Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B02299g8.838ON64364329970.0
NDAI0E003008.838ON6644324409e-46
TBLA0D032508.838ON6834223472e-33
Kpol_1068.108.838ON6172093178e-30
TPHA0I002308.838ON6142223106e-29
TDEL0B005908.838ON5412243032e-28
Kwal_27.102728.838ON5512152856e-26
NCAS0B003108.838ON5642302839e-26
ZYRO0G14146g8.838ON5072112774e-25
ABL128W8.838ON4742422748e-25
SAKL0D01518g8.838ON5742242671e-23
KLTH0C03916g8.838ON5702552624e-23
Ecym_46098.838ON5202112606e-23
Smik_13.208.838ON5102572454e-21
YML114C (TAF8)8.838ON5102382445e-21
Skud_13.278.838ON5142432393e-20
KLLA0D01617g8.838ON5622362287e-19
KAFR0A028208.838ON4532402204e-18
Suva_13.298.838ON5092522091e-16
KNAG0G034108.838ON5261901627e-11
Ecym_60013.581ON48660706.9
YFR053C (HXK1)3.581ON48556698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B02299g
         (643 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...  1159   0.0  
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   174   9e-46
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   138   2e-33
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   126   8e-30
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   124   6e-29
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   121   2e-28
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   114   6e-26
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   113   9e-26
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   111   4e-25
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   110   8e-25
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   107   1e-23
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   105   4e-23
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   104   6e-23
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...    99   4e-21
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...    99   5e-21
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...    97   3e-20
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...    92   7e-19
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...    89   4e-18
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...    85   1e-16
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    67   7e-11
Ecym_6001 Chr6 (4872..6332) [1461 bp, 486 aa] {ON} similar to As...    32   6.9  
YFR053C Chr6 complement(253592..255049) [1458 bp, 485 aa] {ON}  ...    31   8.9  

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 1159 bits (2997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/643 (90%), Positives = 583/643 (90%)

Query: 1   MPAIESSVVRGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAM 60
           MPAIESSVVRGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAM
Sbjct: 1   MPAIESSVVRGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAM 60

Query: 61  DQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIR 120
           DQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIR
Sbjct: 61  DQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIR 120

Query: 121 ENYRNDTSVVFKDINIDNPMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAM 180
           ENYRNDTSVVFKDINIDNPMESALGRINIQNKENIEPT           YELIELQQHAM
Sbjct: 121 ENYRNDTSVVFKDINIDNPMESALGRINIQNKENIEPTDNDVDIDEDDDYELIELQQHAM 180

Query: 181 EQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKA 240
           EQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKA
Sbjct: 181 EQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKA 240

Query: 241 LVKLMSNLDSISTTKDNQKGTHLKQXXXXXXXXXXXXXXVQSISTDKPDDVGSLEDINKQ 300
           LVKLMSNLDSISTTKDNQKGTHLKQ              VQSISTDKPDDVGSLEDINKQ
Sbjct: 241 LVKLMSNLDSISTTKDNQKGTHLKQENNLILSEESNNLEVQSISTDKPDDVGSLEDINKQ 300

Query: 301 DDDKTQGNKIEVDAENKDQVVKIXXXXXXXXXXXXXXXXXXXXXXQLSEEELADLEIKAL 360
           DDDKTQGNKIEVDAENKDQVVKI                      QLSEEELADLEIKAL
Sbjct: 301 DDDKTQGNKIEVDAENKDQVVKIEENKESSTEKATETATETATEKQLSEEELADLEIKAL 360

Query: 361 LYRIENNKEYLIEPMRVSLLKGVLKDLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEY 420
           LYRIENNKEYLIEPMRVSLLKGVLKDLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEY
Sbjct: 361 LYRIENNKEYLIEPMRVSLLKGVLKDLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEY 420

Query: 421 EQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCIKRTMDRFKRNIPIIKEKRKMVRKESI 480
           EQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCIKRTMDRFKRNIPIIKEKRKMVRKESI
Sbjct: 421 EQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCIKRTMDRFKRNIPIIKEKRKMVRKESI 480

Query: 481 KRKDELIAKRLATIKEAKMKKEQEIVRKSREMEAIENANKFGILPGEKPLEVLQDASNAS 540
           KRKDELIAKRLATIKEAKMKKEQEIVRKSREMEAIENANKFGILPGEKPLEVLQDASNAS
Sbjct: 481 KRKDELIAKRLATIKEAKMKKEQEIVRKSREMEAIENANKFGILPGEKPLEVLQDASNAS 540

Query: 541 TGESSTTTAQIPQGAPLLVNPVNSTLVPLVDSEKPKPLEEVQTIDVIAKDVXXXXXXXXX 600
           TGESSTTTAQIPQGAPLLVNPVNSTLVPLVDSEKPKPLEEVQTIDVIAKDV         
Sbjct: 541 TGESSTTTAQIPQGAPLLVNPVNSTLVPLVDSEKPKPLEEVQTIDVIAKDVEDDDEDLGL 600

