Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B02321g8.842ON51251226470.0
Suva_13.288.842ON53042416800.0
NCAS0B003008.842ON52351516670.0
YML115C (VAN1)8.842ON53543116600.0
Skud_13.268.842ON53941616580.0
NDAI0E002908.842ON52250716520.0
Kpol_541.158.842ON49841316490.0
Smik_13.198.842ON53642116440.0
KNAG0G034208.842ON51142516330.0
KAFR0A028308.842ON50741316200.0
ZYRO0G14234g8.842ON50941816180.0
TDEL0B005608.842ON50942616160.0
TBLA0B032708.842ON52042115620.0
KLLA0D01529g8.842ON50142015560.0
TPHA0C047808.842ON52542015550.0
KLTH0C03828g8.842ON40440115420.0
SAKL0D01430g8.842ON44742315430.0
Ecym_46138.842ON52441914910.0
ABL124W8.842ON48542514440.0
Kwal_27.102468.842ON33933313620.0
Ecym_35731.479ON44735110131e-133
NCAS0G041101.479ON49435110041e-131
KLTH0C03432g1.479ON48935210031e-131
NDAI0B012501.479ON4463569981e-130
YEL036C (ANP1)1.479ON50035210001e-130
SAKL0D11792g1.479ON4833659951e-130
Smik_5.571.479ON4913519951e-129
AFR357W1.479ON4343549871e-129
KAFR0I027701.479ON4553539851e-128
NDAI0G003401.479ON5043519891e-128
Skud_5.541.479ON4913519881e-128
Suva_5.331.479ON4953519881e-128
CAGL0L01331g1.479ON4473539811e-128
Kwal_27.101571.479ON4763519841e-128
Kpol_370.51.479ON6453519881e-126
TBLA0B021701.479ON5723519811e-126
KNAG0I003001.479ON4573559701e-126
TPHA0O004301.479ON5483889761e-126
KLLA0E22155g1.479ON4503539521e-124
TDEL0C026001.479ON4623549491e-123
ZYRO0F05170g1.479ON6083559511e-121
TPHA0L013708.500ON3923445003e-57
KLLA0E12849g8.500ON3923604942e-56
NCAS0C023308.500ON3933514854e-55
Kpol_1031.788.500ON3923574845e-55
Smik_16.1868.500ON3953574803e-54
KNAG0A021508.500ON3963604793e-54
KLTH0E11616g8.500ON3943474785e-54
Skud_16.2328.500ON3953574751e-53
NDAI0E030208.500ON3963794751e-53
SAKL0H11110g8.500ON3933574707e-53
KAFR0H013908.500ON3983604707e-53
YPL050C (MNN9)8.500ON3953574672e-52
CAGL0L12804g8.500ON3933554662e-52
TDEL0B013708.500ON3963604654e-52
TBLA0H033408.500ON3933504654e-52
Suva_16.2658.500ON3953574566e-51
Kwal_27.118648.500ON4533444598e-51
ZYRO0F08492g8.500ON3963624551e-50
AGL259C8.500ON3893464382e-48
Ecym_25508.500ON3903464357e-48
NCAS0B024408.500ON4003574313e-47
NDAI0C052508.500ON4023464313e-47
KNAG0A039908.500ON3573522686e-25
SAKL0H20438gsingletonON5652031421e-08
KAFR0J026006.373ON2120139770.88
SAKL0G18810gna 1ON57161741.9
ZYRO0G12540g3.295ON95063723.3
Agos_YGOB_Anc_6.3476.347ON469131714.1
Skud_4.809na 1ON56851714.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B02321g
         (512 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...  1024   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   651   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   646   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   644   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   643   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   640   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   639   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   637   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   633   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   628   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   627   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   627   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   606   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   603   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   603   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   598   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   598   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   578   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   560   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   529   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   394   e-133
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    391   e-131
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   390   e-131
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   389   e-130
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   389   e-130
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   387   e-130
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   387   e-129
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   384   e-129
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   384   e-128
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   385   e-128
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   385   e-128
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   385   e-128
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   382   e-128
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   383   e-128
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   385   e-126
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   382   e-126
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   378   e-126
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   380   e-126
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   371   e-124
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   370   e-123
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   370   e-121
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   197   3e-57
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   194   2e-56
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   191   4e-55
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   191   5e-55
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   189   3e-54
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   189   3e-54
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   188   5e-54
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   187   1e-53
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   187   1e-53
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   185   7e-53
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   185   7e-53
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   184   2e-52
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   184   2e-52
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   183   4e-52
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   183   4e-52
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   180   6e-51
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   181   8e-51
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   179   1e-50
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   173   2e-48
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   172   7e-48
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   170   3e-47
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   170   3e-47
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...   107   6e-25
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    59   1e-08
KAFR0J02600 Chr10 complement(492375..498737) [6363 bp, 2120 aa] ...    34   0.88 
SAKL0G18810g Chr7 complement(1624866..1626581) [1716 bp, 571 aa]...    33   1.9  
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    32   3.3  
Agos_YGOB_Anc_6.347 Chr5 complement(1133115..1134524) [1410 bp, ...    32   4.1  
Skud_4.809 Chr4 (1427842..1429548) [1707 bp, 568 aa] {ON} YDR536...    32   4.5  

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/512 (96%), Positives = 496/512 (96%)

Query: 1   MMMSIPSFRDLAKLRRSADNKRGGEYSLPISRTGSEATLSKHDKFIAKKKNFKFRKLATG 60
           MMMSIPSFRDLAKLRRSADNKRGGEYSLPISRTGSEATLSKHDKFIAKKKNFKFRKLATG
Sbjct: 1   MMMSIPSFRDLAKLRRSADNKRGGEYSLPISRTGSEATLSKHDKFIAKKKNFKFRKLATG 60

Query: 61  AXXXXXXXXXXXXXXXXEVSPISLPSSFYHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFD 120
           A                EVSPISLPSSFYHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFD
Sbjct: 61  AIIVIVIVSIFLVFFNIEVSPISLPSSFYHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFD 120

Query: 121 QGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVC 180
           QGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVC
Sbjct: 121 QGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVC 180

Query: 181 VPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPD 240
           VPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPD
Sbjct: 181 VPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPD 240

Query: 241 ILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVI 300
           ILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVI
Sbjct: 241 ILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVI 300

Query: 301 GQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQ 360
           GQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQ
Sbjct: 301 GQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQ 360

Query: 361 DYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVH 420
           DYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVH
Sbjct: 361 DYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVH 420

Query: 421 LAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVG 480
           LAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVG
Sbjct: 421 LAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVG 480

Query: 481 FRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK 512
           FRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK
Sbjct: 481 FRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK 512

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/424 (71%), Positives = 359/424 (84%), Gaps = 2/424 (0%)

Query: 91  KEYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQM 150
           + Y   + +D  Y+++DFEDID ++VSKFD G+ +YLI+++G+E  +  D  +Y + + M
Sbjct: 103 ENYKTIDLEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSM 162

Query: 151 LLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLA 210
           LLDSTVEKYDL NF+G+ +G E ++HIL+C+PLR+A +VLPLMFK+LMNLTYPHELIDLA
Sbjct: 163 LLDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLA 222

Query: 211 FLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNY--NKGKSNESIHLKYMEPDYLK 268
           FLVSDCSEGD TL+AL  YS+ LQ G L +I  ++D    ++ K  + ++LKYM+ DY+ 
Sbjct: 223 FLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYIN 282

Query: 269 RVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLM 328
           RV  A+ PPFH NY KPFRSVQ+FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 
Sbjct: 283 RVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 342

Query: 329 SNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSW 388
           +NALKPYHSWVYWRDADVELCPGSVI+DLM ++YDVIVPNVWRPLP FLNS QPYDLNSW
Sbjct: 343 ANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSW 402

Query: 389 MESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILAR 448
           MES EAL LAKTLDEDDVIVEGYAEYPT+RVHLAYIR+  GDP +VVDLDGVGGVSILA+
Sbjct: 403 MESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAK 462

Query: 449 ARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKL 508
           A++FR GV F AFTFENHAETEAFGKMAKK+G+RVGGLPHYT+WHIYEPSDDDL  +A  
Sbjct: 463 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATR 522

Query: 509 EKGK 512
           E+ K
Sbjct: 523 EREK 526

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/515 (61%), Positives = 379/515 (73%), Gaps = 15/515 (2%)

Query: 11  LAKLRRSADNKRGGEYSLPISRTGSE--ATLSKHDKFIAKKKNF--------KFRKLATG 60
           L K+++   NK   E  LP SR  S       K + F+ K++           F  L   
Sbjct: 4   LIKVKKGVQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLIII 63

Query: 61  AXXXXXXXXXXXXXXXXEVSPISLPSSFYHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFD 120
                             V+ +    +     Y   +  +  Y+  DFEDI+  +V KFD
Sbjct: 64  VYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFD 123

Query: 121 QGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVC 180
            G+ +YLIS+YGT+  + SD   Y   LQM+LD++VEKYDL  F GS++G   ++H+L+C
Sbjct: 124 NGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLC 183

Query: 181 VPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPD 240
           VPLRDAE VLPLMFK+LMNLTYPHELIDLAFLVSDCSEGD+TL+AL  YS+ LQ G L  
Sbjct: 184 VPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQ 243

Query: 241 ILADMDNY-----NKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKD 295
           +  +MD Y      K K  +++HLKYM PDYLK V  ++K   H NY KPFRS+Q+FQKD
Sbjct: 244 VFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKD 303

Query: 296 FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIE 355
           FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLM+NALKPYH+WVYWRDAD+ELCPGSVIE
Sbjct: 304 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIE 363

Query: 356 DLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYP 415
           DLM +DYDVIVPNVWRPLP+FL+  QPYDLNSW+ES+EAL+LAKTLDEDDVIVEGYAEYP
Sbjct: 364 DLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYP 423

Query: 416 TYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKM 475
           T+RVHLAYIR+  GDP +VVDLDGVGGVSILA+A++FR GV F AFTFENHAETEAFGKM
Sbjct: 424 TWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKM 483

Query: 476 AKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510
           A+K+GFRVGGLPHYT+WHIYEPSDDDL+ +A  E+
Sbjct: 484 ARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKER 518

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/431 (69%), Positives = 356/431 (82%), Gaps = 2/431 (0%)

Query: 84  LPSSFYHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAE 143
           L SS   + Y   + +D  Y+ +DFEDID +++SKFD G+ +YLIS++G+E  +  D  +
Sbjct: 100 LGSSKSSENYKTIDLEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEK 159

Query: 144 YNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYP 203
           Y   L ML DSTVE+YDL NF+G+ +G E ++HIL+C+PLR+A +VLPLMFK+LMNLTYP
Sbjct: 160 YQRELNMLFDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYP 219

Query: 204 HELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNY--NKGKSNESIHLKY 261
           HELIDLAFLVSDCSEGD TL+AL  YS+ LQ G L  I  ++D    ++ K  + ++LKY
Sbjct: 220 HELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKY 279

Query: 262 MEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMG 321
           M+  Y+ RV  A+ PPFH NY KPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMG
Sbjct: 280 MDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMG 339

Query: 322 RARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQ 381
           RARNWL +NALKPYHSWVYWRDADVELCPGSVI+DLM ++YDVIVPNVWRPLP FL + Q
Sbjct: 340 RARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQ 399

Query: 382 PYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVG 441
           PYDLNSWMES EAL LAKTLDEDDVIVEGYAEYPT+RVHLAYIR+ +GDP + VDLDGVG
Sbjct: 400 PYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVG 459

