (REAL)
          Length = 109

 Score = 33.5 bits (75), Expect = 0.36,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 204 IGATLGAVFSGLIGTED--ANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNV 254
           IGA L  V + L+G     A  W + F+     A  NFVL  + +P T+  NV
Sbjct: 6   IGAVLAPVMAPLLGASMMVAKGWRYIFWLLTWVATANFVLLFFFLPETLSDNV 58

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 3/67 (4%)

Query: 102 AWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVS 161
           +W + ++ +    FI   GR+GDI G  +   V      + SL+CGL     +   F V 
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCGLMPNFEA---FAVM 123

Query: 162 RAFQGLG 168
           RA QG+ 
Sbjct: 124 RALQGIA 130

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 63/142 (44%), Gaps = 17/142 (11%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVS--RAFQGLGISLILPN 175
           ISG + D+YG +  +L+G L       +C     A S S+ ++   R  Q  GIS I+  
Sbjct: 141 ISGGLADVYGRRPVILMGMLI-----YVCASIGLACSQSYGVIVFLRCLQSAGISPIIAI 195

Query: 176 ILGIVGSIYIAGSKRKNMVISLIGCMAPIGATL-GAVFSGLIGT--EDANQWPWAFYSYA 232
             G+VG   +     K+   + +G ++  G TL G  F  LIG     A  W   F+   
Sbjct: 196 NSGVVGDFTL-----KHERGTFVGAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLT 248

Query: 233 ITAAINFVLSIWLIPNTIPTNV 254
           I      +++  ++P T  T V
Sbjct: 249 IGCGTCMIINFLILPETKRTLV 270

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 17/130 (13%)

Query: 125 IYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIY 184
           ++G +   L+G +     S+ C ++   HS    + SR   GLG++ I       V  IY
Sbjct: 140 LFGKRILYLIGIIVFFFGSIGCSVS---HSYESLLASRIVSGLGVATIESLPSATVAEIY 196

Query: 185 IAGSKRKNM---VISLIG--CMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINF 239
            A  +   +    + L+G   + P+ A+L  VF  L      +++ W F+   I   INF
Sbjct: 197 FAHERAYRLGVYTLLLLGGKNLVPLLASL--VFQSL------DRY-WLFWIVTIIVGINF 247

Query: 240 VLSIWLIPNT 249
           VL ++ +P T
Sbjct: 248 VLHLFFVPET 257

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 13/116 (11%)

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           GSF L  GR+GDIYG +  L+V  +  I  ++I   +  A     +++ R   GLG  LI
Sbjct: 137 GSFFL--GRLGDIYGRRIGLIVASVIFIAGTIIQIASIKAWYQ--YMIGRIVAGLGCGLI 192

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGC---MAPIGATLGAVFS-GLIGTEDANQW 224
                 I+  + I+    KNM  +++ C   M  +G  LG   + G     D+ QW
Sbjct: 193 -----AILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKRYHDSTQW 243

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 59/138 (42%), Gaps = 13/138 (9%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSL-ICGLTKYAHSDSFFIVSRAFQGLGISLILPNI 176
           +SG + DIYG +  +L G L  +V S+ I     Y       I  R  Q  GIS ++   
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYG----VIIFLRCLQSTGISPLIAIS 208

Query: 177 LGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYAIT 234
            G VG  +   ++R   V ++ G +      +G  F  LIG   A  + W   F+  AI 
Sbjct: 209 SGAVGD-FTVKAERGTFVGAVSGLV-----LMGQAFGSLIGAALAAAYNWRAIFWFLAIG 262

Query: 235 AAINFVLSIWLIPNTIPT 252
                 ++  ++P T  T
Sbjct: 263 CGACMAIAGIVLPETKRT 280

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 39/204 (19%), Positives = 82/204 (40%), Gaps = 12/204 (5%)

Query: 49  KWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAF 108
           ++++P  + S LK+++ L   + S ++   G     P + ++    ++        +  +
Sbjct: 86  EYKDPRDYPSILKKFIVLLIAYAS-MMGPMGTSIVFPAIGLITSDYNTSTIMVNVSVGIY 144

Query: 109 PLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLG 168
            +  G F L    I ++ G +   LV +  L  +   C  T  + +   FI+ R   G  
Sbjct: 145 LISLGVFPLWWSSISELKGRRTVYLVSFTLLFAF---CIGTAVSPNIQAFIILRVLCGAS 201

Query: 169 ISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAF 228
            + +     G +  +Y    + KN+    +G +         + S +IG+   N W W  
Sbjct: 202 SASVQSVGAGTIADLYAPEERGKNLGYFYLGALT------APLLSPIIGSLLVNHWSWRS 255

Query: 229 YSY--AITAAINFVLSIWLIPNTI 250
             +   I A  N +L +  +P T+
Sbjct: 256 TQWFMVILAGANVILIVLFLPETL 279

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 102/233 (43%), Gaps = 28/233 (12%)

Query: 26  FKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDS------TLKEYLFLCSCFVSQL-LNQA 78
           F+Q+++ I          ++G +  Q  E +D         K++  +   FV QL +N  
Sbjct: 45  FRQESSSI--------HTVNGKRVLQEYEVYDKLGYEFPQWKKWSIVTVIFVCQLSMNFN 96

Query: 79  GAIQTQPIMNIVAD-SLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYL 137
           G++    +  I  +  + SQ    + ++  F +  G    +     + YG +  + +   
Sbjct: 97  GSVYPHALSLISKEFHVSSQAANTSQMI--FKVAYGFGCELWAPWSEEYGRRNIMQLSLF 154

Query: 138 FLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNI-LGIVGSIYIAGSKRKNMVIS 196
           F  +W ++ G    A +    IV+R F G GIS    ++ LG+V  ++    +     ++
Sbjct: 155 FTNIWQILGGK---APNFGTIIVAR-FLG-GISQAGGSVTLGVVADMW--QPQDHGYAVA 207

Query: 197 LIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNT 249
            +   + +GA +G VF GL+  E+   W W F+   I   +  +L  +L+P T
Sbjct: 208 YVVLASVLGAVIGPVFGGLM--EEHLSWHWNFWIQLIFGGVTQLLHFFLVPET 258

>Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON}
           YCR098C (REAL)
          Length = 521

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 27/157 (17%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLI--CGLTKYAHSDSFFIVSRAFQGLGISLILPN 175
           I     D  G K TL++G+   IV+ LI  C   + +     FI+  A   +  +    N
Sbjct: 327 IGAYFSDRIGRKYTLMIGFSGYIVFGLIIGCAYDQLSKITPLFIIFYALMNMLGNAGPGN 386

Query: 176 ILGIVGSIYIAGSKR---------KNMVISLIG--CMAPIGATLGAVFSGLIGTEDANQW 224
           +LG++ S   A + R            + S++G  C  PI   LGA              
Sbjct: 387 MLGVISSESSATAVRGVFYGISAVTGKIGSVVGVECFQPIRDNLGA-------------- 432