Query: 601 XXXXNSSSDDEEIDQNKETQESPTKKTTHVKFELGESDSDKDI 643
               NSSSDDEEIDQNKETQESPTKKTTHVKFELGESDSDKDI
Sbjct: 601 FGGFNSSSDDEEIDQNKETQESPTKKTTHVKFELGESDSDKDI 643

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  174 bits (440), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 134/432 (31%), Positives = 210/432 (48%), Gaps = 63/432 (14%)

Query: 11  GGVQENRDVDIKEIN-----SSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVL 65
               E  + D+ E+      + N MD Q+ +LL++++ +QL+    D +  ++A +QL L
Sbjct: 2   ASANETENYDMNEVQPPREIAHNHMDMQIEKLLQKSIAIQLKAFKVDFS--KLAFNQLTL 59

Query: 66  FAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRN 125
             +DQLN+L+  LHR+SLLQRR S+A  DLE+WMRG+N+ PSDL    E SK+I+E    
Sbjct: 60  LVDDQLNSLITELHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSG 119

Query: 126 DTSVVFKDINIDNPMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFK 185
               + +D+N     E    R +I     +E +           +  I     +   L K
Sbjct: 120 KEYRILRDLN----EEVVKQRTHI-----MESSTSDDNYDLTKQFRNISDATDSSNILIK 170

Query: 186 -TDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244
            T+  +G N+     WLP FPPDHTYK+TP + N +  E  I+QKLVEEG  SEKAL+  
Sbjct: 171 PTNPFKGINIS---SWLPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNF 227

Query: 245 MSNLDSISTTKDNQKGTHLKQXXXXXXXXXXXXXXVQSISTDKPDDVGSLEDINKQDDDK 304
           + N+ +       +KGT +                  S+S + P        I   D+++
Sbjct: 228 LKNISNA------KKGTSIAPMTIPPSP---------SLSNEGP--------ITDTDEEE 264

Query: 305 TQGNKIEVDAENKDQVVKIXXXXXXXXXXXXXXXXXXXXXXQLSEEELADLEIKALLYRI 364
            Q  K E + E +D V+                          +EE LA    K+  Y I
Sbjct: 265 KQA-KNEKEKEQEDTVI----------------IPKDIDMNLANEETLAIYGTKSQSYEI 307

Query: 365 ENNKEYLIEPMRVSLLKGVLKDLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEYEQLY 424
           E  ++   +P  +S+    + +   + +S  K FDV  Y+  R+E+ R+KV  FE ++L 
Sbjct: 308 E--RDSSSKPNIISIHDEKIVNFFGHSSSD-KKFDVNKYSHHRVELVRKKVEAFENKKLR 364

Query: 425 LKYNPLLRLAKM 436
           L+ NP L+L+K+
Sbjct: 365 LEKNPFLKLSKL 376

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  138 bits (347), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 113/422 (26%), Positives = 200/422 (47%), Gaps = 85/422 (20%)

Query: 24  INSSNRMDYQ-MGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRIS 82
           I S NR++   +G+LL +++ +QL+ ++ + +++ +A ++L+   + QLN ++  L R+S
Sbjct: 49  IQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLS 108

Query: 83  LLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMES 142
           + QRR +IA +DL +W+R +NL PSDL +  EES FI+  +  D +++++          
Sbjct: 109 ITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYE---------- 158

Query: 143 ALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGRGRN--LRYKPGW 200
            L   N +   N +             Y   +L  +   +   +      N  LR  P W
Sbjct: 159 LLRDYNTETNHNFK----------NPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEW 208

Query: 201 LPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDSISTTKDNQKG 260
           LP  PPDHTYK+TP Y   +  ET +++ LV EG+L+E AL+KL+      STT +    
Sbjct: 209 LPSLPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLL----EASTTSE---- 260

Query: 261 THLKQXXXXXXXXXXXXXXVQSISTDKPDDVGSLEDINKQDDDKTQGNKIEVDAENKDQV 320
                              + S+ T + D    LE  N   D  T GN + + + ++++ 
Sbjct: 261 -------------------INSLPTPETDRENDLEQ-NINIDTNTNGNSMTLKSVSENEK 300

Query: 321 VKIXXXXXXXXXXXXXXXXXXXXXXQLSEEELADLEIKAL------LYRIENNKEYLIEP 374
                                    +L++E LA  E KA+      + +I+   E +I+P
Sbjct: 301 TNT--------------------NERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDP 340

Query: 375 MRVSLLKGVLKDLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLA 434
              + L          P++    F+VE YAR++++  R +V+ +E +QL  + NP  + +
Sbjct: 341 KAETQLSEEF----VYPST----FNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYS 392

Query: 435 KM 436
           KM
Sbjct: 393 KM 394

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  126 bits (317), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 118/209 (56%), Gaps = 24/209 (11%)