Query: 442 GVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDD 501
           GVSILA+A++FR GV F AFTFENHAETEAFGKMAKK+G+RVGGLPHYT+WHIYEPSDDD
Sbjct: 460 GVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDD 519

Query: 502 LLAMAKLEKGK 512
           L  +A  E+ K
Sbjct: 520 LKEIASREREK 530

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/416 (72%), Positives = 352/416 (84%), Gaps = 2/416 (0%)

Query: 93  YLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLL 152
           Y   + +D  Y+++DFEDID +++SKFD G  +YLIS++G+E     +  EY   L MLL
Sbjct: 109 YKTIDLEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLL 168

Query: 153 DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFL 212
           DSTVEKYDL +F+G+ +G E ++HIL+C+PLR+A +VLPLMFK+LMNLTYPHELIDLAFL
Sbjct: 169 DSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228

Query: 213 VSDCSEGDKTLEALETYSQLLQEGILPDILADMDNY--NKGKSNESIHLKYMEPDYLKRV 270
           VSDCSEGD TL+AL  YS+ LQ G L  I  D+D    ++ K  + ++LKYM+ DY+ RV
Sbjct: 229 VSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRV 288

Query: 271 KAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSN 330
             A+ PPFH NY KPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL +N
Sbjct: 289 HQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348

Query: 331 ALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWME 390
           ALKPYHSWVYWRDADVELCPGSVIEDLM ++YDV+VPNVWRPLP FLNS Q YDLNSWME
Sbjct: 349 ALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWME 408

Query: 391 SNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARAR 450
           S EAL+LAKTLDEDDVIVEGYAEYPT+RVHLAYIR+ +G+P +VVDLDGVGGVSILA+A+
Sbjct: 409 SREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAK 468

Query: 451 VFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
           +FR GV F AFTFENHAETEAFGKMAKK+G+RVGGLPHYT+WHIYEPSDDDL  +A
Sbjct: 469 IFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/507 (61%), Positives = 385/507 (75%), Gaps = 16/507 (3%)

Query: 19  DNKRGGEYSLPISRTGSE-ATLSKHDKFIAKKKNFKFRKLATGAXXXXXXXXXXXX---- 73
           ++++  +  LPISR  S  A   K  +FI KKK+   + +A G+                
Sbjct: 11  NSRKDAKLELPISRNNSNVADELKKQRFIPKKKSTA-KNVAIGSVVSFIICALIYCGYSY 69

Query: 74  --XXXXEVSPISLPSSFYHK---EYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLI 128
                  +  I+L ++  +K    Y   E  D  Y+++DFE+I+ D++ KF+ G+ +YLI
Sbjct: 70  FFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLI 129

Query: 129 SEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEE 188
           SE+GT+  +  D  +Y   L MLLD++VEKYDL  F GS +G E ++H+L+CVPLRDAE 
Sbjct: 130 SEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAES 189

Query: 189 VLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNY 248
           VLPLMFK+LMN+TYPHELIDLAFLVSDCS+GD TLEAL  YS+ LQ G L  +  DMD Y
Sbjct: 190 VLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEY 249

Query: 249 NKGKSNES-----IHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQG 303
               S+++     +HLKYM  +YLK V+ A+  P H NY KPFRSVQIF+KDFGQVIGQG
Sbjct: 250 QYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQG 309

Query: 304 FSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYD 363
           FSDRHAVKVQGIRRKLMGRARNWLM+NALKPYHSWVYWRDAD+ELCPG+++ED+M  DYD
Sbjct: 310 FSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYD 369

Query: 364 VIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAY 423
           V+VPNVWRPLP+FL+S QPYDLNSW+ES+EAL+LAKTL EDDVIVEGYAEYPT+RVHLAY
Sbjct: 370 VLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAY 429

Query: 424 IREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRV 483
           IRE  GDPT VVDLDGVGGVSILA+A++FR GVHF AFTFENHAETE FGKMAK++G+RV
Sbjct: 430 IREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRV 489

Query: 484 GGLPHYTLWHIYEPSDDDLLAMAKLEK 510
           GGLPHYT+WHIYEPSDDDL  +A  E+
Sbjct: 490 GGLPHYTIWHIYEPSDDDLKEIANKER 516

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/413 (70%), Positives = 351/413 (84%)

Query: 98  FKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVE 157
            +D  Y+ +DF++ D  +V KFD G  +YLIS+YG+E  +  D + Y   LQ LL +TV+
Sbjct: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140

Query: 158 KYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCS 217
            YDL  + G+ +G + +EH+L+CVPLRDAE+VLPLMFKN+MNLTYPHELIDLAFLVSDC+
Sbjct: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200

Query: 218 EGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPP 277
           EGD TLE+L  YS+ LQ+G L  +  +MD  +  K +E ++LKYM  DYLK V+ AY PP
Sbjct: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMDKDDSKKDSEKLYLKYMNKDYLKMVEDAYSPP 260

Query: 278 FHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHS 337
           FH +Y KPFRSVQIFQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWLM+NALKPYH+
Sbjct: 261 FHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHA 320

Query: 338 WVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQL 397
           WVYWRDADVELCPG+VIEDLM +++DV+VPNVWRPLP+FLNS QPYDLNSWMESNEAL+L
Sbjct: 321 WVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKL 380

Query: 398 AKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVH 457
           AK LDEDDVIVEGYAEYPT+RVHLAYIRE++G+P QVVDLDGVGGVSIL +A++FR G+H
Sbjct: 381 AKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIH 440

Query: 458 FSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510
           F AFTFENHAETEAFGKMAKK+GFRVGGLPHYTLWHIYEPSDDDLL +A  E+
Sbjct: 441 FPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKER 493

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/421 (70%), Positives = 353/421 (83%), Gaps = 2/421 (0%)

Query: 84  LPSSFYHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAE 143
           L SS     Y   + +D  Y+ +DFEDID ++VSKFD G+ +YLIS++G++  +  D  +
Sbjct: 100 LGSSKSSDNYKTIDLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEK 159

Query: 144 YNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYP 203
           Y   L MLLDSTVEKYDL  F+G+++G E ++HIL+CVPLR+A +VLPLMFK+LMNLTYP
Sbjct: 160 YQSELSMLLDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYP 219

Query: 204 HELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNY--NKGKSNESIHLKY 261
           HELIDLAFLVSDCSE D TL+AL  YS+ LQ G L  I  ++D    ++ K  + ++L+Y
Sbjct: 220 HELIDLAFLVSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQY 279

Query: 262 MEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMG 321
           M+ +Y+ RV+ A+ PPFH NY KPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMG
Sbjct: 280 MDQNYINRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMG 339

Query: 322 RARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQ 381
           RARNWL +NALKPYHSWVYWRDADVELCPGS+I+DLM ++YDVIVPNVWRPLP FL S Q
Sbjct: 340 RARNWLTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ 399

Query: 382 PYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVG 441
           PYDLNSWMES E L+LAKTLDEDDVIVEGYAEYPT+RVHLAYIR+ +GDP +V+DLDGVG
Sbjct: 400 PYDLNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVG 459

Query: 442 GVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDD 501
           GVSILA+A++FR GV F AFTFENHAETEAFGKMAKK+G+RVGGLPHYT+WHIYEPSDDD
Sbjct: 460 GVSILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDD 519

Query: 502 L 502
           L
Sbjct: 520 L 520

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/425 (68%), Positives = 351/425 (82%), Gaps = 5/425 (1%)

Query: 93  YLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLL 152
           Y     ++  Y+++DFE +D  ++ KFDQG+ +YLISE+G +  +  D   Y   ++ L 
Sbjct: 84  YKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLF 143

Query: 153 DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFL 212
           DSTV++YDL  F GS DG   ++H+L+CVPLRDAEEVLPLMFK+LMNLTYPHELID+AFL
Sbjct: 144 DSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFL 203

Query: 213 VSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYN-----KGKSNESIHLKYMEPDYL 267
           VSDCS+ D TLEAL  YS+ LQ G L  I  +MD        K + N  ++LKYM+ +YL
Sbjct: 204 VSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYL 263

Query: 268 KRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 327
            +V+ A+ PP+H NY KPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+RNWL
Sbjct: 264 NKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWL 323

Query: 328 MSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNS 387
            +NALKPYHSWVYWRDAD+ELCPGSVI+D+M +DYDV+VPNVWRPLP+FLN  QPYDLNS
Sbjct: 324 TANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNS 383

Query: 388 WMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILA 447
           WMES EAL+LA+TLDEDDVIVEGYAEYPT+RVHLAYIR+E+GDP++VVDLDGVGGVSILA
Sbjct: 384 WMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILA 443

Query: 448 RARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAK 507
           RA++FR GV F AFTFENHAETEAFGKMA+K+GFRVGGLPHYTLWHIYEPSDDDL  +A 
Sbjct: 444 RAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIAN 503

Query: 508 LEKGK 512
            E+ K
Sbjct: 504 KEREK 508

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/413 (70%), Positives = 349/413 (84%), Gaps = 2/413 (0%)

Query: 100 DAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKY 159
           D  Y++FDFEDID  ++ KFDQG  +YLIS++GT+  +  D   Y   + ML DST+E Y
Sbjct: 91  DQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETY 150

Query: 160 DLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEG 219
           DL +F G+ +G E ++H+L+C+PLRDA  VLPLMF++LMNLTYPHELIDLAFLVSDCSE 
Sbjct: 151 DLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSEN 210

Query: 220 DKTLEALETYSQLLQEGILPDILADMDNYNKGKSN--ESIHLKYMEPDYLKRVKAAYKPP 277
           D TL+AL  +S+ LQ G L  +L ++D + K +++   ++HLKYM+P+YLKRV+ A+ PP
Sbjct: 211 DNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPP 270

Query: 278 FHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHS 337
           FH +Y KPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL +NALKPYHS
Sbjct: 271 FHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHS 330

Query: 338 WVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQL 397
           WVYWRDAD+ELCPGSVIEDLM +DYDVIVPNVWRPLP FL+  QPYDLNSW ES EAL+L
Sbjct: 331 WVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKL 390

Query: 398 AKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVH 457
           A+TLDEDDVIVEGYAEYPT+RVHLAYIR+  G+P +VVD+DGVGGVSILA+A++FR GV 
Sbjct: 391 AQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLFRSGVQ 450

Query: 458 FSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510
           F AFTFENHAETEAFGKMAKK+G++VGGLPHYTLWHIYEPSDDDL  MA  E+
Sbjct: 451 FPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKER 503

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/418 (70%), Positives = 342/418 (81%), Gaps = 5/418 (1%)

Query: 98  FKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVE 157
            ++ AY+ +DFEDID  ++ KFD G+ +YLI+++G +  +  D   +    +MLL STVE
Sbjct: 87  LEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVE 146

Query: 158 KYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCS 217
            YDL  F+GSA+G    EH+L+CVPLRDAE+VLPLMFK+LMNLTYPHELIDLAFLVSDC+
Sbjct: 147 SYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCT 206

Query: 218 EGDKTLEALETYSQLLQEGILPDILADMDNYNK-----GKSNESIHLKYMEPDYLKRVKA 272
           E DKTL+AL  YS+ LQ G L  + ADMD          K  E ++LKYM PDYL+ VK 
Sbjct: 207 EDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKE 266