Query: 225 PWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDW 261
            W F   AI   +  V++ +L+P+++ +++    +D+
Sbjct: 433 RWTFIIAAICGLVGVVITYFLVPHSLDSDLMKQDVDF 469

>ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 649

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 61/140 (43%), Gaps = 11/140 (7%)

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           G F L    I ++ G +   +V ++ L+ +++ C L+    +   FI  R   G   + +
Sbjct: 141 GVFPLWWSSISEMNGRRTVYVVSFMLLLGFNIGCALSPNIGA---FIALRFLSGAASASV 197

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSY- 231
                G V  +Y++  + +N+ I  +G +      L  + S +IG    + W W    + 
Sbjct: 198 QSVGAGTVSDLYVSEQRGRNLGIYYLGPL------LAPLISPIIGAALVSHWSWRSTQWF 251

Query: 232 -AITAAINFVLSIWLIPNTI 250
             I A  N ++ I  +P T+
Sbjct: 252 LVILAGANVLILILFLPETL 271

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 42/99 (42%), Gaps = 1/99 (1%)

Query: 52  NPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLI 111
            P    S +K  + +CS ++   L          +M  +    + Q  K  W+  ++ L 
Sbjct: 386 EPSVEMSNMKMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFN-QIPKVPWVATSYLLS 444

Query: 112 SGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTK 150
           S  F  + G++ DI+G K  L+   L      +ICG++ 
Sbjct: 445 SAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSN 483

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 97/251 (38%), Gaps = 29/251 (11%)

Query: 27  KQDNNDIVDEKQC-------DTQAIDGNQKWQNPEY--FDSTLKEYLFLCSCFVSQLLNQ 77
           K+   ++  EK+        +T     N+  + P Y  F    +  +FL   +V  L   
Sbjct: 95  KKSKEELKIEKRIATATSTEETSLKSANRSKEPPPYTAFSKKQRLIIFLVIIYVGFLGPL 154

Query: 78  AGAIQTQPIMNIVADSLD----SQNGKQAWLMAAF---PLISGSFILISGRIGDIYGLKK 130
           +G I   P + ++ +S +    + N   +  MA F   PL    F        D  G K 
Sbjct: 155 SGNIYI-PALPLLQESFNVSATTINATVSVFMAVFSVGPLFWALF-------ADFGGRKF 206

Query: 131 TLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKR 190
             +V  L  I+ +++           FF+  R  Q  G S ++   +G V  I    S+ 
Sbjct: 207 LYIVSLLLTIIVNILLSAVPTNIGALFFL--RIAQAFGSSSVMSLGIGTVSDITPPKSRG 264

Query: 191 KNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTI 250
           + +   ++G    +G  L  + +GLI    +N W W F    I + I   L + L+P T+
Sbjct: 265 RAVSYFMLG--PNMGPILAPIIAGLI-LMSSNNWRWLFGFICIISGIALFLVVLLLPETL 321

Query: 251 PTNVHGHKMDW 261
              V      W
Sbjct: 322 RCIVGNGDPHW 332

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 58/134 (43%), Gaps = 13/134 (9%)

Query: 99  GKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFF 158
           G   WL+  + L +  F+L+ GR+ +I G  + L++  +   + SLI  L+    +    
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGT---L 99

Query: 159 IVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA---PIGATLGAVFSGL 215
           I  R   G G S I  ++  +VG+  +  + R  M+ +L         +G  +G  F   
Sbjct: 100 IGGRVIAGFGGSGI-ESLAFVVGTSIVQENYRGIMITALAVSYVIAEGVGPFIGGAF--- 155

Query: 216 IGTEDANQWPWAFY 229
               +   W W FY
Sbjct: 156 ---NEHLSWRWCFY 166

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 101/245 (41%), Gaps = 34/245 (13%)

Query: 26  FKQDNNDI--VDEKQCDTQAIDGNQKWQN-------PEYFDSTLKEYLFLC-SCFVSQLL 75
           F QD+ +I  +DE   DT ++   +  Q+       P Y     KE +FL   C  + L 
Sbjct: 53  FDQDSVEIDKLDEP-IDTTSLYKTKSGQHNEPTLDEPPYSRFGRKEKIFLVIQCAFTGLF 111

Query: 76  NQAGAIQTQPIMNIVADSL---DSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTL 132
           +        P+++++       + Q      +   F  +S + +   G + D  G +  +
Sbjct: 112 SSIAGSIYYPVLSVMEKEFYITEEQVNVSVVVYFIFQALSPTLM---GGLADSLGRRPVV 168

Query: 133 LVGYLFLIVWSLIC-GLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRK 191
           L     ++++   C GL +  +  S  I  R  Q  GIS ++    GI+G +     +  
Sbjct: 169 LSS---IVLYFCACIGLARCTNY-SQLIGLRCLQAAGISPVIAVNSGIMGDVTTKAERG- 223

Query: 192 NMVISLIGCMAPIGAT--LGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIP 247
                  G M  +  T  LG  F  LIG   +++W W   F+   I + I  ++SI ++P
Sbjct: 224 -------GYMGLVSGTQVLGTAFGALIGAGLSSRWSWRSIFWFLVIGSGICLIVSIIVLP 276

Query: 248 NTIPT 252
            T  T
Sbjct: 277 ETKRT 281

>NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 94/236 (39%), Gaps = 17/236 (7%)

Query: 56  FDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSF 115
           F S+ K  L L   F       AGAI   P+++ + +            +  + +  G  
Sbjct: 75  FGSSEKTILVLQCAFTGFFSTIAGAIY-YPVLSEIEEIFHISEESVNITVVVYFIFQGIS 133

Query: 116 ILISGRIGDIYGLKKTLL--VGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLIL 173
             I G + D  G +  +L  +   F     L C  T Y       +V R  Q  GIS ++
Sbjct: 134 PSIMGGLADTMGRRPIVLCSIAVYFCACIGLACCQT-YPQ----IVVLRCLQAAGISPVI 188

Query: 174 PNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSY 231
               GI+G I    ++R   V  + G        +G+ F  LIG   ++ W W   F+  
Sbjct: 189 AINSGIMGDI-TTRAERGGFVGYVSGFQV-----MGSAFGALIGAGISSTWSWRAIFWFL 242

Query: 232 AITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWD 287
           AI + I  ++S  ++P T  T V G+      S L     +M+ ++  +  +D  D
Sbjct: 243 AIGSGICLIISFIILPETKRTIV-GNGSIIPKSKLNRAPSLMVPYLRKKLHLDNPD 297

>KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 96/244 (39%), Gaps = 21/244 (8%)

Query: 27  KQDNNDIVDEKQCDTQAIDGNQKWQ-NPEYFDSTLKEYL--FLCSCFVSQLLNQAGAI-- 81
           K+  +  + E++  T+  D N   Q +P Y   + ++ L  F+   FV  L   +G I  
Sbjct: 70  KEHPSGKLKEEELKTEDADQNLSEQPDPPYTAFSQRQVLVIFIIVIFVGFLGPLSGNIYI 129