Query: 37  LLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLE 96
           +L +AV +QL++++ D ++T+ A + L+     Q++ +V  LHR+S LQRR ++A +D+ 
Sbjct: 32  ILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMVLELHRLSSLQRRNTVAKADIS 91

Query: 97  IWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKENIE 156
           +W+RG+NL P DL    ++S+++ + Y  D   + K         S   ++++ +K+   
Sbjct: 92  VWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLTKIATTTTRTLSTYQKLDLTHKDT-- 149

Query: 157 PTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSY 216
                         +L+ +  + +++L              P WLPDFPPD+TYK+TP Y
Sbjct: 150 --------STAQTSKLVPI-SNPLQKLI-------------PSWLPDFPPDYTYKFTPQY 187

Query: 217 VNVVKPETEIRQKLVEEGRLSEKALVKLM 245
              +  ET IR+K+VEEG+ SEKAL+ L+
Sbjct: 188 NTPITDETIIRRKVVEEGKQSEKALLNLL 216

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 45/73 (61%), Gaps = 4/73 (5%)

Query: 398 FDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYD----AEESDFETEYQKC 453
            +VE YAR R+EI R+KV+ +E  QL ++ NP L+++++   +      +S   TE +K 
Sbjct: 269 LNVEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKY 328

Query: 454 IKRTMDRFKRNIP 466
           +KR++  F  +IP
Sbjct: 329 LKRSLLNFIHSIP 341

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  124 bits (310), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 127/222 (57%), Gaps = 25/222 (11%)

Query: 34  MGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVS 93
           M  +L +A+ +QL+ +++D T+T+ A   L    ++QL+ +V+ + +++ LQRR+ +A  
Sbjct: 66  MEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRKEVAKK 125

Query: 94  DLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKE 153
           D+++W+RG+NL PSDL +T ++S++I+E Y  + +++ +     N + +   + +   K+
Sbjct: 126 DIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRLATDTNEVLTVFKKTDKTLKD 185

Query: 154 NIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYT 213
           +                +L+ +  + +E +              P WLP FPPD+TYK+T
Sbjct: 186 D----------STLETLKLVPI-TNTLENII-------------PDWLPSFPPDYTYKFT 221

Query: 214 PSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDSISTTK 255
           P +   +   T IR+K+  EG+ SEKAL+ L+ + + I+T+K
Sbjct: 222 PQFNKHITDATVIRKKVAAEGKKSEKALLHLLES-EKITTSK 262

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 90/184 (48%), Gaps = 31/184 (16%)

Query: 387 LDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESD- 445
           +D +  S    FD+E Y  +RI I R KV  +E +QL L+ +P L   KM    +E++D 
Sbjct: 307 VDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFL---KMTALLSEQTDK 363

Query: 446 ------FETEYQKCIKRTMDRFKRNIPIIKEKRKMVRKESI----KRKDELIAKRLATIK 495
                   T  +  +KR+  +   +IP + + +K  R+ ++    +R DE + +R     
Sbjct: 364 KVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAMVEKKRRHDEWLKRR----- 418

Query: 496 EAKMKK-EQEIVRKSREMEAIE-----NANKFGILPG------EKPLEVLQDASNASTGE 543
           E K+KK EQE   +++   AI+     N +  G L G      E+ LE+   +S  ++ +
Sbjct: 419 EEKLKKLEQEKNLRAQAFGAIDLSSFTNIDDGGFLDGFDSSENEQELEIRAKSSQNNSKD 478

Query: 544 SSTT 547
            S+T
Sbjct: 479 ISST 482

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  121 bits (303), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 119/224 (53%), Gaps = 41/224 (18%)

Query: 37  LLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLE 96
           +L +AV +QL+ +  D++  + A + L++  +DQLN ++  LHR S +QRR+SIA  D+ 
Sbjct: 33  ILSKAVALQLKPMKADIS--KFAFEHLMILIDDQLNDMIGQLHRFSNVQRRESIAKGDVH 90

Query: 97  IWMRGYNLLPSDLYMTAEESKFIRENYRN--DTSVVFKDINIDNPMESALGRINIQNKEN 154
           ++++GYNL P+DL    + S++  + Y    D+    K+   D  ++   G  ++ N   
Sbjct: 91  LFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKETFTDAVVDEDNGSEDVIN--- 147

Query: 155 IEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGRGRN--LRYKPGWLPDFPPDHTYKY 212
                           EL+                R  N  +RY P W+P FPPDHTYK+
Sbjct: 148 ----------------ELV----------------RPNNPLIRYIPKWMPAFPPDHTYKF 175

Query: 213 TPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDSISTTKD 256
           TP Y   +  ET IR+++V+EG+ SE AL+ L+ N++  + + D
Sbjct: 176 TPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSD 219

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 65/109 (59%), Gaps = 8/109 (7%)

Query: 397 DFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESD----FETEYQK 452
           +F +E YAR R+EIAR+KVV++E  Q+ L+ NP ++ +K+   ++ +         E   
Sbjct: 263 NFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHS 322