Query: 273 AYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNAL 332
           ++ PPFH NY KPFRSVQ+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL +NAL
Sbjct: 267 SFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 326

Query: 333 KPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESN 392
           KPYHSWVYWRDADVELCPGSVIEDLM +DYDV VPNVWRPLP+FL+  QPYDLNSWMES 
Sbjct: 327 KPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESG 386

Query: 393 EALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVF 452
           EAL LAKTLDEDDVIVEGYAEYPTYRVHLAYIR+   DP +++DLDGVGGVSILA+A +F
Sbjct: 387 EALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELF 446

Query: 453 REGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510
           R G+ F AFTFENHAETE FGKMAKK+G+RVGGLPHYTLWHIYEPSDDDL  +A  E+
Sbjct: 447 RRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/426 (69%), Positives = 347/426 (81%), Gaps = 2/426 (0%)

Query: 89  YHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNL 148
           + K Y      D AY+ +DFE+ID D++ KFD G+  Y I+++G E  +  +  ++   +
Sbjct: 81  WTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEV 140

Query: 149 QMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELID 208
            MLLDSTVEKYD+  F+G+ +  E QEH+L+CVPLRDAE VLPLMFK+LMN+TYPHELID
Sbjct: 141 SMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELID 200

Query: 209 LAFLVSDCSEGDKTLEALETYSQLLQEGILPDILAD--MDNYNKGKSNESIHLKYMEPDY 266
           LAFLVSDCSEGD TL+AL  YS+ LQ G L  + A+  M    + K  E+++L+YM+ DY
Sbjct: 201 LAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDY 260

Query: 267 LKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 326
           L+RVK ++ PPFH NY K FRSVQIFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNW
Sbjct: 261 LQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNW 320

Query: 327 LMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLN 386
           L +NALKPYHSWVYWRDADVELCPGSVI+DLM +DYDV+VPNVWRPLP FL+  QPYDLN
Sbjct: 321 LTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLN 380

Query: 387 SWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSIL 446
           SW+ES EAL LAKTLDEDDVIVEGYAEYPT+R HLAY R+ +GDP +VV+LDGVGGVSIL
Sbjct: 381 SWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSIL 440

Query: 447 ARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
           ARAR+FR G+HF AFTFENHAETEAFGKMAKK+GFRVGGLPHYTLWHIYEPSDDDL  + 
Sbjct: 441 ARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500

Query: 507 KLEKGK 512
             E+ K
Sbjct: 501 NKEREK 506

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/421 (68%), Positives = 342/421 (81%), Gaps = 5/421 (1%)

Query: 97  EFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTV 156
           E +D  Y+ +DF  ID      FDQG  +YLI++YG +  +  D   Y   ++ LL S+V
Sbjct: 96  ELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSV 155

Query: 157 EKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDC 216
           +KYDL  F+G+A+G E +EH+L   PLRDAE VLP+MFK+LMNLTYPHELID+AFLVSDC
Sbjct: 156 DKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDC 215

Query: 217 SEGDKTLEALETYSQLLQEGILPDILADMD----NYNKGKSNESIH-LKYMEPDYLKRVK 271
           SEGDKTL+ L T+++ LQ+G L DI  DMD       K   N + H LK+M+ +Y+K   
Sbjct: 216 SEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMAD 275

Query: 272 AAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNA 331
           A++  P H  Y+KPFRSVQIFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL +NA
Sbjct: 276 ASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 335

Query: 332 LKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMES 391
           LKPYHSWVYWRDADVELCPGSVI+DLM ++YDVIVPNVWRPLP+FLN  QPYDLNSWMES
Sbjct: 336 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMES 395

Query: 392 NEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARV 451
            EAL+LAKTLDEDDVIVEGYAEYPT+RVHLAY+R+ +GDP Q +D+DGVGGVSILA+A++
Sbjct: 396 GEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKL 455

Query: 452 FREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKG 511
           FR GVHF AFTFENHAETEAFGKMAKK+G+ VGGLP+Y LWHIYEPSDDDL  MA +E+G
Sbjct: 456 FRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERG 515

Query: 512 K 512
           +
Sbjct: 516 E 516

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 343/420 (81%), Gaps = 1/420 (0%)

Query: 92  EYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQML 151
           +Y+P    +  Y+ +DF+ +D+D + K+D+G+ +Y+IS+ G E  S  D   +     ML
Sbjct: 75  QYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADML 134

Query: 152 LDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAF 211
           L ST + YDL  + G+++G   ++H+L+CVPLRDA  +LP++FKNLMNLTYPHELID+AF
Sbjct: 135 LASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAF 194

Query: 212 LVSDCSEGDKTLEALETYSQLLQEGILPDILADMD-NYNKGKSNESIHLKYMEPDYLKRV 270
           LVSDC++  +T+ +L  +S+ LQ G L   L D + + +KG S E ++LKYM  DYLK V
Sbjct: 195 LVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMV 254

Query: 271 KAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSN 330
           K A+ PPFH +Y KPFRS+QIF+KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWL +N
Sbjct: 255 KNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTAN 314

Query: 331 ALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWME 390
           ALKPYHSWVYWRD DVELCPG+VIEDLM  DYDVIVPNVWRPLP FL  AQ YDLNSW+E
Sbjct: 315 ALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVE 374

Query: 391 SNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARAR 450
           SNEA++LAKTLDEDDVIVEGYAEYPT+RVHL Y+R+++G+P  ++DLDGVGGVSILARA+
Sbjct: 375 SNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQ 434

Query: 451 VFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510
           +FR+G+HF AFTFENHAETEAFGKMAKK+GF+VGGL HYTLWHIYEPSDDDL  +AKLE+
Sbjct: 435 LFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLER 494

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/420 (68%), Positives = 349/420 (83%), Gaps = 10/420 (2%)

Query: 103 YHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAE---YNDNLQMLLDSTVEKY 159
           Y+++DF D ++D +SK+D+G+  YL+  Y T++ S+  +     Y+  L  LL S+V+ Y
Sbjct: 104 YYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIY 163

Query: 160 DLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEG 219
           D+ +F G++ G   +EH+L+C+PLRDAE+VLPLMFKNLMNLTYPHELID+AFLVSDCSE 
Sbjct: 164 DMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSEN 223

Query: 220 DKTLEALETYSQLLQEGILPDILADMDNYNK-------GKSNESIHLKYMEPDYLKRVKA 272
           D TLE+L  Y++ LQ G LPD+  +MD  ++          +  ++LKYM+ +YL+RVK 
Sbjct: 224 DHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKE 283

Query: 273 AYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNAL 332
           A+K PFH NY KPFRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWLM+NAL
Sbjct: 284 AFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNAL 343

Query: 333 KPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESN 392
           KPYHSWVYWRDADVELCPG+VIEDLM +D+DVIVPNVWRPLP+F+NS QPYDLNSWMES 
Sbjct: 344 KPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESR 403

Query: 393 EALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVF 452
           EA+ LAK L ED+VIVEGYAEYPT+RVHLAY+RE+DGDP QVVD+DGVGGVSILARAR+F
Sbjct: 404 EAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLF 463

Query: 453 REGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK 512
           R GVHF AFTFENHAETEAFGKMAKK+GFRVGGLPHYTLWHIYEPSDDDL+A+A  EK +
Sbjct: 464 RAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/401 (71%), Positives = 329/401 (82%), Gaps = 3/401 (0%)

Query: 115 IVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQ 174
           ++ KFD G  +YLIS+ G E    SD   Y + ++ LLDSTVE YDL +F+GSA G   +
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 175 EHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQ 234
           EH+L+ VPLR+AE+VLPLMFKNLMNLTYPHELIDLAFLVSDCSE DKTLEAL  Y + LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 235 EGILPDILADM---DNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQI 291
            G L D+ A     +   K K    + LKYM P YLK VK AY PPFH  Y KPFRSVQI
Sbjct: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180

Query: 292 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPG 351
           FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL +NALKPYHSWVYWRDADVELCPG
Sbjct: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240

Query: 352 SVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGY 411
           SVI+DLM  D+DV VPNVWRPLP+FL   QPYDLNSW+ES+ ALQLA+TLDEDDVIVEGY
Sbjct: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300

Query: 412 AEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEA 471
           AEYPT+RVHLAY+R+ D +P  +++LDGVGGVSILA+A++FR GVHF AFTFENHAETEA
Sbjct: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360

Query: 472 FGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK 512
           FGKMAKK+G+RV GLPHYTLWHIYEPSDDDL+ +A+ E+ K
Sbjct: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/423 (66%), Positives = 341/423 (80%), Gaps = 3/423 (0%)

Query: 93  YLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLL 152
           Y  F  KD  Y+++DF++ID+DI+ K+D+G  ++LIS+ G E  +  D   Y   ++MLL
Sbjct: 22  YKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLL 81

Query: 153 DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFL 212
            +TV+ YDL  ++GS +G E ++H+L+CVPLR+A  VLPLMFK+LMNLTYPHELIDLAFL
Sbjct: 82  GATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFL 141

Query: 213 VSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKG---KSNESIHLKYMEPDYLKR 269
           VSDCSE D TL+AL  YS+ LQ G L ++ A+ D   +    K +  ++LKYM  DYL  
Sbjct: 142 VSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNM 201

Query: 270 VKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMS 329
           V+ A+KPPFH +Y KPFRSVQ+FQKDFGQVIGQGFSDRHAV VQGIRRKLMGRARNWL +
Sbjct: 202 VEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTA 261

Query: 330 NALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWM 389
           NALKPYHSWVYWRD D+ELCPGSVIEDLM  + DV VPNVWRPLP+FL   Q YDLNSW+
Sbjct: 262 NALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWV 321

Query: 390 ESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARA 449
           ES EAL+LA TLDEDDVIVEGYAEYPT+RVHL YIR  D +P +++DLDGVGGVSILA+A
Sbjct: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381

Query: 450 RVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLE 509
           ++FR GVHF AFTFENHAETEAFGKMAKK+ +RVGGLPHYT+WHIYEPSDDDL  +AK E
Sbjct: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIAKKE 441

Query: 510 KGK 512
           + K
Sbjct: 442 REK 444

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/419 (65%), Positives = 335/419 (79%), Gaps = 8/419 (1%)

Query: 98  FKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVE 157
            +++ Y++F++  +D+D V ++D G  + LI + GT N ++ +   + ++L MLL +TVE
Sbjct: 103 LEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGTLNSNQEE--GFEEHLDMLLSTTVE 160

Query: 158 KYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCS 217
            YDL  + G+A+G E +EH+L+CVPLR+AE VLPLMF++LMNLTYPHELIDLAFLVSDCS
Sbjct: 161 TYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCS 220

Query: 218 EGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNES------IHLKYMEPDYLKRVK 271
           + D T+++L +Y++ LQ+G L   L   D Y   K ++S      +HLKYM  DYL  V+
Sbjct: 221 KDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHLKYMNKDYLNMVE 280

Query: 272 AAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNA 331
            A K PFH NY KPFRSVQIFQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARNWL +NA
Sbjct: 281 NALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANA 340

Query: 332 LKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMES 391
           LKPYHSWVYWRDADVELCPGSVIEDLM   YDVIVPNVWRPLP+FL S Q YDLNSW+ES
Sbjct: 341 LKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIES 400

Query: 392 NEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARV 451
           + AL LAKTLDEDDVIVEGYAEY T+R HLA  R+  G+   V+DLDGVGGVSILA+A++
Sbjct: 401 DNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKL 460