Query: 82  QTQPIM-NIVADSLDSQNGKQAWLMAAF---PLISGSFILISGRIGDIYGLKKTLLVGYL 137
              PI+ N+   S  + N   +  MA F   PLI  SF        D  G K   ++  L
Sbjct: 130 PALPILQNVFGLSATAINATVSVFMAVFAVGPLIWASF-------ADFGGRKILYMISLL 182

Query: 138 FLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISL 197
             +V +++  L     +       R  Q    S ++    G V  I     + K +   +
Sbjct: 183 MTVVVNVL--LASVPVNVGALFTLRVVQAFASSSVMALGAGTVSDIRPPKVRGKAIAYFM 240

Query: 198 IGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGH 257
           +G    +G  L  + +GLI     + W W F    I +    ++ + L+P T+   V   
Sbjct: 241 LG--PNMGPILAPIIAGLI-LMHGSYWRWLFGFTCILSGFGLLMVVVLLPETLRCIVGNG 297

Query: 258 KMDW 261
            + W
Sbjct: 298 DIKW 301

>AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR180W (DTR1)
          Length = 619

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 102/272 (37%), Gaps = 24/272 (8%)

Query: 6   KSGTDSVQQETLXXXXXXXX--FKQDNNDIVDEKQCDTQAIDGNQKWQNPEY--FDSTLK 61
           K+GTDS    T             +D +   +E      ++   Q   +P Y  F    +
Sbjct: 99  KAGTDSRGNSTKVEGTPDEDGDSSEDRSGTKNEYNTRDCSLSREQSGFDPPYTAFSRLQR 158

Query: 62  EYLFLCSCFVSQLLNQAGAI--QTQPIMN-IVADSLDSQNGKQAWLMAAF---PLISGSF 115
             +F    F+  L   AG I     PI+    A S  + NG  +  MA F   PL+    
Sbjct: 159 SVIFAVIIFIGFLGPMAGNIYIPALPILEQDFAVSTTTINGTVSVFMAVFSVGPLLWALH 218

Query: 116 ILISGR-IGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILP 174
               GR +  +  +   ++V  L  ++ + I  L           V R  Q    S  L 
Sbjct: 219 ADFGGRKLLYVLSMGLNVIVNVLLAVMPARIGAL----------FVLRVVQAFASSSALS 268

Query: 175 NILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAIT 234
              G V  I    ++ K +   ++G  A  G  L  + +GLI   D ++W W F   +I 
Sbjct: 269 LGAGTVSDITPPKNRGKAIAYFMLGPNA--GPILAPIIAGLI-LFDNDRWRWLFGFTSIM 325

Query: 235 AAINFVLSIWLIPNTIPTNVHGHKMDWIGSGL 266
           A I F+L    +P T+   V    + W  +G 
Sbjct: 326 AGIGFLLVCVFLPETLRCIVGNGDVRWRLAGF 357

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 82/183 (44%), Gaps = 20/183 (10%)

Query: 86  IMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145
           ++  +A  LD+ + + +W+  A+ L   +F  + G++ DI+G K  L++  L   +   I
Sbjct: 64  LLPTIASDLDASS-QMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAI 122

Query: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRK------NMVISLIG 199
           CG + + ++       R   G+G       +  I  S  I   KR       N+  SL G
Sbjct: 123 CG-SPWTNNVWVLSTGRFVAGIGGG-GQATLSTITTSDIIPLRKRGVYQGLVNICFSL-G 179

Query: 200 CMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKM 259
           C +  G+ LGAV    IG      W WAF    +  A+   L I ++ + +P +  G  +
Sbjct: 180 CAS--GSVLGAVLQQGIG------WRWAFL-VQVPMALVCALMIAVVLD-LPADSPGRGL 229

Query: 260 DWI 262
            W+
Sbjct: 230 LWL 232

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 51/127 (40%), Gaps = 7/127 (5%)

Query: 103 WLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSR 162
           WLM  + L +   +L+ GRI  + GLK +L+   +     SL+  L   A S    I  R
Sbjct: 46  WLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAAL---ATSMGMLIGGR 102

Query: 163 AFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDAN 222
              G G S I   +  +     +   K +  V++++G    +    G    G     +  
Sbjct: 103 VIAGFGGSGIETLVFAV--GTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFA--EHV 158

Query: 223 QWPWAFY 229
            W W F+
Sbjct: 159 SWRWCFF 165

>Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 65/155 (41%), Gaps = 7/155 (4%)

Query: 120 GRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGI 179
           G + D  G K   +V    ++  ++I      A+  + F++ R FQ    S ++    G 
Sbjct: 167 GALADFGGRKFLYMVSLSLMLAVNIILAAVP-ANIAALFVL-RVFQAFASSSVISLGAGT 224

Query: 180 VGSIYIAGSKRKNMVISLIGC-MAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAIN 238
           V  +     + K +   ++G  M PI   +  + +GLI  +  N W W F   +I A I 
Sbjct: 225 VTDVVPPKHRGKAIAYFMMGPNMGPI---IAPIVAGLILMK-GNYWRWLFGFTSIMAGIA 280

Query: 239 FVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIM 273
            +L   L+P T+   V      W     GV G ++
Sbjct: 281 LILVTALLPETLRCIVGNGDPKWCERKKGVEGKVL 315

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 71/166 (42%), Gaps = 20/166 (12%)

Query: 70  FVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLK 129
           FV   L          ++  +A  LD+ N + +W+  ++ L   +F  + G++ D++G K
Sbjct: 39  FVGSYLAALDTTIVTTLLPTIASELDASN-QMSWIATSYLLSCSAFQPLYGKLSDVFGRK 97

Query: 130 KTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSK 189
             L+   L      ++CG   +  S     + R   G+G   +  N L  + +  I   +
Sbjct: 98  PLLIWSNLCFGFGCILCG-APFTKSLWMLCIGRFIAGVGGGGL--NSLSTITTSDIIPLR 154

Query: 190 RK-------NMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAF 228
           ++       N+V +L GC +  G+ +GA     IG      W WAF
Sbjct: 155 QRGVYQGMGNIVFAL-GCAS--GSLIGAFLQQRIG------WRWAF 191

>NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {ON}
           Anc_6.155
          Length = 502

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 62/144 (43%), Gaps = 16/144 (11%)

Query: 119 SGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGL--GISLILPNI 176
           +G + + YG K+  L+      ++  +C  T  A++    I+ R   G+  G+S++    
Sbjct: 110 AGSLAERYGRKRVNLINNFCFALFGSLCMFT--ANNVIMLILGRVLVGIAAGVSIV---- 163

Query: 177 LGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE--DANQWPWAFYSYAIT 234
              V S+YI          +L G M  +   LG + +  +  +  D + W W F+  A  
Sbjct: 164 ---VTSLYINDIAPVEWRGAL-GTMNQLSINLGILLTQTVALKYADVHSWRWIFFVGAFV 219