Query: 453 CIKRTMDRFKRNIPIIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKK 501
            ++R++    ++IP ++  ++  R+++ +++DE    RL  +++ K +K
Sbjct: 323 MLQRSLQHLIKSIPELQMTKQDARRKAEQKRDE----RLQELRDKKAQK 367

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  114 bits (285), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 116/215 (53%), Gaps = 18/215 (8%)

Query: 30  MDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQS 89
           MD  + +LL++A+ +QL++I+ D +++++A + L++  E+ L+ ++  LH+++ +QRR  
Sbjct: 35  MDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNMLMDLHKMANIQRRHC 94

Query: 90  IAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINI 149
           I+  DL + + GYNL  SDL +  E S+++R  +      V +D               +
Sbjct: 95  ISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEEDSKY------------V 142

Query: 150 QNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHT 209
           + +E+   T           + +++      + +        ++ ++ P WLPDFPPDHT
Sbjct: 143 EKQEHTPLTQNELLSSTHPEFFVLD------KDVLTLVPPSVKDTKHVPRWLPDFPPDHT 196

Query: 210 YKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244
           Y++T  Y   +  E  +++KL EE  LSEKAL+ L
Sbjct: 197 YRFTAQYNKPITDERLMKRKLAEEANLSEKALIHL 231

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 71/133 (53%), Gaps = 21/133 (15%)

Query: 396 KDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCIK 455
           ++F VE YAR R+EIARR+V ++E  QL L+    ++ A +    +++     + +K I+
Sbjct: 285 QNFSVEEYARNRVEIARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIR 344

Query: 456 RTMDRFK----RNIPIIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKKEQEIVRKSRE 511
             + R +    ++ P +KE+RK         ++  +A+    +++ K++KE+E   KS  
Sbjct: 345 TLLHRSRIGLLKSAPSLKERRK---------REIALAEENRRLRDEKLRKEREARSKS-- 393

Query: 512 MEAIENANKFGIL 524
                 +N+F +L
Sbjct: 394 ------SNEFDVL 400

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  113 bits (283), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 122/230 (53%), Gaps = 44/230 (19%)

Query: 27  SNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQR 86
           SN  D Q+ +LL +++ +QL+ ++  + ++++A ++L L   DQL+ L+  LHR+S++QR
Sbjct: 41  SNSSDEQVRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLISELHRMSVIQR 98

Query: 87  RQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDIN--------IDN 138
           R + A +D+E+ +RG NL  S+L+   + S F++     D   + KD +        + N
Sbjct: 99  RNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMAN 158

Query: 139 PMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGRGRNLRYKP 198
           P   ++    + N  NI                           L K +     ++   P
Sbjct: 159 PGHDSM----VNNPSNI---------------------------LIKPNNPFEISI---P 184

Query: 199 GWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNL 248
            WLP FPPDHTYK+TP +   +  +  I+QKL+EEG+ SEK+L+ L++++
Sbjct: 185 NWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLIEEGKKSEKSLLNLLNDI 234

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 68/121 (56%), Gaps = 10/121 (8%)

Query: 396 KDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKM-KYYDAEESDFETEYQKCI 454
           K F+V  YA  R+E+ R++V +FE EQL  + NP LRL++M        SD + E +  +
Sbjct: 294 KHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMINDKKVSRSDLKLEIKNSL 353

Query: 455 KRTMDRFKRNIPIIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKKEQEIVRKSREMEA 514
           +R+     RN P +K++R   R+  + R+     KR   I++ K++ EQ  ++K R+ + 
Sbjct: 354 QRSYKSIFRNYPKLKQERD--RRLELARQ-----KREEKIEKLKIQNEQ--LKKDRDAQL 404

Query: 515 I 515
           +
Sbjct: 405 L 405

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  111 bits (277), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 112/211 (53%), Gaps = 33/211 (15%)

Query: 37  LLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLE 96
           +L ++V +QL+ ++    +T+ A D+L+   + QLN ++  LHR+S LQRR++IA  D+ 
Sbjct: 28  VLAKSVALQLKPMN--AQITQFAFDRLLQLVDGQLNDMISQLHRMSNLQRRETIAKGDIS 85

Query: 97  IWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKENIE 156
           + M G+N+ PS + + +  S+F  + Y  +    F  ++    ++S+L            
Sbjct: 86  MLMEGFNISPSSIELQSRISEFYSQKYFKE----FNHLHSLRDLQSSLA----------- 130

Query: 157 PTXXXXXXXXXXXYELIELQ-QHAMEQLFKTDTGRGRN--LRYKPGWLPDFPPDHTYKYT 213
                        +E++  + Q A+ Q   T      N    + P WLPDFPPDHTYK+T
Sbjct: 131 -------------HEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFT 177

Query: 214 PSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244
           P Y + +  ET IR+++VEE + SE AL  L
Sbjct: 178 PQYSHPITDETTIRRQIVEEAKQSELALSHL 208