Query: 452 FREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510
           FR GVHF+AF FENHAETEAFGKMAKK+G+RVGGL HYTLWHIYEPS+DDL+ +A+ E+
Sbjct: 461 FRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKER 519

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/425 (61%), Positives = 332/425 (78%), Gaps = 9/425 (2%)

Query: 92  EYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQML 151
           E+ P    D  Y+ ++F     + ++K+D+G  +Y ++  G       D  E+ + ++ L
Sbjct: 59  EWEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEEL 115

Query: 152 LDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAF 211
           + +TVE+YDL N++G+ +G E +EH+L+C+PLR+A  VLP+MFK+LMNLTYPHELID+AF
Sbjct: 116 VSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAF 175

Query: 212 LVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNK------GKSNESIHLKYMEPD 265
           LVSDCSE DKTL++L  Y+  LQ+G L ++LA  +   K      G     ++LKYM+ +
Sbjct: 176 LVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQE 235

Query: 266 YLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARN 325
           YL+ V+ A+ PP+H NY KPFRSVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARN
Sbjct: 236 YLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARN 295

Query: 326 WLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDL 385
           WL +NALKPYHSWVYWRD DVELCPGSVIEDLM   YDVIVPNVWRPLP+FL   Q YDL
Sbjct: 296 WLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDL 355

Query: 386 NSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSI 445
           NSW+ES +AL LAK L+EDDVIVEGYAEY T+R HL   RE  G+P +V+DLDGVGGVSI
Sbjct: 356 NSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSI 415

Query: 446 LARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAM 505
           LA+A++FR+G HF+AF FENHAETEAFGKMAKK+G++VGGLPHYTLWHIYEPSDDD++ +
Sbjct: 416 LAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDI 475

Query: 506 AKLEK 510
           A+ E+
Sbjct: 476 ARRER 480

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/333 (75%), Positives = 280/333 (84%), Gaps = 3/333 (0%)

Query: 181 VPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPD 240
           VPLR+A++VLPLMFKNLMNLTYPHELIDLAFLVSDCSE D+T EAL  Y++ LQ G L  
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 241 ILADMD---NYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFG 297
           + A  +   N  + + +  + LKYM P YLK VK A+ PPFH NY KPFRSVQIFQK+FG
Sbjct: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121

Query: 298 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDL 357
           QVIGQ FSDRHAVKVQG RRKLMGRARNWL +NALKPYHSWVYWRDADVELCPGSVIEDL
Sbjct: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181

Query: 358 MLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTY 417
           M   YDV VPNVWRPLP+FL+  Q YDLNSW+ES+ AL LAK LDEDDVIVEGYAEYPT+
Sbjct: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241

Query: 418 RVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAK 477
           RVHL YIREEDGDP   +DLDGVGGVSILA+A++FR GVHF AFTFENHAETEAFGKMAK
Sbjct: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301

Query: 478 KVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510
           K+G+ V GLPHYTLWHIYEPSDDDL+ + + E+
Sbjct: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERER 334

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  394 bits (1013), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 192/351 (54%), Positives = 242/351 (68%), Gaps = 45/351 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           V+ YDL N+QG+ DG+++ + +L CVPLRDA   LP+ FK+L ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            +  D T+            G+L + L D+ +   G                        
Sbjct: 110 ST--DDTM------------GVLLNSLHDLQSQADG------------------------ 131

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                  +K F  ++IFQKDFGQ+IGQ FSDRH    QG RRKLM RARNWL S A+KPY
Sbjct: 132 -------TKRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAIKPY 184

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE  P +++EDLM  D D+IVPNVWRPLPK+LN  QPYDLNSW+ES   L
Sbjct: 185 HSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESEGGL 244

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA +L EDDVIVEGY EY T+RVHLAY+R+ +GDP   ++LDG+GGVSIL++A+VFR G
Sbjct: 245 QLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVFRTG 304

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
            HF AF+FE HAETEAFGK+++++ + V GLPHY +WH+YEPS DDL  MA
Sbjct: 305 SHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMA 355

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  391 bits (1004), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 193/351 (54%), Positives = 241/351 (68%), Gaps = 45/351 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDLGN+QG+ DG+++ + IL CVPLRDA E LP+ F +L  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+            G+L      + N    +S +                    
Sbjct: 142 SS--DNTM------------GVL------LSNLQNAQSQQ-------------------- 161

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                + SK F +++IF+KDFGQ+IGQ FSDRH  K QG RRKLM RARNWL S A+KPY
Sbjct: 162 -----DRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIKPY 216

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   L
Sbjct: 217 HSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGL 276

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA +LDED VIVEGY EY T+R HLAY+R+ +G+P   ++L+G+GGVSIL++A+VFR G
Sbjct: 277 QLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFRSG 336

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
            HF AF+FE HAETEAFGK+++++ F V GLPHY +WHIYEPS +DL  MA
Sbjct: 337 SHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMA 387

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  390 bits (1003), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 193/352 (54%), Positives = 238/352 (67%), Gaps = 45/352 (12%)

Query: 155 TVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVS 214
            V+ YDL N+QG ADG+++ +H+L  VPLRDA E LP+ F ++  ++YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 215 DCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAY 274
           D S  D T+  L  Y Q  Q                            +PD  +R     
Sbjct: 112 DSS--DDTMGVLLEYLQKAQS---------------------------KPDRTQR----- 137

Query: 275 KPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKP 334
                      F +++I++KDFGQ IGQ FSDRH    QG RRKLMGRARNWL S ALKP
Sbjct: 138 -----------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALKP 186

Query: 335 YHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEA 394
           YHSWVYWRD DVE  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   
Sbjct: 187 YHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGG 246

Query: 395 LQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFRE 454
           LQLA++LDED VIVEGY EY T+R HLAY+R+  GDP   ++LDG+GGVSIL++A+VFR 
Sbjct: 247 LQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVFRA 306

Query: 455 GVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
           G HF AF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS DDL  MA
Sbjct: 307 GSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMA 358

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  389 bits (998), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/356 (54%), Positives = 239/356 (67%), Gaps = 45/356 (12%)

Query: 155 TVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVS 214
           +VE YD+ N+QG  DG+ Q   IL+CVPL+DA   LPL FK L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 215 DCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAY 274
           D S  D T+  L    + LQ          +D    GK                      
Sbjct: 114 DSS--DNTMYNLLNMLKRLQ----------IDGGTSGK---------------------- 139

Query: 275 KPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKP 334
                      F +++I++KDFGQVIGQGFSDRH    QG RRKLMG+ARNWL + A+KP
Sbjct: 140 -----------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVAIKP 188

Query: 335 YHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEA 394
           YHSWVYWRD DVE+ P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   
Sbjct: 189 YHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEAG 248

Query: 395 LQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFRE 454
           L L+ +L ED VIVEGY EY T+R HLAY+R+ +GDP + ++LDGVGGVSIL++A VFR 
Sbjct: 249 LALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKANVFRS 308

Query: 455 GVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510
           G HF AF+F+ HAETEAFGK++K + F V GLP+Y +WHIYEPS +DL  MAKLE+
Sbjct: 309 GSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLEE 364

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  389 bits (1000), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 192/352 (54%), Positives = 237/352 (67%), Gaps = 45/352 (12%)

Query: 155 TVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVS 214
           +VE YDL N+QG+ DG++Q + IL CVPLRDA E LP+ F +L  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 215 DCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAY 274
           D S  D T+  L +  Q+ Q                                        
Sbjct: 121 DSS--DNTMGVLLSNLQMAQS--------------------------------------- 139

Query: 275 KPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKP 334
                 + SK F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL S ALKP
Sbjct: 140 ----QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKP 195

Query: 335 YHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEA 394
           YHSWVYWRD DVE  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   
Sbjct: 196 YHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGG 255

Query: 395 LQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFRE 454
           LQLA +LDED VIVEGY EY T+R HLAY+R+ +G+P   ++LDG+GGVSILA+A+VFR 
Sbjct: 256 LQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRT 315

Query: 455 GVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
           G HF AF+FE HAETEAFG++++++ + V GLPHY +WHIYEPS DDL  MA
Sbjct: 316 GSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  387 bits (995), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 249/365 (68%), Gaps = 47/365 (12%)

Query: 142 AEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLT 201
           ++Y  NL+ +    VE YDL N+QG+ADG+++ + +L CVPLRDA E LP+ FK++  ++
Sbjct: 70  SQYVPNLKNV--PQVEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEIS 127

Query: 202 YPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKY 261
           YPH LIDL+FLVSD S  D T+            G+L      + +  K +SN+      
Sbjct: 128 YPHNLIDLSFLVSDSS--DDTM------------GVL------LSSLKKAQSNQ------ 161

Query: 262 MEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMG 321
                              + S+ F +++IF+KDFGQVIGQ FSDRH    QG RRKLM 
Sbjct: 162 -------------------DKSQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMA 202

Query: 322 RARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQ 381
           RARNWL S ALKPYHSWVYWRD DVE  P +++EDLM  + DVIVPNVWRPLP +L + Q
Sbjct: 203 RARNWLGSVALKPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQ 262

Query: 382 PYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVG 441
           PYDLNSW ES   LQLA +L+ED VIVEGY EY T+R HLAY+R+  GDP   ++LDG+G
Sbjct: 263 PYDLNSWKESEGGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIG 322

Query: 442 GVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDD 501
           GVSIL++A+VFR G HF AF+FE HAETEAFGK+++++ + V GLPHY +WH+YEPS DD
Sbjct: 323 GVSILSKAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDD 382

Query: 502 LLAMA 506
           L  MA
Sbjct: 383 LKHMA 387

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  387 bits (995), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 193/351 (54%), Positives = 240/351 (68%), Gaps = 45/351 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL N+QG+ DG++Q + IL CVPLRDA E LP+ F +L  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+            G+L      + N +K +S +                    
Sbjct: 122 SS--DNTM------------GVL------LSNLHKAQSQQ-------------------- 141

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                + SK F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL S ALKPY
Sbjct: 142 -----DKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPY 196

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   L
Sbjct: 197 HSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGL 256

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA  L+ED VIVEGY EY T+R HLAY+R+ +G+P   ++LDG+GGVSILA+A+VFR G
Sbjct: 257 QLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTG 316

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
            HF AF+FE HAETEAFG++++++ + V GLPHY +WHIYEPS DDL  MA
Sbjct: 317 SHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  384 bits (987), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 193/354 (54%), Positives = 234/354 (66%), Gaps = 46/354 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE +DL   +G ADG+ Q + +L CVPLRDA E LP+ FK+L  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
               D+T+  L  + + LQ                                         
Sbjct: 102 SK--DETMSVLRQHVRELQS---------------------------------------- 119

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
               P+ ++ F +++IFQKDFGQ IGQ FSDRH    QG RRKLM RARNWL S ALKPY
Sbjct: 120 ---QPDNARQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPY 176

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE  P ++IEDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES   L
Sbjct: 177 HSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEGGL 236

Query: 396 QLAK-TLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFRE 454
           QLA  T DED VIVEGY EY T+RVHLAY+R+ +GDP   ++LDG+GGVSIL+RARVFR 
Sbjct: 237 QLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVFRS 296

Query: 455 GVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKL 508
           G HF AF+F+ HAETE FGK+++ +G+ V GLPHY +WHIYEPS DDL  MA +
Sbjct: 297 GSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWM 350