Query: 235 AAINFVLSIWLIPNTIPTNVHGHK 258
           A  NFVL  W      P  + GH+
Sbjct: 220 ALSNFVL--WFKIEESPRWLLGHR 241

>KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease;ureidosuccinate
           permease; expression is constitutive but sensitive to
           nitrogen catabolite repression
          Length = 521

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 85/205 (41%), Gaps = 18/205 (8%)

Query: 57  DSTLKEYLFLCSCFVSQLLNQAGAIQTQ--------PIMNIVADSLDSQNGKQAWLMAAF 108
           + T K  L    C++  +++   A+Q           IM +  D L     + +W+   F
Sbjct: 64  EVTNKRLLRKADCYICTMMSVVYAVQYMDKQTNSYASIMGLRKD-LKMHGNQYSWVGTCF 122

Query: 109 PLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLG 168
            L    F + S      + + K   V  +F+++W  +  +T    + + FI +R   G+ 
Sbjct: 123 YLGYMIFEIPSSLALQRFPIAK---VSAVFIVLWGFVLCMTSLPKNYASFIATRTVLGIL 179

Query: 169 ISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAF 228
            S + P  + +    Y    + + +  S+    A +GA LG++ +  +   D +  P A 
Sbjct: 180 ESAVTPAFMLLTSQWY--RREEQFLRTSIWSASAGLGAILGSLIAYGLAVRDPSSLPIAS 237

Query: 229 YS--YAITAAINFVLSI--WLIPNT 249
           +   Y +   +  VL +  + +P+T
Sbjct: 238 WRLLYVVLGVVTIVLGVAFFFVPDT 262

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 94/214 (43%), Gaps = 22/214 (10%)

Query: 61  KEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISG 120
           K  + + + F+   L+         ++  +A  LD+ + + +W+  ++ L   +F  + G
Sbjct: 39  KTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDASS-QMSWIATSYLLSCSAFQPLYG 97

Query: 121 RIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRA-FQGLGISLILPNILGI 179
           ++ DI+G K  L+   L   V+++ C L     + + +I+S   F        L  +  I
Sbjct: 98  KLSDIFGRKILLVWSNL---VFAIGCALCGSPWTTNIWILSAGRFIAGIGGGGLTTLSTI 154

Query: 180 VGSIYIAGSKR------KNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAI 233
             S  I   KR       N+  SL GC +  G+ LGAV    IG      W WAF     
Sbjct: 155 TTSDIIPLRKRGVYQGLGNICFSL-GCAS--GSVLGAVLQQGIG------WRWAFLIQVP 205

Query: 234 TAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLG 267
            A I+ +L ++++   +P++  G  + W+    G
Sbjct: 206 IALISGLLIVFVLE--LPSDSPGRGLIWLEHARG 237

>Suva_14.4 Chr14 (4495..6051) [1557 bp, 518 aa] {ON} YCR098C (REAL)
          Length = 518

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 67/157 (42%), Gaps = 27/157 (17%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLI--CGLTKYAHSDSFFIVSRAFQGLGISLILPN 175
           I   + D  G K TL++G+   IV+ LI  C   + +     FI+  AF  +  +    +
Sbjct: 324 IGAYLSDRIGRKYTLIIGFSGYIVFGLIIGCAYDQLSKITPLFIIFYAFMNMLGNAGPGD 383

Query: 176 ILGIVGSIYIAGSKR---------KNMVISLIG--CMAPIGATLGAVFSGLIGTEDANQW 224
           +LG++ S   A + R            + S++G  C  PI   LGA              
Sbjct: 384 MLGVISSESSATAVRGVFYGISAVTGKIGSVVGVECFQPIRDNLGA-------------- 429

Query: 225 PWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDW 261
            W F   AI   +  +++++ +P+++  ++    +++
Sbjct: 430 RWTFIIAAICGLVGVLITVFFVPHSLENDLMKEDVEF 466

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 50/109 (45%), Gaps = 3/109 (2%)

Query: 61  KEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISG 120
           K +LF+ S F + L+           +  +A+ L+  + K  W M    +      ++ G
Sbjct: 42  KTWLFVASAFFALLVEATDFFIVSLNVVKIAEDLNVNDEKVTWGMTIALMTRTIGAVLYG 101

Query: 121 RIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGI 169
            IGD +G K + ++    + +  L+ G   +A +  +FI  RA+ G+ +
Sbjct: 102 YIGDQFGQKASFMINIGMISILQLLTG---FATTFPYFIACRAYFGVEL 147

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 76  NQAGAIQTQPIMNIVADSLDSQNGKQA---WLMAAFPLISGSFILISGRIGDIYGLKKTL 132
           N A A     I++   + + SQ  + +   W+  A+ L + +   + G+I DI G +K L
Sbjct: 69  NSALAALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCL 128

Query: 133 LVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLG 168
           L G +   +  L+C    +A++     ++RA  G+G
Sbjct: 129 LFGEVIFALGVLLC---NFANTIPQLAIARAICGIG 161

>TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.451
           YCR023C
          Length = 572

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 5/104 (4%)

Query: 120 GRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGI 179
           GR  D YG K T+++G L   +  LI G +K+ +     +++R+  GL ++  +  I  I
Sbjct: 83  GRFSDEYGRKLTVILGMLGTCISLLILGFSKHFYQA---MIARSMMGL-LNGNIAVIRTI 138

Query: 180 VGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQ 223
           VG +   G + + +  S I  +   G  +G++  G +     N 
Sbjct: 139 VGELTTEG-RHQAIAFSTIPLLFQFGTVIGSIIGGFLVFHKDND 181

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 12/100 (12%)

Query: 113 GSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           G F L  GR+GDIYG +  L+V  +  I+ S+I   +  A     +++ R   G+G  LI
Sbjct: 132 GCFFL--GRLGDIYGRRIGLIVASVIFIIGSVIQIASVKAWYQ--YMIGRIVAGIGCGLI 187

Query: 173 LPNILGIVGSIYIAGSKRKNMVISLIGC---MAPIGATLG 209
                 I+  + I+    KNM  +++ C   M  +G  LG
Sbjct: 188 -----AILSPMLISEVSPKNMRGAMVSCYQLMVTLGIFLG 222

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 63/143 (44%), Gaps = 10/143 (6%)

Query: 30  NNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKE----YLFLCSCFVSQLLNQAGAIQTQP 85
            ND     +  + A++GN+  ++ E  +  L++       L S + +  L+         
Sbjct: 67  ENDSYKSGREHSGALEGNK--EDEEDLEIDLRDPKTFKWVLTSLWTNSALSALDGTIVST 124

Query: 86  IMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145
            +N VA     Q     W+  A+ L + +   + G+I DI G +K LL G    IV+++ 
Sbjct: 125 TVNDVASRFQ-QASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGE---IVFAVG 180

Query: 146 CGLTKYAHSDSFFIVSRAFQGLG 168
            GL  ++ S     ++R   G+G
Sbjct: 181 VGLCIFSKSIPQLAIARGICGIG 203

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSF-- 157
           + +W+  A+ L S +F  + G+I DI+G K  L    +   +  LICG  K     SF  
Sbjct: 131 RISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAK-----SFWV 185