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 57/102 (55%), Gaps = 8/102 (7%)

Query: 397 DFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEE----SDFETEYQK 452
           +F VE YA  RIE+AR+KV++FE  QL  + +P L+L+++ +    +         E+Q 
Sbjct: 264 NFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQL 323

Query: 453 CIKRTMDRFKRNIPIIK----EKRKMVRKESIKRKDELIAKR 490
            ++R+     ++IP ++    E  +  ++E  KR  EL A+R
Sbjct: 324 ALQRSFIHLVKSIPELERNKLETEEKAKEERSKRLQELRAQR 365

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  110 bits (274), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 118/242 (48%), Gaps = 36/242 (14%)

Query: 12  GVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQL 71
           G+Q  +  D+ E+  SN M     +LL +AVG+ L+T+  DV +T++  + LV F E QL
Sbjct: 18  GIQLKKLPDLTEVTKSNPMQ----KLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQL 73

Query: 72  NALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVF 131
           + ++  LHR + +QRR  +++ D+ +++ G  +    LY     S+++R+ +        
Sbjct: 74  DDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVR--- 130

Query: 132 KDINIDNPMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDT--- 188
              +I+    S +G  +    E                    EL   +  + F  D    
Sbjct: 131 ---SIEEQSASLMGHWHQPMSEE-------------------ELLSSSHAEFFFKDVDIL 168

Query: 189 ----GRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244
                   N  Y P WLP+FPPDHTYK+T  Y   +  E ++++KL EE +LSEKAL+ +
Sbjct: 169 NLVPPTNNNNHYVPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHM 228

Query: 245 MS 246
           + 
Sbjct: 229 LG 230

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 30/39 (76%)

Query: 396 KDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLA 434
           + F++E YAR R+E+ARR+V +FE ++L ++ NP +R A
Sbjct: 273 RGFNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIRAA 311

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 117/224 (52%), Gaps = 32/224 (14%)

Query: 34  MGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVS 93
           M ++L +AV ++L+ ++KDV +++ A + LV    + L+ ++  LHR   +QRR+ I+  
Sbjct: 39  MHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKK 98

Query: 94  DLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKE 153
           DL + ++GY+L  S+L    E S++I  N+    + + +       ++S L         
Sbjct: 99  DLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQK---SKELKSKL--------- 146

Query: 154 NIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTG-------RGRNLRYKPGWLPDFPP 206
            ++P                EL   A  + F  D           +N +Y P WLP+FPP
Sbjct: 147 -LKPMTEK------------ELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPP 193

Query: 207 DHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDS 250
           DHTY++T  Y   V  E ++R+KLVEEG+ SE+ALV L+ + DS
Sbjct: 194 DHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDS 237

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 58/102 (56%), Gaps = 4/102 (3%)

Query: 392 TSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAK----MKYYDAEESDFE 447
           T  LK+F VE YAR R+EIARRKV+++E  QL L+ NP ++ A     +K         +
Sbjct: 284 TLPLKNFSVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAID 343

Query: 448 TEYQKCIKRTMDRFKRNIPIIKEKRKMVRKESIKRKDELIAK 489
            E +  ++R+     R++P + E +   R+ + +R+ E++ K
Sbjct: 344 KELKSMLQRSYIGLLRSVPKLNEVKARERELANERRREMLEK 385

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  105 bits (262), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 129/255 (50%), Gaps = 35/255 (13%)

Query: 12  GVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQL 71
           GVQ     +++EI  +  +D  + +LL++AV +QL+ ++ +V++++ A + L++  E  L
Sbjct: 18  GVQLRHLPNLEEIPRT-ALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76

Query: 72  NALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIREN-------YR 124
           + ++  LH++  +QRR  I+  DL + + GYNL  +DL +  E S+++R +        R
Sbjct: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVR 136

Query: 125 NDTSVVFKDINIDNPMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLF 184
            ++ VV            A  +  +  KE +E               L+           
Sbjct: 137 EESEVV-----------EAKEKTPLSEKELLESKHLEFFIQDKEILTLV----------- 174

Query: 185 KTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244
                  +N +Y P WLP+FPPDHTY++T  +   +  E  +++KL EE  LSEKAL+ L
Sbjct: 175 ---PPTPKNTKYVPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHL 231

Query: 245 --MSNLDSISTTKDN 257
             +S+ +S S   D+
Sbjct: 232 SKLSHEESPSEGADS 246

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 396 KDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDF---ETEYQK 452
           ++++VE YAR R+EIARRKV ++E  QL L+    ++ A +    A++ +    E E + 
Sbjct: 285 QNYNVEEYARNRVEIARRKVEEYERHQLLLQKGAFIKAAHLLSPFAKKRNCKQVEKEVRT 344

Query: 453 CIKRTMDRFKRNIPIIKEKRK 473
            + R+     ++ P+++E+RK
Sbjct: 345 LLHRSYIGLLKSAPLLREQRK 365

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  104 bits (260), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 110/211 (52%), Gaps = 18/211 (8%)