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  384 bits (985), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 190/353 (53%), Positives = 241/353 (68%), Gaps = 45/353 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL N+QG++DG+++ + IL CVPLRDA E LP+ F++L  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+  L ++ Q  Q        + MD                             
Sbjct: 122 SS--DDTMGVLLSHLQSAQ--------SQMDK---------------------------- 143

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                  SK F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL S ALKPY
Sbjct: 144 -------SKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPY 196

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   L
Sbjct: 197 HSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGL 256

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA+ L+ED VIVEGY EY T+R HLAY+R+ +GDP + ++LDG+GGVSIL++A+VFR G
Sbjct: 257 QLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFRTG 316

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKL 508
            HF AF+FE HAETEAFG++++++ + V GLPHY +WHIYEPS +DL  MA +
Sbjct: 317 SHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWM 369

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  385 bits (989), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 193/351 (54%), Positives = 238/351 (67%), Gaps = 45/351 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL N+QG+ DG+++ + IL CVPLRDA E LP+ F +L  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+            G+L      + N    +S +                    
Sbjct: 147 SS--DDTM------------GVL------LSNLQNAQSQQ-------------------- 166

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                + SK F +++IF+KDFGQVIGQ FSDRH    QG RRKLM RARNWL S A+KPY
Sbjct: 167 -----DKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKPY 221

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   L
Sbjct: 222 HSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGL 281

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA TL EDDVIVEGY EY T+R HLAY+R+ +G+P   ++LDG+GGVSILA+A+VFR G
Sbjct: 282 QLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTG 341

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
            HF AF+FE HAETEAFGK+++K+ + V GLPHY +WHIYEPS +DL  MA
Sbjct: 342 SHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  385 bits (988), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 234/351 (66%), Gaps = 45/351 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL N+QG+ DG++Q + IL CVPLRDA E LP+ F +L  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+  L +  Q  Q                                         
Sbjct: 122 SS--DNTMGVLLSSLQTAQS---------------------------------------- 139

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                + SK F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL S ALKPY
Sbjct: 140 ---QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPY 196

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DV+  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   L
Sbjct: 197 HSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGL 256

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA  LDED VIVEGY EY T+R HLAY+R+ +G+P   ++LDG+GGVSILA+A+VFR G
Sbjct: 257 QLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTG 316

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
            HF AF+FE HAETEAFG++++++ + V GLPHY +WHIYEPS DDL  MA
Sbjct: 317 SHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  385 bits (988), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 192/351 (54%), Positives = 236/351 (67%), Gaps = 45/351 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL N+QG+ DG++Q + IL CVPLRDA E LP+ F +L  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+  L +  Q+ Q                            + D  KR      
Sbjct: 122 SS--DNTMGVLLSKLQMAQS---------------------------QQDKTKR------ 146

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                     F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL S ALKPY
Sbjct: 147 ----------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALKPY 196

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   L
Sbjct: 197 HSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEGGL 256

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA  LDED VIVEGY EY T+R HLAY+R+ +G+P   ++LDG+GGVSILA+A+VFR G
Sbjct: 257 QLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRTG 316

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
            HF AF+FE HAETEAFG++++++ + V GLPHY +WHIYEPS DDL  MA
Sbjct: 317 SHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  382 bits (981), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 193/353 (54%), Positives = 236/353 (66%), Gaps = 47/353 (13%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL ++ G  DG+++ + IL CVPLRDA E LP+ F +L  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+  L                               HL+  + D  KR      
Sbjct: 114 SS--DNTMGVLMH-----------------------------HLQQAQKDKNKR------ 136

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                     F +++IF+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL S A+KPY
Sbjct: 137 ----------FGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIKPY 186

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE+ P S++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW+ES   L
Sbjct: 187 HSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEGGL 246

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA TL ED VIVEGY EY T+R HLAY+R+ +G+P   + LDG+GGVSIL++ARVFR G
Sbjct: 247 QLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFRAG 306

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKL 508
            HF AF+F+ HAETEAFGK+++++GF V GLPHY +WHIYEPS DDL  MA +
Sbjct: 307 SHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWM 359

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  383 bits (984), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 194/351 (55%), Positives = 240/351 (68%), Gaps = 45/351 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL N+QG+ DG+++ + +L  VPLRDA E LP+ F ++  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+            G+L D                 HLK          KA  K
Sbjct: 113 SS--DDTM------------GVLLD-----------------HLK----------KAQSK 131

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                +  K F +++IF+KDFGQ IGQ FSDRH    QG RRKLMGRARNWL S ALKPY
Sbjct: 132 T----DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALKPY 187

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   +
Sbjct: 188 HSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGM 247

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA++LDED VIVEGY EY T+R HLAY+R+  G+P   ++LDG+GGVSIL++A+VFR G
Sbjct: 248 QLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFRAG 307

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
            HF AF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS DDL  MA
Sbjct: 308 SHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMA 358

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  385 bits (988), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 236/351 (67%), Gaps = 45/351 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL N+QG+ DG++Q + IL C+PLRDA + LP+ F ++  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+  L ++ Q +Q                                         
Sbjct: 126 SS--DDTMGVLLSHLQTVQS---------------------------------------- 143

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                + SK F +++I++KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL S ALKPY
Sbjct: 144 ---QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVALKPY 200

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD D+E  P +++EDLM  D D+IVPNVWRPLP +L + QPYDLNSW ES   L
Sbjct: 201 HSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEGGL 260

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA  LDE+ VIVEGY EY T+R HLAY+R+ +GDP   ++LDG+GGVSIL++A+VFR G
Sbjct: 261 QLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVFRSG 320

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
            HF AF+FE HAETEAFGK+++++ + V GLPHY +WHIYEPS +DL  MA
Sbjct: 321 SHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  382 bits (981), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 188/351 (53%), Positives = 237/351 (67%), Gaps = 45/351 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           V  YDL N++G++DG+++ + IL CVPLRDA + LP  F +L  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
               D T+  L ++ Q  Q                            + + LKR      
Sbjct: 132 SK--DDTMGVLLSHLQTAQS---------------------------QQNKLKR------ 156

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                     F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL S ALKPY
Sbjct: 157 ----------FGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALKPY 206

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE CP +++EDLM    DVIVPNVWRPLP +L + QPYDLNSW ES   L
Sbjct: 207 HSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEGGL 266

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA +LDED VIVEGY EY T+R HLAY+R+ +GDP + ++LDG+GGVSIL++A+VFR G
Sbjct: 267 QLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFRSG 326

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506
            HF AF+FE HAETEAFGK+++++ + V GLPHY +WHIYEPS +DL  MA
Sbjct: 327 SHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 377

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  378 bits (970), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 237/355 (66%), Gaps = 45/355 (12%)

Query: 154 STVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLV 213
           +  E YDL N++G+++G++  + IL CVPLRDA E LP+ FK+L  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 214 SDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAA 273
           SD    D T+  L +  Q  Q                                       
Sbjct: 125 SDSK--DDTMGVLLSNLQTAQS-------------------------------------- 144

Query: 274 YKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALK 333
                  + SK F +++ F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL S A+K
Sbjct: 145 -----QKDRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 199

Query: 334 PYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNE 393
           PYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++L + QPYDLNSW ES+ 
Sbjct: 200 PYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQESDA 259

Query: 394 ALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFR 453
            L+LA +LD+D VIVEGY EY T+R HLAY+R+ +GDP   ++LDG+GGVSIL++ARVFR
Sbjct: 260 GLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARVFR 319

Query: 454 EGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKL 508
            G HF AF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS +DL  MA +
Sbjct: 320 SGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWM 374

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  380 bits (976), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 197/388 (50%), Positives = 249/388 (64%), Gaps = 56/388 (14%)

Query: 123 IMNYLIS-----EYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHI 177
           I N LIS     ++   NPS S + ++ D         VE YDL N++G+ DG+++ + I
Sbjct: 33  ISNSLISLPSLLKFVQLNPSHSYVPDFRDT------PNVEFYDLRNYKGNKDGWQRNDRI 86

Query: 178 LVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGI 237
           + CVPLRDA + LP  F +L  ++YPH LIDL+FLVSD S  D T+  L +  Q  Q   
Sbjct: 87  VFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVSDSS--DDTMGVLLSNLQTAQS-- 142

Query: 238 LPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFG 297
                                         +R K           SK F +++I++KDFG
Sbjct: 143 ------------------------------QRDK-----------SKRFGNIEIYEKDFG 161

Query: 298 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDL 357
           QVIGQ FSDRH    QG RRKLM RARNWL S ALKPYHSWVYWRD D+E  P +++EDL
Sbjct: 162 QVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDIETAPRTIMEDL 221

Query: 358 MLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTY 417
           M  D D+IVPNVWRPLP +L + QPYDLNSW ES   LQLA  L+ED VIVEGY EY T+
Sbjct: 222 MHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQLANQLNEDAVIVEGYPEYATW 281

Query: 418 RVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAK 477
           R HLAY+R+ +GDP   ++LDG+GGVSIL++A VFR G HF AF+FE HAETEAFGK+++
Sbjct: 282 RPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVFRSGSHFPAFSFEKHAETEAFGKLSR 341

Query: 478 KVGFRVGGLPHYTLWHIYEPSDDDLLAM 505
           ++G+ V GLPHY +WHIYEPS +DL  M
Sbjct: 342 RMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  371 bits (952), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 235/353 (66%), Gaps = 45/353 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL N+QG+A+G++  + ++ CVPLRDA   L + F  L  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T++ L                  + +  + +SN+                    
Sbjct: 117 SS--DDTMKTL------------------LSHLRRAQSNQ-------------------- 136

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                + S+ F +++IF+KDFGQ +GQ FSDRH    QG RRK M RARNWL S ALKPY
Sbjct: 137 -----DKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAALKPY 191

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HS+VYWRD DV+  P +++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW+ES   L
Sbjct: 192 HSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEGGL 251

Query: 396 QLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREG 455
           QLA +LDED  IVEGY EY T+R HLAY+R+  GDP   ++LDG+GGVSIL++A+VFR G
Sbjct: 252 QLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVFRTG 311

Query: 456 VHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKL 508
            HF AF+FE HAETEAFGK+++++ + V GLPHY +WHIYEPS DDL  MA +
Sbjct: 312 SHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWM 364

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  370 bits (949), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 186/354 (52%), Positives = 232/354 (65%), Gaps = 46/354 (12%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           VE YDL N+QG  DG+++   IL  VPLRDA + LP  F ++  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            S  D T+  L  + Q+ Q                                         
Sbjct: 117 SS--DDTMGELLHHLQIAQS---------------------------------------- 134

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                + +K F +++IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL S  LKPY
Sbjct: 135 ---QKDRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLKPY 191

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEAL 395
           HSWVYWRD DVE+ P S++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   +
Sbjct: 192 HSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEAGI 251

Query: 396 QLAKTL-DEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFRE 454
           QLA TL DED VIVEGY E+ T+R HLAY+R+ +G+P   ++LDG+GGVSILA+A+VFR 
Sbjct: 252 QLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFRT 311

Query: 455 GVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKL 508
           G HF AF+FE HAETEAFGK+++++ + V GLPHY +WHIYEPS +DL  MA +
Sbjct: 312 GSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWM 365

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  370 bits (951), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 236/355 (66%), Gaps = 46/355 (12%)

Query: 155 TVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVS 214
            VE YDL N+QG  DG+++   IL  VPLRDA E LP  F ++  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 215 DCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAY 274
           D S  D T+ AL                  + +  K +SN+                   
Sbjct: 122 DSS--DDTMGAL------------------LSHLEKAQSNK------------------- 142