Query: 158 FIVSRAFQGLG 168
            ++ R   G+G
Sbjct: 186 LVIGRFISGVG 196

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 88/230 (38%), Gaps = 28/230 (12%)

Query: 29  DNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMN 88
           +NN  +   +     +   QKW         +   L +C+ F S L    G+    P + 
Sbjct: 42  ENNGTISRNEAPYTLLSYGQKWG--------MVALLTMCT-FWSSL----GSPIYYPALR 88

Query: 89  IVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGL 148
            +    +    K    +  + L  G     SG + DIYG +  +++G +  +  S+  GL
Sbjct: 89  QLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAVSV--GL 146

Query: 149 TKYAHSDSF--FIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206
              A S+S+   +  R  Q   IS  +    G VG   +   +      + +G  +   A
Sbjct: 147 ---ACSNSYGVLVFLRILQSACISPTIAISSGFVGDFTLKFERG-----TFVGATSGF-A 197

Query: 207 TLGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNV 254
            LG  F  LIG   A  W W   F+   I   +  ++   L+P T  T V
Sbjct: 198 LLGQAFGSLIGAALAAAWDWRAIFWFLVIGCGVCMLIIFTLLPETKRTLV 247

>TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 15/111 (13%)

Query: 120 GRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGI 179
           GRIGD+YG +  ++V  +  IV ++I  ++  A     +++ R   GLG  LI      I
Sbjct: 67  GRIGDMYGRRFGIIVASIIFIVGTVIQIVSVKAWYQ--YMIGRIVAGLGCGLI-----AI 119

Query: 180 VGSIYIAGSKRKNMVISLIGC---MAPIGATLGAVFSGLIGT---EDANQW 224
           +  + I+    K+M  +++ C   M  +G  LG  +    GT   +D+ QW
Sbjct: 120 LSPMLISEVSPKHMRGAMVSCYQLMITLGILLG--YGSNYGTKRYDDSRQW 168

>NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570
          Length = 530

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 65/167 (38%), Gaps = 15/167 (8%)

Query: 98  NGKQAWLMAAF---PLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHS 154
           N   +  MA F   PL  G F  + GR        K L +  + L+V   I   +  AH 
Sbjct: 107 NATVSVFMAVFAVGPLFWGLFADVGGR--------KVLYICSILLMVIVNILLASIPAHI 158

Query: 155 DSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSG 214
            S F++ R  Q  G S ++    G V  I     + + +   +IG    +G  L  + +G
Sbjct: 159 SSLFVL-RIVQAFGSSSVITLGAGTVTDITPPKQRGRAIGYFMIG--PNMGPVLAPIIAG 215

Query: 215 LIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDW 261
           LI     N W W F    I   +  +L +  +P T+   V      W
Sbjct: 216 LI-LMKGNYWRWLFGLTGIMGGVGLLLIVAFLPETLRCIVGNADPGW 261

>KNAG0D05230 Chr4 complement(952025..953386) [1362 bp, 453 aa] {ON}
           Anc_7.511 YJR124C
          Length = 453

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 61/128 (47%), Gaps = 21/128 (16%)

Query: 123 GDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGS 182
            D++G +K L+ G + + +  L+     +A S+SF ++   F   G+     + +G   S
Sbjct: 73  ADVWGRRKVLMYGAVMMFLSGLV-----FATSESFNML-LVFAIFGVISPSSDEVGPFKS 126

Query: 183 I------YIAGSKRKNMVISLIGCMAPIGATLGAVFSG--------LIGTE-DANQWPWA 227
           I      +++ + ++  + ++ G +A +GA LGA+ SG          G E D   + WA
Sbjct: 127 IEESMIAHLSPNNKRPEIYAIHGFVATLGAALGAIISGAFIHTLKYTFGVESDLKCYKWA 186

Query: 228 FYSYAITA 235
           F  YA  A
Sbjct: 187 FVLYAAFA 194

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 69/168 (41%), Gaps = 28/168 (16%)

Query: 120 GRIGDIYGLKKTLL--VGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNIL 177
           G + D +G +  +L  V         + C  T YA      +V R  Q  GIS ++    
Sbjct: 77  GGLADSFGRRPVVLWSVALYMAACIGIACSKT-YAQ----ILVLRCLQSAGISPVIAVNS 131

Query: 178 GIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPW--AFYSYAITA 235
           GI+G +     +++   + L      IG+  G     LIG    + W W   F+  AI +
Sbjct: 132 GIMGDV--TTREQRGGYVGLTAGFQVIGSAFG----ALIGGGIVSTWSWRAVFWFLAIAS 185

Query: 236 AINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPI 283
             + V++  ++P T        K   +G+     G I  N +W+ AP+
Sbjct: 186 GFSLVVTFIMLPET--------KRSIVGN-----GSIQPNTIWHIAPV 220

>CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180w DTR1
          Length = 542

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 40/100 (40%), Gaps = 3/100 (3%)

Query: 162 RAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDA 221
           R  Q    S ++    G V  +     + K M   ++G    +G  L  + +GLI   D 
Sbjct: 176 RIIQAFASSSVISLGAGTVADLTPPKDRGKAMAYFMLG--PNLGPILAPIIAGLI-LLDN 232

Query: 222 NQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDW 261
           N W W F    I + +  ++ I L+P T+   V      W
Sbjct: 233 NNWRWLFGFLCIVSGLGLIMVILLLPETLRCIVGNGDRQW 272

>Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON}
           (117855..119801) [1947 nt, 649 aa]
          Length = 648

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 58/146 (39%), Gaps = 6/146 (4%)

Query: 117 LISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNI 176
           LI G   DI G K   L   L + + +++           +F+  R FQ    S ++   
Sbjct: 225 LIWGHFADICGRKWLYLCSLLLMTIVNILLASLPAKIGLLYFL--RIFQAFSSSSVMSMG 282

Query: 177 LGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAA 236
            G V  I     + K +   ++G    +G  +  + +G+I   D   W W F   +I + 
Sbjct: 283 AGTVTDITAPKHRGKAIAYFMMG--PNMGPIVAPIIAGVILIND--NWRWLFGFTSIMSG 338

Query: 237 INFVLSIWLIPNTIPTNVHGHKMDWI 262
           + F L +  +P T+   V      WI
Sbjct: 339 VAFFLVLVFLPETLRCMVGNGDKRWI 364

>TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON} 
          Length = 493

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 53/115 (46%), Gaps = 10/115 (8%)

Query: 28  QDNNDIVDE-----KQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQ 82
           +D +DI+D+      + DT  I   +K   PE     L+ +L + + F+  + +      
Sbjct: 43  EDKHDIIDKVSTIKDKTDTLFICKEEKNSFPE---GGLRGWLAVFASFIGMVASYGTMYA 99