Query: 37  LLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLE 96
           LL ++V +QL+T+  D ++T +  + ++ F E Q+N +   LHR + +QRR  I++ DL+
Sbjct: 39  LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLK 98

Query: 97  IWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKENIE 156
           ++++G  +    LY   E+S++I++ Y  +    FK+I           R ++   E  +
Sbjct: 99  LFLKGTGIEVQSLYDEFEKSRYIKKTYEAE----FKNIE----------RQSLDLVEKWQ 144

Query: 157 PTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSY 216
                         E        +  +  T+     N  Y P WLP+FPPDHTYK+T  Y
Sbjct: 145 KPLRDEELLSSNHAEFFFKDVDILNLVPPTNI----NNSYVPTWLPEFPPDHTYKFTAIY 200

Query: 217 VNVVKPETEIRQKLVEEGRLSEKALVKLMSN 247
              +  E ++++ L EEG+LSEKAL+ ++ +
Sbjct: 201 NKPISDERQMKRMLFEEGKLSEKALLNMLGS 231

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 58/103 (56%), Gaps = 10/103 (9%)

Query: 392 TSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKM--KYYDAEESD---F 446
           +S  K F+++ YAR RI +ARRKV +FE  +L  + NP +R + +   Y +A+++     
Sbjct: 288 SSHSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAA 347

Query: 447 ETEYQKCIKRTMDRFKRNIPIIK-----EKRKMVRKESIKRKD 484
           E E+   ++R+     ++IP ++     E    + +E IK+K+
Sbjct: 348 EREFNILLRRSYVGVLKSIPKLRQLKANEMAAAIERERIKQKE 390

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 128/257 (49%), Gaps = 29/257 (11%)

Query: 1   MPAIESSVVRGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAM 60
           M   ES      VQ  R  D+ EI S   +D  + E+LK+ V  QL +++  + ++  A+
Sbjct: 5   MSGSESGTQHTIVQLRRLPDLTEI-SHLEIDAPVVEILKKTVLFQLNSLN--ICISNFAL 61

Query: 61  DQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIR 120
           D+LV     Q++ +   LH ++LLQRR   + +DL++  R +N+  + LY   + S+FI+
Sbjct: 62  DELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIK 121

Query: 121 ENYRNDTSVVFKDINIDNPMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAM 180
            N+  +   + +  +       AL      N+E+ E                IE QQ  +
Sbjct: 122 SNHAVEYGKLVRLSSF-----PALA----HNEEDEEDELSN-----------IEEQQSEI 161

Query: 181 EQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKA 240
             L        + +   P WLP+FPPDHTYK+TP + + +     I++++V+E   SEKA
Sbjct: 162 NVLLPPSNPLEKLI---PSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKA 218

Query: 241 LVKL---MSNLDSISTT 254
           L+ L   +S+L S S T
Sbjct: 219 LLNLNKRLSHLSSASHT 235

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 59/110 (53%), Gaps = 12/110 (10%)

Query: 393 SKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQK 452
           + L + ++E YA+ R+E+AR +V  FE  QL    NP L+L++  Y+           Q 
Sbjct: 268 TSLNESNIEQYAKYRVELARERVAKFELNQLKRTKNPFLKLSETLYFSEGPHQSHKTIQS 327

Query: 453 CI----KRTMDRFKRNIPII----KEKRKMVRKESIK----RKDELIAKR 490
            I    +++M  F  N+P +    KE+ +M ++E  K    R++ELI++R
Sbjct: 328 AIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKEERAKSLRRRQEELISER 377

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score = 98.6 bits (244), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 118/238 (49%), Gaps = 28/238 (11%)

Query: 20  DIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLH 79
           D+ EI S   +D  + E+LK+ V  QL +++  + ++  A+D+LV     Q++ +   LH
Sbjct: 24  DLTEI-SHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTVQMDGMFRNLH 80

Query: 80  RISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDN- 138
            ++LLQRR   + +DL++ +R +NL    LY   + S+FI+  +  +   +    ++   
Sbjct: 81  NLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSWSSLAAL 140

Query: 139 PMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGRGRNLRYKP 198
           P         + N                     IE QQ+ +  L        + +   P
Sbjct: 141 PHNEEDEEDELNN---------------------IEEQQNEINVLLPPSNPLEKQI---P 176

Query: 199 GWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDSISTTKD 256
            WLP+FPPDHTYK+TP + + +     I++++V+E + SEKAL+ L  +L  IS+  +
Sbjct: 177 SWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASN 234

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 15/115 (13%)

Query: 391 PTSKLKDFD---VEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFE 447
           PT   K F+   +E YA+ R+E+AR +V  FE  QL    NP L++++  Y         
Sbjct: 263 PTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKISETLYLPESPHQSH 322

Query: 448 TEYQKCI----KRTMDRFKRNIPII----KEKRKMVRKESIK----RKDELIAKR 490
              QK I    +++M  F  N+P +    KEK +M ++E  K    R++ELI++R
Sbjct: 323 KTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKEERAKSLKRRQEELISQR 377

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 118/243 (48%), Gaps = 26/243 (10%)

Query: 10  RGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAED 69
           R  VQ     D+ EI S  ++D  + E+L++ V  QL ++D  + ++  A+D+LV     
Sbjct: 14  RTLVQLKNLPDLTEI-SHLKIDAPVVEILRKTVLFQLNSLD--ICISNFALDELVNLVAV 70

Query: 70  QLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSV 129
           Q++ +   LH ++LLQRR     +DL++  + +NL P+ LY   + S+FI+ N+  +   
Sbjct: 71  QMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEK 130

Query: 130 VFKDINIDNPMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTG 189
           +    +      +     +  N                     IE QQ+ +  L      
Sbjct: 131 LVSSSSFSASSHNEEDEEDELNN--------------------IEEQQNEISVLLPPSNP 170

Query: 190 RGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLD 249
             +     P WLP+FPPDHTY++TP + + +     I++++V+E + SEKAL+ L   L 
Sbjct: 171 LEK---LMPSWLPNFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLL 227

Query: 250 SIS 252
            IS
Sbjct: 228 HIS 230

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 55/104 (52%), Gaps = 12/104 (11%)

Query: 399 DVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCI---- 454
           ++E YA+ R+E+AR +V  FE  QL    NP LR+++  Y            Q+ I    
Sbjct: 274 NIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQF 333

Query: 455 KRTMDRFKRNIPII----KEKRKMV---RKESIKRK-DELIAKR 490
           +++M  F  N+P +    KEK +M    R  S+KR+ +ELI +R
Sbjct: 334 RKSMMLFAHNLPKVQKLKKEKIRMAIEERSRSLKRRQEELILER 377

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score = 92.4 bits (228), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 118/236 (50%), Gaps = 36/236 (15%)

Query: 20  DIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLH 79
           ++ E+  +N M+     L  +AV +QL+T++K+V ++++A D L   +  QL+ L+  L 
Sbjct: 28  NLNEVPHANPME----RLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDDLLQSLK 83

Query: 80  RISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNP 139
           +I+ +QRR  I+  DL ++ +G  +   DL    E S F+   ++++           N 
Sbjct: 84  KITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEA----------NA 133

Query: 140 MESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDT-------GRGR 192
           +   + ++  Q  + +E                 EL      + F  D           +
Sbjct: 134 LNETVLKVKQQFMKELEEK---------------ELLSSKHSEFFVQDVDILNLLPSSNK 178

Query: 193 NLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNL 248
           + +Y P WLP+ PPDHTYK+T  Y   +  E  +++KL+EEGRLSEKAL+ ++S +
Sbjct: 179 SNKYVPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQV 234

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 383 VLKDLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAE 442
           VL  ++S   S +K+F+V  Y ++R  I +R+    E +    + NP +R A +     +
Sbjct: 288 VLHGIESFNLSPVKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQ 347

Query: 443 ES-----DFETEYQKCIKRTMDRFKRNIPIIKEKRKMVRKESIKRKDELIAKRLATIKEA 497
            S       E + +  ++R+      +IP +KE R+  RKE+ +R + L+ ++    KE 
Sbjct: 348 GSTKSRKSVENQLKTMLRRSYLGLIDSIPRVKEVRERARKEAEER-ERLLQEQRRIEKEK 406

Query: 498 KMKKEQEIV 506
           KM  EQEI+
Sbjct: 407 KM-AEQEIL 414

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score = 89.4 bits (220), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 108/240 (45%), Gaps = 33/240 (13%)

Query: 12  GVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQL 71
            ++++ +V+  EI      + Q+  LL ++V ++L+ ++    +   A D L+   + QL
Sbjct: 4   SIEDDMNVEPLEIRRQITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQL 63

Query: 72  NALVDGLHRISLLQRRQSIAV-SDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVV 130
           N L+  L R+SLLQRR S A  SD+ + ++G+NL  S+L    E S  I+  Y  D   +
Sbjct: 64  NDLIKQLGRLSLLQRRNSNATKSDILLLLKGFNLSESELNTELEISNHIKRLYSEDEKKL 123

Query: 131 FKDINIDNPMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGR 190
            +D    N     +G +   + + + PT                                
Sbjct: 124 SEDSIHYNQHTDFVGPVETSSFQLLNPTNPLKDAI------------------------- 158

Query: 191 GRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDS 250
                  P W P  PPDHTYK+TP Y N +     I+QK  +E +  + AL  L++ ++S
Sbjct: 159 -------PSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVKTALFNLINKIES 211

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 80/156 (51%), Gaps = 27/156 (17%)

Query: 349 EEELADLEIKALLYRIENNKEYLIEPMRVSLLKGVLKDLDS--NPTSKLKDFDVEAYARQ 406
           +E LA LE +AL   +E       E M  +  K V K L+S   P +K   FD+E Y+ +
Sbjct: 221 DETLAKLESQALFGTVE-------EKMNTN--KKVYKSLNSIIVPITK---FDIEEYSHK 268