Query: 275 KPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKP 334
                 + ++ F +++I++KDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALK 
Sbjct: 143 ------DKTRRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVALKA 196

Query: 335 YHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEA 394
           YHSWVYWRD DVELCP S++EDLM  D DVIVPNVWRPLP +L + QPYDLNSW ES   
Sbjct: 197 YHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEVG 256

Query: 395 LQLAKTLDEDD-VIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFR 453
           +QLA +L +DD VIVEGY +Y T+R HLAY+R+ +G+P   ++LDG+GGVSIL++ +VFR
Sbjct: 257 VQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKVFR 316

Query: 454 EGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKL 508
            G HF AF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS +DL  MA +
Sbjct: 317 TGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMAWM 371

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  197 bits (500), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 175/344 (50%), Gaps = 50/344 (14%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           +  YDL     + D  + +EH+L+  P++   +     + NL+ ++YP  L++L F++  
Sbjct: 96  IAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPR 152

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
              GD+TL+ LE   + +Q G + D                                   
Sbjct: 153 TPTGDETLKKLEAAVKNVQTGKVED----------------------------------- 177

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                     F  + I ++D       G  +RH++ VQ  RR  M  ARN L+ +++ P 
Sbjct: 178 ---------RFAKITILRQDSQSFDKLGEKERHSLAVQKERRSAMALARNELLFSSIGPS 228

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNSAQPYDLNSWMESN 392
            SWV W DAD+   P +VI+D+   +  V+  NV++      K  NS +PYD N+W ES 
Sbjct: 229 TSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQRFFDKEKNENSIRPYDFNNWAESE 288

Query: 393 EALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVF 452
           + L++AK ++ED++IVEGYAE  TYR  +A+  ++ G    ++ LDGVGG   L +A V 
Sbjct: 289 KGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGCTLVKAEVH 348

Query: 453 REGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           R+G  F  F F +  ETE F KMAK++ + + GLP+Y ++HI E
Sbjct: 349 RDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  194 bits (494), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 115/360 (31%), Positives = 185/360 (51%), Gaps = 57/360 (15%)

Query: 144 YNDNLQMLL-DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND +  L+ +  +  YDL   + +++    +E +L+  P++   +     + NL++LTY
Sbjct: 83  FNDKVDDLIPEGHIAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTY 139

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P  LI+L F++   + GD  L+ LE+  + +Q G                          
Sbjct: 140 PRALIELGFIIPRTASGDAALQKLESAVREVQTG-------------------------- 173

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
                                K F  + I ++        G  DRHA++VQ  RR  M  
Sbjct: 174 ------------------KQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMAL 215

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLN---- 378
           ARN L+ + + P+ SW+ W DAD+   P +VI+DL   +  V+  NV++   KF +    
Sbjct: 216 ARNELLFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQK 272

Query: 379 --SAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVD 436
             S +PYD N+W ES   L+LA+ L ++++IVEGY+E  TYR  +A+  + +G    +++
Sbjct: 273 KESIRPYDFNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLME 332

Query: 437 LDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           LDGVGG   L +A V R+G  F+ F F +  ETEAF KMAK++G+ V GLP+Y ++HI E
Sbjct: 333 LDGVGGGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  191 bits (485), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 174/351 (49%), Gaps = 50/351 (14%)

Query: 149 QMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELID 208
           +++ +  +  YDL     ++D    +E IL+  P++   +     ++NL+ LTYP ELI+
Sbjct: 87  EIIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIE 143

Query: 209 LAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLK 268
           L F+      GD+ L ALE               A +D     K N+             
Sbjct: 144 LGFIAPRTPTGDQALAALE---------------AAVDKVQSDKKNQR------------ 176

Query: 269 RVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLM 328
                            F  V I ++D          +RHA++VQ  RR  M  ARN L+
Sbjct: 177 -----------------FSKVTILRQDSVGFNKLTEKERHALEVQKERRASMALARNELL 219

Query: 329 SNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNSAQPYDL 385
            + + P+ SWV W DAD+   P S+I+D+   D  V+  NV++      K   + +PYD 
Sbjct: 220 FSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQRYYDEEKKQKAIRPYDF 279

Query: 386 NSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSI 445
           N+W ES+  L+LA  + +D++IVEGYAE  TYR  +AY  + D    + + LDGVGG   
Sbjct: 280 NNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGCT 339

Query: 446 LARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           L +A V R+G  F  F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 340 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  191 bits (484), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 116/357 (32%), Positives = 177/357 (49%), Gaps = 51/357 (14%)

Query: 144 YNDNLQMLL-DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND ++ ++ +  +  YDL     ++D    +EH+LV  P++   E     ++NL+ L+Y
Sbjct: 83  FNDRVEDIIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSY 139

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P ELI+L F++     GD  L+ LET                + N    K N        
Sbjct: 140 PRELIELGFIIPRSDAGDAALKKLET---------------AVKNVQSDKKNNR------ 178

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
                                  F  + I +++          +RH++ VQ  RR  M  
Sbjct: 179 -----------------------FSKITILRQESQSFDKLEEKERHSLAVQKERRAAMAL 215

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNS 379
           ARN L+ + L P+ SWV W D+D+   P +VIE +   D  V+  NV++      K  +S
Sbjct: 216 ARNELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQRFFDNDKQQDS 275

Query: 380 AQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDG 439
            +PYD N+W ES+  LQLA  + +D++IVEGYAE  TYR  +A+     GD  + + LDG
Sbjct: 276 IRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDG 335

Query: 440 VGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           VGG   L +A V R+G  F  F F +  ETE F KMAK++ + V GLP++ ++HI E
Sbjct: 336 VGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  189 bits (480), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 184/357 (51%), Gaps = 51/357 (14%)

Query: 144 YNDNLQMLL-DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND+++ ++ +  +  YDL     + D    +EH+L+  P++   +     + NL+ LTY
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTY 139

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P ELI+L F+    + GD  L+ LE                                   
Sbjct: 140 PRELIELGFITPRTATGDLALKKLE----------------------------------- 164

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
             + +K+V+A  K       ++ F  + I +++          +RHA+ VQ  RR  M  
Sbjct: 165 --NAVKKVQADKK-------AQRFSKITIMRQNSQSFDKLMEKERHALDVQKERRAAMAL 215

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNS 379
           ARN L+ + + P+ SWV W DAD+   P ++I+D+   +  V+  N+++      K  +S
Sbjct: 216 ARNELLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQRFYDQEKKQSS 275

Query: 380 AQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDG 439
            +PYD N+W ES+  L++A  +D+D++IVEGYAE  TYR  +A+    +  P++ + LDG
Sbjct: 276 IRPYDFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDG 335

Query: 440 VGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           VGG   L +A V R+G  F  F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 336 VGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  189 bits (479), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 178/360 (49%), Gaps = 57/360 (15%)

Query: 144 YNDNLQ-MLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND++  ++ ++ +  YDL     +      +E +L+  P++   E     + N++++TY
Sbjct: 84  FNDHVDDIIPENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTY 140

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P ELI+L F+      GD  L+ LE   + +Q                GK NE       
Sbjct: 141 PRELIELGFIAPRTPTGDAALKKLEAAIKKIQ---------------SGKKNER------ 179

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
                                  F  + I +++          DRHA+ VQ  RR  M  
Sbjct: 180 -----------------------FAKIIILRQESQSFDMLAEKDRHALAVQKQRRSAMAL 216

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNS--- 379
           ARN L+ + L P+ SWV W DAD+   P +VI+DL   D  V+  NV++   +F N    
Sbjct: 217 ARNELLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELS 273

Query: 380 ---AQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVD 436
               +PYD N+W ES   L+LA +L  D++IVEGYAE  T+R  +A+  +E    ++ + 
Sbjct: 274 KADIRPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMA 333

Query: 437 LDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           LDGVGG   L +A V R+G  F  F F +  ETE F KMAK++G+ V GLP+Y ++HI E
Sbjct: 334 LDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  188 bits (478), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 173/347 (49%), Gaps = 56/347 (16%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           +  YDL     +   F  +E +L+  P++   +     + NL+ LTYP +LI+L F++  
Sbjct: 96  ISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---WDNLLQLTYPRDLIELGFIIPR 152

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            + GD  L  LE               A +     GK ++                    
Sbjct: 153 TATGDTALRKLE---------------AAVKRTQLGKKDQR------------------- 178

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                     F  + I ++D          +RHA+KVQ  RR  M  ARN L+ + + P+
Sbjct: 179 ----------FSKITILRQDSQSFDSLQEKERHALKVQKERRAAMALARNELLFSTIGPH 228

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLN------SAQPYDLNSWM 389
            SW+ W DAD+   P S+I+D+   +  V+  NV++   K++N      + +PYD N+W 
Sbjct: 229 TSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ---KYMNEETKKIAERPYDFNNWA 285

Query: 390 ESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARA 449
           +S +ALQ+A  + +D+V+ EGYAE PTYR  +A++ +  G     + LDGVGG   L +A
Sbjct: 286 DSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGCTLVKA 345

Query: 450 RVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
            V R+G  F +F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  187 bits (475), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 182/357 (50%), Gaps = 51/357 (14%)

Query: 144 YNDNLQMLL-DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND+++ ++ +  +  YDL     ++D    +EH+L+  P++   +     + NL+ L+Y
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSY 139

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P ELI+L F+    + GD  L+ LE                                   
Sbjct: 140 PRELIELGFITPRTATGDLALKNLE----------------------------------- 164

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
             + +K+V+   K       ++ F  + I +++          +RHA+ VQ  RR  M  
Sbjct: 165 --NAIKKVQTDKK-------TQRFSKITILRQNSQSFDKLMEKERHALDVQKERRAAMAL 215

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNS 379
           ARN L+ + + P+ SW+ W DAD+   P S+I+D+   D  V+  N+++      K   S
Sbjct: 216 ARNELLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQRFYDQEKKQPS 275

Query: 380 AQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDG 439
            +PYD N+W ES+  L++A  + +D++IVEGYAE  TYR  +A+    DG P + + LDG
Sbjct: 276 IRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDG 335

Query: 440 VGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           VGG   L +A V R+G  F  F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 336 VGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  187 bits (475), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 116/379 (30%), Positives = 184/379 (48%), Gaps = 65/379 (17%)

Query: 121 QGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVC 180
           + + N++ +E+  E  SE  +AE+               DL     + D    +E +L+ 
Sbjct: 77  KKVQNWMFNEHIDEIISEGHIAEF---------------DLNKLHSTKDASINKEKVLIL 121

Query: 181 VPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPD 240
            PL+   +     ++N++ L+YP ELI+L F+V     GD  L++LE   +  Q      
Sbjct: 122 TPLQKFHQE---YWENILQLSYPRELIELGFIVPRTQTGDLALQSLEKAVEKTQ------ 172

Query: 241 ILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVI 300
              D  N                                    + F  V I ++D     
Sbjct: 173 --TDKKN------------------------------------QRFAKVTILRQDSESFN 194

Query: 301 GQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQ 360
                +RHA+ VQ  RR  M  ARN L+ + + P+ SWV W DAD+   P ++I+D+   
Sbjct: 195 KLAEKERHALNVQKERRSSMALARNELLFSTIGPHTSWVLWLDADIVETPSTLIQDMTAH 254