Query: 83  TQPIMNIVADSL--DSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVG 135
              I N + ++   D+ + +  W+ + +  I     ++ G + D +G KK +L+G
Sbjct: 100 PGVIENYIKENQLNDTSSFEIGWIFSLYIFICFITFILGGTLFDNFGFKKPILIG 154

>KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 563

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 21/127 (16%)

Query: 159 IVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGT 218
           +V R  Q  GIS ++    GI+G +     +        +G  A     LG+ F  LIG 
Sbjct: 137 LVLRCLQSAGISPVIAVNSGIMGDVTTRAQRG-----GYVGLTAGF-QVLGSAFGALIGG 190

Query: 219 EDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNF 276
              + W W   F+  AI +  + V S  L+P T        K   +G+     G I    
Sbjct: 191 GIVSTWGWRAIFWFLAIGSGCSLVCSSLLLPET--------KRSVVGN-----GSITPPA 237

Query: 277 VWNQAPI 283
           +W++API
Sbjct: 238 IWSKAPI 244

>KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {ON}
           weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 611

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 17/138 (12%)

Query: 117 LISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNI 176
           +I+     I+G +   LVG +     S+ C +++   S    + SR   GLG+S I    
Sbjct: 136 IIASPCAVIFGKRIVYLVGIIIFFFGSIGCAVSQNYES---LLASRIVSGLGVSTIESLP 192

Query: 177 LGIVGSIYIAGSKRKNM---VISLIGC--MAPIGATLGAVFSGLIGTEDANQWPWAFYSY 231
              V  IY A  +   +    + L+G   + P+ A+   VF  L    D +   W F+  
Sbjct: 193 SATVAEIYFAHERAYRLGFYTLLLLGGKNLVPLLASF--VFEYL----DRH---WLFWIV 243

Query: 232 AITAAINFVLSIWLIPNT 249
            I   +NF+L +  +P T
Sbjct: 244 TIIVGVNFMLHVLFVPET 261

>KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease ureidosuccinate permease
           expression is constitutive but sensitive to nitrogen
           catabolite repression
          Length = 551

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 8/118 (6%)

Query: 138 FLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISL 197
           ++I W L+  LT    S   FI++R   G+  S I P ++  +   Y    +     I L
Sbjct: 177 YIIAWGLLLCLTSLVKSYPTFILTRTLLGVLESSITPAMVLFMSQWYKKDEQFFRTSI-L 235

Query: 198 IGCMAPIGATLGAVFS------GLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNT 249
           I C A +G  +GA  S       L GT   + W   F    +   +  ++ +++IP+T
Sbjct: 236 IACNA-VGGLVGASVSYRLYERQLAGTLSMDAWRILFIIVGLITIVTGLMVLFIIPDT 292

>ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 5/106 (4%)

Query: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGC-MAPIGATLGAVFSGLIGT 218
           V R FQ  G S  +    G V  I     + K +   ++G  M PI   L  + SGLI  
Sbjct: 194 VLRVFQAFGSSSAISLGTGTVTDITPPKHRGKAIGYFMMGPNMGPI---LAPIISGLILM 250

Query: 219 EDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGS 264
           E ++ W W F   +I + I F+  + ++P T+   V      W  S
Sbjct: 251 E-SDAWRWLFGFTSIMSGIAFIAVVLILPETLRCIVGNGDQRWKKS 295

>CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highly
           similar to uniprot|P10870 Saccharomyces cerevisiae
           YDL194w SNF3 or uniprot|Q12300 Saccharomyces cerevisiae
           YDL138w RGT2
          Length = 856

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 122 IGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI 172
           I D YG KKT++  +   +V+SL   L   AH+    I  R   GLG+ L+
Sbjct: 186 ISDKYGRKKTIM--FSTAVVFSLGNSLQVGAHNIQLLIAGRVISGLGVGLV 234

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 21/127 (16%)

Query: 159 IVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGT 218
           I+ R  Q  GIS ++    GI+G +       +   +  +     +G+ LGA    LIG 
Sbjct: 168 IILRCLQAAGISPVIAINSGIMGDVTTKA--ERGGYVGYVAGFQILGSALGA----LIGA 221

Query: 219 EDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNF 276
             +++W W   F+  AI +    ++S +++P T        K   +G+     G I    
Sbjct: 222 ALSSRWDWRAIFWFLAIGSGACALVSFFVLPET--------KRTVVGN-----GSIRPKP 268

Query: 277 VWNQAPI 283
           V+N+API
Sbjct: 269 VFNRAPI 275

>SAKL0D02508g Chr4 (197981..199720) [1740 bp, 579 aa] {ON} similar
           to gnl|GLV|KLLA0D12606g Kluyveromyces lactis
           KLLA0D12606g and weakly similar to YNR055C
           uniprot|P53389 Saccharomyces cerevisiae YNR055C HOL1
           Putative ion transporter similar to the major
           facilitator superfamily of transporters; mutations in
           membrane- spanning domains permit nonselective cation
           uptake
          Length = 579

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 54/117 (46%), Gaps = 9/117 (7%)

Query: 136 YLF-LIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLI--LPNILGIVGSIYIAGSKRKN 192
           YLF ++  ++IC    Y  ++  +I S+  QGL  + I  LP I   +  ++      ++
Sbjct: 119 YLFSMLATTMICVWPPYTKTNGEWIASKILQGLFGATIESLPEI--SMSDLFF--EHERS 174

Query: 193 MVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNT 249
           + +SL G      + L  V +G I       W W  +  +I  A+ FVL  +L+  T
Sbjct: 175 LGLSLYGLTLLAASYLAPVLAGFI--SQGQGWEWVMWWCSIFGAVCFVLLFFLMEET 229

>TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa]
           {ON} 
          Length = 566

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 96/227 (42%), Gaps = 28/227 (12%)

Query: 28  QDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIM 87
           +D   I+ E +C          +    Y  ST K++  L   F++QL     A      +
Sbjct: 35  EDPRRILREYEC----------YDKLGYSFSTRKKWTILTIIFITQLSMNFNASAYPHAI 84

Query: 88  NIVAD----SLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWS 143
            ++A     S  + N  Q   + ++    G    +     + YG  + + +  LF  +W 
Sbjct: 85  PLIAKEFGVSTQAANTSQMIFLVSY----GFGCELWAPWSEEYGRWRVMQLSLLFSNIWQ 140

Query: 144 LICGLTKYAHSDSFFIVSRAFQGLGISLILPNI-LGIVGSIYIAGSKRKNMVISLIGCMA 202
           ++ GL   A +    IV+R F G G+SL   ++ LG+V  ++          ++ I   +
Sbjct: 141 ILGGL---APNFGTIIVAR-FLG-GMSLAGGSVTLGVVADMF--DPIDHGYAVAFIVLSS 193

Query: 203 PIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNT 249
             G+ +G +F GL+  ++   W W F+   I   +  +L  +++P T
Sbjct: 194 VCGSVIGPIFGGLM--QEHLSWHWNFWIQLIFNGVAQILHFFIVPET 238

>TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.242
           YNL065W
          Length = 602

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 15/137 (10%)

Query: 117 LISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSF--FIVSRAFQGLGISLILP 174
           +I G + D  G ++ L++  L +      C     A  +++   I  R  Q  GI+ ++ 
Sbjct: 177 IIVGNLADTNG-RRPLILSCLLI----YFCACVGLASCNTYAQLIGLRCLQAAGIAPVIA 231

Query: 175 NILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWA--FYSYA 232
              GI G I    ++R+    S IG ++     +G+ F  LIG   ++ W W   F+  A
Sbjct: 232 INSGIAGDI---TTRRERG--SYIGYVSGF-VVIGSAFGALIGAGLSSTWDWRAIFWFLA 285

Query: 233 ITAAINFVLSIWLIPNT 249
           I + +  + SI L P T
Sbjct: 286 IGSGVCVIYSIILFPET 302

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 83/227 (36%), Gaps = 32/227 (14%)

Query: 28  QDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIM 87
           +DN DI D  + +  A+    +  N    ++TL       + F+S       A   Q I 
Sbjct: 30  EDNADIEDVDKDEDMAL---SRIPNLWIIEATL-----FSNVFLSGFDGTVTASTYQTIG 81

Query: 88  NIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICG 147
           N       +Q     W+  A+ + S SF  + G   D  G +  L        +  L C 
Sbjct: 82  NEF-----NQMSISNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAAFTIGCLACS 136

Query: 148 LTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKR------KNMVISLIGCM 201
           L+   ++ S                L  +  IV S  I  SKR      +N+   L+G  
Sbjct: 137 LSTNIYTLSLM----RALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNL---LLGFG 189

Query: 202 APIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPN 248
           A  GA+ G   +  IG      W W F      + I+ VL  + +PN
Sbjct: 190 AICGASFGGTIASTIG------WRWCFLIQVPISIISSVLMNYYVPN 230

>Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]
           {ON} YBR180W (DTR1) - dityrosine transporter MFS-MDR
           [contig 22] FULL
          Length = 567

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 75/195 (38%), Gaps = 18/195 (9%)

Query: 81  IQTQPIM-NIVADSLDSQNGKQAWLMAAF---PLISGSFILISGRIGDIYGLKKTLLVGY 136
           I   PI+  I   S  + N   +  MA F   PLI  SF        D  G K   ++  
Sbjct: 131 IPALPILQRIFGVSSTTINATVSVFMAVFAVGPLIWASF-------ADFGGRKILYMISL 183

Query: 137 LFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVIS 196
           L  ++ +++           FF+  R  Q    S ++    G V  I     + K +   
Sbjct: 184 LLTVIVNVLLAAVPVNTGALFFL--RVMQAFASSSVMALGAGTVSDIRPPQVRGKAIAYF 241

Query: 197 LIGC-MAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVH 255
           ++G  M PI   L  + +GLI     + W W F   +I + I  +  I  +P T+   V 
Sbjct: 242 MLGPNMGPI---LAPIIAGLI-LMRGSYWRWLFGFTSILSGIGLIAVIVFLPETLRCIVG 297

Query: 256 GHKMDWIGSGLGVVG 270
                WI +   VVG
Sbjct: 298 NGDPKWIDTEDEVVG 312

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 89/209 (42%), Gaps = 32/209 (15%)

Query: 28  QDNNDIVDEKQC---DTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQ 84
           +D +   DE      D Q + G + + N      +L   LFL +     +L  + +I+  
Sbjct: 16  EDRSSAQDESSGHVGDPQPLSGFKLYANM----GSLTLVLFLAAL---DILIMSASIE-- 66

Query: 85  PIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSL 144
               ++++  +  + K  W+++ + L      L+ GR   I+G K +LL+  L     SL
Sbjct: 67  ----VISEQFNDYS-KSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSL 121

Query: 145 ICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPI 204
           I  ++   +S +  I  R   G+G S I    L  V +  +   + + + IS++ C   +
Sbjct: 122 ISAVS---NSMNVLIGGRVVAGIGGSGI--QSLCFVIASTLTTERSRGVAISVLSCAYAV 176

Query: 205 GAT----LGAVFSGLIGTEDANQWPWAFY 229
            A     +G+ F+  +       W W FY
Sbjct: 177 AAVASPFMGSAFTTHV------TWRWCFY 199

>Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011W
           (REAL)
          Length = 541

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 22/136 (16%)

Query: 117 LISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSF--FIVSRAFQGL---GISL 171
           L  GR+GDIYG K  L+   L  IV  +I    + A +D +  + + R   G+   GI++
Sbjct: 122 LTLGRLGDIYGRKIGLMCVILVYIVGIVI----QIASTDKWYQYFIGRIISGMGVGGIAV 177

Query: 172 ILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTED-ANQWPWAFYS 230
           + P ++      +I G+      +S    M  +G  LG  +    GT+D +N   W    
Sbjct: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLG--YCTNYGTKDYSNSIQW---- 226

Query: 231 YAITAAINFVLSIWLI 246
             +   +NF  +I++I
Sbjct: 227 -RVPLGMNFAFAIFMI 241

>NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa]
           {ON} 
          Length = 587

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 67/172 (38%), Gaps = 15/172 (8%)

Query: 85  PIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLL--VGYLFLIVW 142
           P++ ++    D         +  + +  G    I G + D  G +  +L  V   F    
Sbjct: 116 PVLTVIEKLFDISEESVNITVVVYFIFQGLSPSIMGGLADSLGRRPVVLFSVAVYFCACV 175

Query: 143 SLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMA 202
            L C  T Y       IV R  Q  GIS ++    GI+G +    ++R   V  + G   
Sbjct: 176 GLACAQT-YPQ----IIVLRCLQAAGISPVIAINSGIMGDV-TTRAERGGYVGYVSGFQV 229

Query: 203 PIGATLGAVFSGLIGTEDANQWPWA--FYSYAITAAINFVLSIWLIPNTIPT 252
                LG  F  LIG   ++ W W   F+  AI + I  + S  ++P T  T
Sbjct: 230 -----LGNSFGALIGAGISSTWSWRAIFWFLAIGSGICLLASFIVLPETKRT 276

>KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} similar
           to uniprot|P53142 Saccharomyces cerevisiae YGL104C VPS73
           Mitochondrial protein involved in vacuolar protein
           sorting
          Length = 503

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 11/127 (8%)

Query: 117 LISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNI 176
           L +GR+ D YG KK      +  I+ SL   L   A+S +  I  R   G+     +   
Sbjct: 98  LYAGRVADRYGRKKYSFTNCVIGIIGSL---LLFRANSYAQLIAGRFIAGISCGSCI--- 151

Query: 177 LGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE--DANQWPWAFYSYAIT 234
             +V  ++I     K +  SL G M  +   +G + + L+  +  D+ +W W   + AI 
Sbjct: 152 --VVTPLFINEISPKELRGSL-GSMNQVCINVGILLTQLLALKYADSYRWRWLMLAGAIL 208