Query: 361 DYDVIVPNVWRPL---PKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTY 417
           D  V+  NV++      K  ++ +PYD N+W ES   L+LA  +++D++IVEGY+E  TY
Sbjct: 255 DKSVLAANVFQRYYDDEKKASATRPYDFNNWQESEIGLELASKMNDDEIIVEGYSEIATY 314

Query: 418 RVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAK 477
           R  +AY  +     ++ + LDGVGG   L +A V R+G  F +F F +  ETE F KMAK
Sbjct: 315 RPLMAYFHDTTKPVSEEMILDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAK 374

Query: 478 KVGFRVGGLPHYTLWHIYE 496
           ++G+ + GLP+Y ++HI E
Sbjct: 375 RLGYEIFGLPNYLVYHIEE 393

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  185 bits (470), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 114/357 (31%), Positives = 182/357 (50%), Gaps = 51/357 (14%)

Query: 144 YNDNLQMLLDST-VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND ++ ++ +  +  YDL     + +    +E +L+  P+++  +     + NL+ LTY
Sbjct: 82  FNDKIEDVIPAGHIAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTY 138

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P ELI+L F+V     G+  LE LE   + +Q G   D                   ++ 
Sbjct: 139 PRELIELGFIVPRTGSGNVALEQLEAAVKKVQTGKKED-------------------RFG 179

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
           +   L++   ++               ++ +K+           RHA++VQ  RR  M  
Sbjct: 180 KITILRQASQSFD--------------KLLEKE-----------RHALEVQKERRAAMAL 214

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNS 379
           ARN L+ + + PY SW+ W DAD+   P SVIED+   +  V+  NV++      +   S
Sbjct: 215 ARNELLFSTIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQRYYDQEQKKES 274

Query: 380 AQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDG 439
            +PYD N+W ES+  LQLA  +  D+++VEGY E  TYR  +A+  E+    T  ++LDG
Sbjct: 275 IRPYDYNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDG 334

Query: 440 VGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           VGG   L +A V R+G  F  F F +  ETE F KMAK++G+ V GLP+Y ++HI E
Sbjct: 335 VGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  185 bits (470), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 113/360 (31%), Positives = 184/360 (51%), Gaps = 57/360 (15%)

Query: 144 YNDNLQMLL-DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND++  ++ +  +  YDL   + +A     +E +L+  P++   +     ++NL+ LTY
Sbjct: 86  FNDHVDDIIPEGHIAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTY 142

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P ELI+L F++     G+  L+ LE                                   
Sbjct: 143 PRELIELGFIIPRTKTGENALKELEIA--------------------------------- 169

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
               +K+V++  K       ++ F  + I ++D          DRH++ VQ  RR  M  
Sbjct: 170 ----IKKVQSDKK-------NQRFAKITILRQDSQSFDQLAEKDRHSILVQKERRAAMAL 218

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLN---- 378
           ARN L+ + L P+ +WV W DAD+   P +VI+D+   D  V+  NV++   K+ +    
Sbjct: 219 ARNELLFSTLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQ---KYFDNDEK 275

Query: 379 --SAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVD 436
             + +PYD N+W ES+  L++A  +DE+++IVEGY+E  TYR  +A+    DG  T  ++
Sbjct: 276 KMAIRPYDFNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEME 335

Query: 437 LDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           LDGVGG   L +A V R+G  F  F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 336 LDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  184 bits (467), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 110/357 (30%), Positives = 182/357 (50%), Gaps = 51/357 (14%)

Query: 144 YNDNLQMLL-DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND+++ ++ +  +  YDL     +++    +EHIL+  P++   +     + NL+ L Y
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNY 139

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P ELI+L F+    + GD  L+ LE                                   
Sbjct: 140 PRELIELGFITPRTATGDLALKKLE----------------------------------- 164

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
             + +K+V+   K       ++ F  + I +++          +RHA+ VQ  RR  M  
Sbjct: 165 --NAIKKVQTDKK-------TQRFSKITILRQNSQSFDKLMEKERHALDVQKERRAAMAL 215

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNS 379
           ARN L+ + + P+ SWV W DAD+   P S+I+D+   +  ++  N+++      K   S
Sbjct: 216 ARNELLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQRFYDEEKKQPS 275

Query: 380 AQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDG 439
            +PYD N+W ES+  L++A  + +D++IVEGYAE  TYR  +A+  + +G P + + LDG
Sbjct: 276 IRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDG 335

Query: 440 VGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           VGG   L +A V R+G  F  F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 336 VGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  184 bits (466), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 114/355 (32%), Positives = 175/355 (49%), Gaps = 66/355 (18%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           V KYDL     ++D    +E +L+  P++   +     + NL+ LTYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            + GD  L+ LE   +  Q         D  N   GK                       
Sbjct: 151 SASGDAALKQLEAAVKRAQ--------TDKKNNRFGK----------------------- 179

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGF-----SDRHAVKVQGIRRKLMGRARNWLMSN 330
                        V I ++D      +GF      +RHA+ VQ  RR  M  ARN L+ +
Sbjct: 180 -------------VTILRQD-----SKGFDKLQEKERHALAVQKERRSAMALARNELLFS 221

Query: 331 ALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQ------PYD 384
            + P+ SWV W DAD+     S+I+D+   +  V+  NV++   ++ + A+      PYD
Sbjct: 222 TIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQ---RYFDEAENKPSIRPYD 278

Query: 385 LNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVS 444
            N+W +S  A +L   + +D++IVEGYAE  TYR  +A+    DG P +++ LDGVGG  
Sbjct: 279 FNNWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGC 338

Query: 445 ILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSD 499
            L +A V R+G  F  F F +  ETE F KMAK++ + V GLP+Y ++HI E +D
Sbjct: 339 TLVKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  183 bits (465), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 178/360 (49%), Gaps = 51/360 (14%)

Query: 144 YNDNLQMLL-DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND ++ ++ +  +  YDL     +A     +E +L+  P++   E     + NL+ LTY
Sbjct: 84  FNDRVEDIIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTY 140

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P ELI+L F+V     GD  L  LE                                   
Sbjct: 141 PRELIELGFIVPRTQSGDVALAKLE----------------------------------- 165

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
             + +K+V+   K       ++ F  V I ++D          +RHA+ VQ  RR  M  
Sbjct: 166 --EAVKKVQTDKK-------NQRFVKVTILRQDSKSFDKLQEKERHALAVQKERRAAMAL 216

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNS 379
           ARN L+ + + P+ SWV W DAD+   P ++I+D+   +  V+  NV++      K  +S
Sbjct: 217 ARNELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESS 276

Query: 380 AQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDG 439
            + YD N+W ES   L+LA  + ED++IVEGY+E  TYR  +AY  + +G P   + LDG
Sbjct: 277 IRAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDG 336

Query: 440 VGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSD 499
           VGG   L +A V R+G  F  F F +  ETE F KMAK++   V GLP+Y ++HI E +D
Sbjct: 337 VGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  183 bits (465), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 178/350 (50%), Gaps = 56/350 (16%)

Query: 153 DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFL 212
           ++ +  YDL     ++D    +E +L+  P++   +     ++NL+ LTYP ELI+L F+
Sbjct: 91  ENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFI 147

Query: 213 VSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKA 272
           +     GD  L+ALE                                       +K+V+ 
Sbjct: 148 LPRSDSGDAALKALEAA-------------------------------------VKKVQT 170

Query: 273 AYKPPFHPNYSKPFRSVQIFQKD---FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMS 329
             K       ++ F  + I ++D   FGQ++ +   +RHA+ VQ  RR  M  ARN L+ 
Sbjct: 171 DKK-------NQRFSKITILRQDSQGFGQLMEK---ERHALHVQKERRAAMALARNELLF 220

Query: 330 NALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNSAQPYDLN 386
           + + P+ SWV W DAD+   P +VI+D+   D  V+  NV++      K   S + YD N
Sbjct: 221 STIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQRYFDEEKKEKSIRAYDFN 280

Query: 387 SWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSIL 446
           +W ES+  LQ+A  +++D++IVEGY+E  TYR  +A+  +        + LDGVGG   L
Sbjct: 281 NWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVGGGCTL 340

Query: 447 ARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
            +A V R+G  F  F F +  ETE F KMAK++ + V GLP+Y ++H+ E
Sbjct: 341 VKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  180 bits (456), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 110/357 (30%), Positives = 178/357 (49%), Gaps = 51/357 (14%)

Query: 144 YNDNLQMLL-DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND+++ ++ +  +  YDL     + D    +EHIL+  P++   +     + NL+ L Y
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNY 139

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P ELI+L F+    + GD  L+ LE+                                  
Sbjct: 140 PRELIELGFITPRTATGDSALKKLESA--------------------------------- 166

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
               +K+V+   K       ++ F  + I +++          +RHA++VQ  RR  M  
Sbjct: 167 ----IKKVQTDKK-------TQRFSKITILRQNSQSFDKLMEKERHALEVQKERRAAMAL 215

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL---PKFLNS 379
           ARN L+ + + P+ SWV W DAD+   P S+I+D+   +  V+  N+++      K   S
Sbjct: 216 ARNELLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQRFYDQEKKQAS 275

Query: 380 AQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDG 439
            +PYD N+W ES+  L +A  + +D++IVEGYAE  TYR  +A+  +      + + LDG
Sbjct: 276 IRPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDG 335

Query: 440 VGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           VGG   L +A V R+G  F  F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 336 VGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  181 bits (459), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 170/344 (49%), Gaps = 50/344 (14%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           +  YDL     +A+    +E +L+  P++   E     + NL+ LTYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
            + GD  L                                            ++++AA K
Sbjct: 212 TTSGDNAL--------------------------------------------RKLEAAVK 227

Query: 276 PPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPY 335
                   + F  + I ++D          DRHA++VQ  RR  M  ARN L+ + + PY
Sbjct: 228 KTQLSKKDQRFLKITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFSTIGPY 287

Query: 336 HSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWR-PLPKFL--NSAQPYDLNSWMESN 392
            SWV W DAD+   P ++I+D+   D  V+  NV++  + K     +  PYD N+W +S+
Sbjct: 288 TSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNNWADSD 347

Query: 393 EALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVF 452
            ALQ+A ++ +D V+ EGY E  TYR  +A+  +E   P+  + LDGVGG   L +A V 
Sbjct: 348 TALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLVKAEVH 407

Query: 453 REGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           R+G  F +F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 408 RDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  179 bits (455), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 109/362 (30%), Positives = 182/362 (50%), Gaps = 57/362 (15%)

Query: 144 YNDNLQMLL-DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND ++ ++ ++ +  YDL     +A+    +EH+L+  P++   +     + NL+ LTY
Sbjct: 84  FNDRVEDIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQEY---WDNLLQLTY 140

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P E  +L F++   S GD  L  LE                                   
Sbjct: 141 PREFTELGFILPRTSSGDIALSKLEAA--------------------------------- 167

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
               +K+V+   K       ++ F  + I +++          +RHA++VQ  RR  M  
Sbjct: 168 ----VKKVQTDKK-------NQRFSKITILRQNSAGFDKLMEKERHALEVQKERRSAMAS 216

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLN---- 378
           ARN L+ ++L P  SWV W DAD+   P ++I+D+   +  V+  NV++   K+ +    
Sbjct: 217 ARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQ---KYYDDQAK 273

Query: 379 --SAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVD 436
               +PYD N+W ES+ AL+LAK + +D+++VEGY +  TYR  +AY  +  G     ++
Sbjct: 274 KVQIRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMN 333