Query: 235 AAINFVL 241
           A I F+L
Sbjct: 209 ALIQFLL 215

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 57/146 (39%), Gaps = 7/146 (4%)

Query: 103 WLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSR 162
           W+  A+ + S SF  + G   D  G +  L        +  L CG +K  +  SF    R
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFM---R 62

Query: 163 AFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDAN 222
           A         L  +  IV S  I  SKR  +  +    +   GA  GA F G I +    
Sbjct: 63  A-LTGIGGGGLITLSTIVNSDVIPSSKR-GIFQAFQNLLLGFGAICGASFGGTIASSIG- 119

Query: 223 QWPWAFYSYAITAAINFVLSIWLIPN 248
            W W F      + I+ +L  + +PN
Sbjct: 120 -WRWCFLIQVPISVISSILMNYYVPN 144

>Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR260W
           (TNA1) - 1:1 [contig 261] FULL
          Length = 508

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 47/117 (40%), Gaps = 8/117 (6%)

Query: 142 WSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCM 201
           WS+I     +  S    I  R   G       P ++ +V  IY    + K + +   GC 
Sbjct: 144 WSVITLGNGFIQSYHSLIALRVLLGAFEGGYFPAMILLVSMIYKPEEQAKRIAL-FFGCA 202

Query: 202 APIGATLGAVFSGLI---GTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVH 255
           A  GA  G + +GL    G    N W W    Y I   I+   SIW I   +PT++ 
Sbjct: 203 ALAGAFGGLIATGLATVNGASGLNGWRWL---YIIEGLISITASIW-IYFGLPTDIE 255

>YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}
           GIT1Plasma membrane permease, mediates uptake of
           glycerophosphoinositol and glycerophosphocholine as
           sources of the nutrients inositol and phosphate;
           expression and transport rate are regulated by phosphate
           and inositol availability
          Length = 518

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 65/157 (41%), Gaps = 27/157 (17%)

Query: 118 ISGRIGDIYGLKKTLLVGYLFLIVWSLI--CGLTKYAHSDSFFIVSRAFQGLGISLILPN 175
           I   + D  G K TL+ G+   I++ LI  C   +       FI+  AF  +  +    +
Sbjct: 324 IGAYLSDRIGRKYTLMFGFSGYIIFGLIIGCAYDQLKKITPLFIIFYAFMNMLGNAGPGD 383

Query: 176 ILGIVGSIYIAGSKR---------KNMVISLIG--CMAPIGATLGAVFSGLIGTEDANQW 224
           +LG++ S   A + R            + S++G  C  PI   LGA              
Sbjct: 384 MLGVISSEASATAVRGVFYGLSAVTGKIGSVVGVECFQPIRDNLGA-------------- 429

Query: 225 PWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDW 261
            W F   AI   I  +++ + +P+++ +++    +++
Sbjct: 430 RWTFIIAAICGLIGIIITYFFVPHSLESDLMKQDVEF 466

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 75/182 (41%), Gaps = 23/182 (12%)

Query: 103 WLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSR 162
           W+  A+ + S SF  + G   D  G +  L        +  L CG +   +  SF    R
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFM---R 62

Query: 163 AFQGLGISLILPNILGIVGSIYIAGSKR------KNMVISLIGCMAPIGATLGAVFSGLI 216
           A  G+G   ++  +  IV S  I  SKR      +N+   L+G  A  GA+ G   +  I
Sbjct: 63  ALTGIGGGGLI-TLSTIVNSDVIPTSKRGIFQAFQNL---LLGFGAICGASFGGTIASTI 118

Query: 217 GTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKM----DWIGSGLGVVGLI 272
           G      W W F      + I+ +L  + +PN    N     +      I +G+ V+G I
Sbjct: 119 G------WRWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSI 172

Query: 273 ML 274
           ++
Sbjct: 173 LI 174

>KLTH0E00132g Chr5 (3262..5010) [1749 bp, 582 aa] {ON} weakly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C HOL1 Putative ion transporter similar to the
           major facilitator superfamily of transporters; mutations
           in membrane-spanning domains permit nonselective cation
           uptake
          Length = 582

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 9/117 (7%)

Query: 136 YLF-LIVWSLICGLTKYAHSDSFFIVSRAFQG-LGISL-ILPNILGIVGSIYIAGSKRKN 192
           YLF ++  +LIC    Y  S+  ++ S+  QG +G S+  LP I   +  ++      ++
Sbjct: 123 YLFSMLATALICVWPPYTKSNGEWVASKILQGFVGSSMESLPEI--SMSDLFF--EHERS 178

Query: 193 MVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNT 249
             +SL G      + L    +G I   +   W W  +  AI  A+ FVL  +L+  T
Sbjct: 179 FALSLYGLTLLSASFLAPFVAGFI--SEGQGWEWVMWWCAIFGAVCFVLLFFLMEET 233

>KLTH0A00440g Chr1 (37100..38848) [1749 bp, 582 aa] {ON} weakly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C HOL1 Putative ion transporter similar to the
           major facilitator superfamily of transporters; mutations
           in membrane-spanning domains permit nonselective cation
           uptake
          Length = 582

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 9/117 (7%)

Query: 136 YLF-LIVWSLICGLTKYAHSDSFFIVSRAFQG-LGISL-ILPNILGIVGSIYIAGSKRKN 192
           YLF ++  +LIC    Y  S+  ++ S+  QG +G S+  LP I   +  ++      ++
Sbjct: 123 YLFSMLATALICVWPPYTKSNGEWVASKILQGFVGSSMESLPEI--SMSDLFF--EHERS 178

Query: 193 MVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNT 249
             +SL G      + L    +G I   +   W W  +  AI  A+ FVL  +L+  T
Sbjct: 179 FALSLYGLTLLSASFLAPFVAGFI--SEGQGWEWVMWWCAIFGAVCFVLLFFLMEET 233

>Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W
           (REAL)
          Length = 522

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 8/128 (6%)

Query: 122 IGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVG 181
           + ++YG + T L   +  I+W     LT ++ + +  +  R   G   S  L    G + 
Sbjct: 139 LSELYGRRITFLYALMLSIIWQC---LTIWSGTIAGVMFGRFLSGFFGSAFLSVAGGAIA 195

Query: 182 SIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVL 241
            I+     +  + +++    A +G +LG +  G +  E    + W F +  IT+    VL
Sbjct: 196 DIF--DKDQIGIPMAIYTTSAFLGPSLGPIIGGALYHES---YKWTFITLLITSGCCLVL 250

Query: 242 SIWLIPNT 249
            I+ IP T
Sbjct: 251 IIFTIPET 258

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,554,797
Number of extensions: 1982327
Number of successful extensions: 6286
Number of sequences better than 10.0: 307
Number of HSP's gapped: 6304
Number of HSP's successfully gapped: 314
Length of query: 537
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 423
Effective length of database: 40,409,475
Effective search space: 17093207925
Effective search space used: 17093207925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)