Query: 437 LDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           LDGVGG   L +A V R+G  F  F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 334 LDGVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

Query: 497 PS 498
            +
Sbjct: 394 TN 395

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  173 bits (438), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/346 (30%), Positives = 166/346 (47%), Gaps = 55/346 (15%)

Query: 153 DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFL 212
           D  + +YDL   Q +A      E +L+  P++   +     + NL+ LTYP + I L FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 213 VSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKA 272
           +   S G+  L  LE   + +Q G                                    
Sbjct: 148 LPRTSSGNTALRKLEKAVRKVQTG------------------------------------ 171

Query: 273 AYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNAL 332
                  P   + F  + I ++DF        S RH   VQ  RR  M  ARN L+ + +
Sbjct: 172 -------PK-DQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFSTI 223

Query: 333 KPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQP----YDLNSW 388
            PY SWV W D+D+   P ++IED+   +  ++  NV++   +++ + +P    YDLN+W
Sbjct: 224 GPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQ---RYVENGEPAIRAYDLNNW 280

Query: 389 MESNEALQLAKTLDEDDVIVEGYA-EYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILA 447
            ES   L++A  L ED +IVEGY  E+ TYR  +A++  +     +++ LDGVGG   L 
Sbjct: 281 AESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCTLV 340

Query: 448 RARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWH 493
           +A V R+G  F  F F +  ETE F KMAK++ + + GLP+Y ++H
Sbjct: 341 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  172 bits (435), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 102/346 (29%), Positives = 167/346 (48%), Gaps = 49/346 (14%)

Query: 153 DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFL 212
           +  + KYD+     ++     +E +L+  P++   +     ++NL++LTYP +L  L F+
Sbjct: 92  EGRIMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFI 148

Query: 213 VSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKA 272
           +     GD  ++ LE   + +Q G               K N+                 
Sbjct: 149 IPRTPTGDVAMKRLEDAVKKVQSG---------------KENQR---------------- 177

Query: 273 AYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNAL 332
                        F  + I ++D          +RHA  VQ  RR  M  ARN L+ + +
Sbjct: 178 -------------FLKITILRQDSQSFNKLDEKERHAFNVQKERRAAMALARNELVFSTI 224

Query: 333 KPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLN--SAQPYDLNSWME 390
            P  SW+ W DAD+   P +VI+D+   D  ++  NV++      N  + +PYD N+W E
Sbjct: 225 GPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNWQE 284

Query: 391 SNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARAR 450
           S   L++A ++ +D++IVE Y E  TYR  +A + + +G P+  + LDGVGG   L +A+
Sbjct: 285 SQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVKAQ 344

Query: 451 VFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYE 496
           V R+G  F  F F +  ETE F  MAK++ + V GLP+Y ++H  E
Sbjct: 345 VHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  170 bits (431), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 105/357 (29%), Positives = 174/357 (48%), Gaps = 56/357 (15%)

Query: 144 YNDNLQ-MLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +ND  +  + +  +  YDL   Q SA+  E +EH+L+  PL+  E+     + NL+ L+Y
Sbjct: 90  FNDRAEDTIPEGHIAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSY 146

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMD---NYNKGKSNESIHL 259
           P + I+L F++    +GD +L+ LE+  + +Q     D  + +      +KG        
Sbjct: 147 PRDAIELGFIIPRTKKGDHSLKKLESAIKKVQTAKQGDKFSKITILRQNSKGFETVPEKK 206

Query: 260 KYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKL 319
           +  E +Y K+++A                                               
Sbjct: 207 EVSEIEYEKQIRAE---------------------------------------------- 220

Query: 320 MGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLN- 378
           M  ARN L+++ L P  +W+ W D+D+   P S+I+D+   D  V+  NV+       + 
Sbjct: 221 MALARNELLASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESG 280

Query: 379 --SAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVD 436
             S +PYD  +W+ES EALQLA  + ED++IVEG A   T R  + +  ++DG P+  + 
Sbjct: 281 ELSIRPYDFRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEIS 340

Query: 437 LDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWH 493
           LDGVG   +L ++ V R+G  F  F F +  E+E F KMAK++ + V GLP+Y ++H
Sbjct: 341 LDGVGASCLLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  170 bits (431), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/346 (31%), Positives = 173/346 (50%), Gaps = 56/346 (16%)

Query: 156 VEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSD 215
           +  YDL     SA+  E +EH+L+  PL+  +E     ++NL+NL+YP +LI+L F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 216 CSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYK 275
             +GD+ L+ LE                     N  K+ + I  K               
Sbjct: 159 TKKGDQILKQLE---------------------NAVKNVQGIDKKLG------------- 184

Query: 276 PPFHPNYSKPFRSVQIF-QKDFGQVIGQGFSDR------HAVKVQGIRRKLMGRARNWLM 328
                  S  F  + I  QKD G      F+DR      + ++++  +R  M  ARN L+
Sbjct: 185 -------SNKFAKITILRQKDSG---FHKFNDRKDKKEMNDIELEKEKRAEMALARNELL 234

Query: 329 SNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSA--QPYDLN 386
           S+ L    +W+ W D++V   P ++I+D+   D  V+  NV+       + A  +PYD  
Sbjct: 235 SSTLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFR 294

Query: 387 SWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSIL 446
           +W+ES+ ALQLA  + ED++IVEG A   T R  +    E DG PT+ + LDG+G    L
Sbjct: 295 NWIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTL 354

Query: 447 ARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLW 492
            ++ V R+G  F  F F +  E+E F KMAK++ + V GLP+Y ++
Sbjct: 355 VKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score =  107 bits (268), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 91/352 (25%), Positives = 142/352 (40%), Gaps = 66/352 (18%)

Query: 143 EYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTY 202
           +Y DN   +    +  Y+L     S D     EHILV +PL +        F+NL  LTY
Sbjct: 66  QYKDNRGAVETGGISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTY 122

Query: 203 PHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYM 262
           P +LIDL  +V D       L+A       LQE                           
Sbjct: 123 PKQLIDLGVIVPDSKNATGILQA-------LQET-------------------------- 149

Query: 263 EPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGR 322
               L +V+A        N S  +  + + + D       G +D          RK +  
Sbjct: 150 ----LAKVQA--------NDSTRYNKITVLKDDNKW----GNTDDPVA-----YRKQLAA 188

Query: 323 ARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQP 382
            +N L+ + L PY SWV W D+ +   P ++++DL      ++  ++      F NS   
Sbjct: 189 LKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHI------FNNSDGS 242

Query: 383 YD---LNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDG 439
            D   LN+W+ S+    LA  +    V++EG +   T R  +    +        ++LD 
Sbjct: 243 PDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEMELDS 302

Query: 440 VGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTL 491
           V     L +A V R+G  F  F F +  ETE F +MA+ +  +  GLP+Y +
Sbjct: 303 VSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 89/203 (43%), Gaps = 21/203 (10%)

Query: 306 DRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVI 365
           DRH   VQ  RRK + + RN+L + +      +    D+D+ + P  ++E  +    ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFLYNRSHMD-EKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 366 VPNVWRPLPKFLNSAQPYDLNSWM-ESNEALQLAKTLDEDDVI---VEGYAEYPTYRV-H 420
           VP + R     + S + YD N+W+ E  +    +K  + +  +   V G  ++    V  
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGERTKPEDTSKQNNYESYVPRPVNGKTKFLQDCVDE 481

Query: 421 LAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTF----------ENHAETE 470
              +   +     VV+LD VGG  +    ++F +G+ F  F             +  ETE
Sbjct: 482 KITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGYDGVETE 541

Query: 471 AFGKMAKKVGFRVGGLPHYTLWH 493
                AK +G++  G+P+    H
Sbjct: 542 GLCYQAKTLGYKCYGVPNVICRH 564

>KAFR0J02600 Chr10 complement(492375..498737) [6363 bp, 2120 aa]
           {ON} Anc_6.373 YCR093W
          Length = 2120

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 17/139 (12%)

Query: 245 MDNYNKGKSNESIHLKYMEP-------DYLKRVKAAYKPPFHPNYSKPFRSVQ---IFQK 294
           MDN++K + +      +++P       +YL   +A  +P +H  YSK   SV    +++ 
Sbjct: 803 MDNFDKKRDDLK---NFLKPSYYAWFSNYLVNQRAKTEPNYHKLYSKILTSVNSRSLYEC 859

Query: 295 DFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVI 354
                + Q F        Q + +KL+    +WL S  L       Y   A  EL   S  
Sbjct: 860 MVNTTLKQLFFFIAVKNTQSVDKKLLKNLASWLGSITLAIDKPIKYRNIAFRELLIDSYK 919

Query: 355 EDLMLQDYDVIVPNVWRPL 373
           E+ +    D+IVP V + L
Sbjct: 920 ENRL----DIIVPFVCKVL 934

>SAKL0G18810g Chr7 complement(1624866..1626581) [1716 bp, 571 aa]
           {ON} highly similar to uniprot|P39932 Saccharomyces
           cerevisiae YDR536W STL1 Glycerol proton symporter of the
           plasma membrane subject to glucose-induced inactivation
           strongly but transiently induced when cells are
           subjected to osmotic shock
          Length = 571

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 119 FDQGIMNYLIS--EYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEH 176
           +DQG+M+ +I+  E+ +E P+   +++++ +  ++  +    Y+LG F GS     + EH
Sbjct: 38  YDQGLMSGIITGKEFNSEFPATHKVSDHDRHATVVQGAVTSCYELGCFFGSLFVMFRGEH 97

Query: 177 I 177
           I
Sbjct: 98  I 98

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 434 VVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWH 493
           V++L+G G   I  +A +FR     +A  ++N  ++  FG    + GF  GG+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 494 IYE 496
           IYE
Sbjct: 272 IYE 274

>Agos_YGOB_Anc_6.347 Chr5 complement(1133115..1134524) [1410 bp, 469
           aa] {ON} ANNOTATED BY YGOB -
          Length = 469

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 51/131 (38%), Gaps = 20/131 (15%)

Query: 219 GDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPF 278
           GD TLE +    +L    +L ++   +     G ++ S+ L  +   Y   +   Y   +
Sbjct: 237 GDVTLEQVINSCKLEVNAVLNELSIRIPELLVGTTHSSVTLAKVNDFYNSFITEYYNYTY 296

Query: 279 HPNYS-KPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNAL----- 332
           H + S K   ++ + Q   G V             + IRRKLMG A   L          
Sbjct: 297 HQSRSDKIIHTLAVSQNTSGSV------------ARIIRRKLMGFATLILSLLVALLEVT 344

Query: 333 --KPYHSWVYW 341
             K  HSWV+W
Sbjct: 345 PAKFAHSWVFW 355

>Skud_4.809 Chr4 (1427842..1429548) [1707 bp, 568 aa] {ON} YDR536W
           (REAL)
          Length = 568

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 119 FDQGIMNYLIS--EYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGS 167
           +DQG+M  LI+  ++  E P+  +  E++ +  ++  +T   Y+LG F GS
Sbjct: 44  YDQGLMASLITGKQFNYEFPATKENGEHDRHATVVQGATTSCYELGCFAGS 94

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,352,564
Number of extensions: 2590956
Number of successful extensions: 6678
Number of sequences better than 10.0: 80
Number of HSP's gapped: 6781
Number of HSP's successfully gapped: 124
Length of query: 512
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 398
Effective length of database: 40,409,475
Effective search space: 16082971050
Effective search space used: 16082971050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)