Query: 407 RIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCIKRTMDRFKRNIP 466
           R+ IAR KV  FE + L LKYNP + L           + +T+ +  + R+      +IP
Sbjct: 269 RVNIARNKVSKFENKMLALKYNPFINLI----------NDQTDVKSYLNRSFQLMINSIP 318

Query: 467 -IIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKK 501
            +  EK+K +R+  I+R DE I  RL    + K+K+
Sbjct: 319 ELTLEKKKAIRQAEIER-DERI-NRLREDHQTKLKQ 352

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 124/252 (49%), Gaps = 26/252 (10%)

Query: 2   PAIESSVVRGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMD 61
           P   S   +  VQ     D+ E+ S   +D  + E+LK++V  QL +++  + ++  A+D
Sbjct: 6   PESGSGASQTMVQLTNLPDLTEV-SHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALD 62

Query: 62  QLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRE 121
           ++V     Q++ +   LH ++LLQRR  ++ +DL++  R +NL  + L+   +    I E
Sbjct: 63  EMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQ----ISE 118

Query: 122 NYRNDTSVVFKDINIDNPMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAME 181
           + ++  SV ++ + + +   +A+                            IE QQ+ + 
Sbjct: 119 HIKSKHSVEYEKL-VKSSSFTAVSH---------------IEDDEEDEINNIEEQQNEIN 162

Query: 182 QLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKAL 241
            L        + +   P WLP+FPPDHTYK+TP + + +     I++++V+E   SE+AL
Sbjct: 163 VLLPPSNPLEKLI---PSWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERAL 219

Query: 242 VKLMSNLDSIST 253
           + L   L  IS+
Sbjct: 220 LNLNKRLFRISS 231

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 62/110 (56%), Gaps = 24/110 (21%)

Query: 399 DVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQ--KCIKR 456
           ++E YA+ RIE+AR +V  FE  QL    NP L++++  Y       F+  +Q  K I+R
Sbjct: 273 NIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISESLY------SFKNPHQSHKVIQR 326

Query: 457 TMD--------RFKRNIPII----KEKRKMV---RKESIKRK-DELIAKR 490
           ++D         F  N+P +    KEK ++    R++S+KR+ +ELI++R
Sbjct: 327 SIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEERQKSLKRRQEELISQR 376

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 90/190 (47%), Gaps = 27/190 (14%)

Query: 72  NALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVF 131
           + +V  LHRI+ +QRRQ     D+ + ++G+ L P D+    EE  ++ +    +   V 
Sbjct: 79  SGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDI----EEQMYLSKKIGYNRMQVP 134

Query: 132 KDINIDNPMESALGRINIQNKENIEPTXXXXXXXXXXXYELIELQQHAMEQLFKTDTGRG 191
           ++  +   ++ A G  +                     ++L+E QQ     L  +D  + 
Sbjct: 135 REQTVQ--LQDATGSYD--------------------RFKLVENQQLIASGLSGSDMSQE 172

Query: 192 RNLRYK-PGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDS 250
             +  K P WLP  PP+HTYK+T  Y  ++  E  +++K+++E    E +L  L+ N D 
Sbjct: 173 LPIAEKIPAWLPKLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDR 232

Query: 251 ISTTKDNQKG 260
            + TK +++ 
Sbjct: 233 DADTKVDERA 242

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 396 KDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLL 431
           K FDV+AY+  R+++AR  V  FE+E  Y   NP L
Sbjct: 286 KSFDVQAYSLGRVKLARNAVQRFEWETKYRPRNPFL 321

>Ecym_6001 Chr6 (4872..6332) [1461 bp, 486 aa] {ON} similar to
           Ashbya gossypii AFR279C
          Length = 486

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 175 LQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEG 234
           +  H + +L K  T +G N+   PGW+ D+P   T K T +Y+ +    T +R  LV  G
Sbjct: 44  ITDHFVGELQKGLTKKGGNIPMIPGWVMDYP---TGKETGNYLAIDLGGTNLRVVLVTLG 100

>YFR053C Chr6 complement(253592..255049) [1458 bp, 485 aa] {ON}
           HXK1Hexokinase isoenzyme 1, a cytosolic protein that
           catalyzes phosphorylation of glucose during glucose
           metabolism; expression is highest during growth on
           non-glucose carbon sources; glucose-induced repression
           involves the hexokinase Hxk2p
          Length = 485

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 177 QHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVE 232
           +H +++L K  T +G N+   PGW+ +FP   T K + +Y+ +    T +R  LV+
Sbjct: 46  KHFIDELNKGLTKKGGNIPMIPGWVMEFP---TGKESGNYLAIDLGGTNLRVVLVK 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,634,759
Number of extensions: 2749568
Number of successful extensions: 12567
Number of sequences better than 10.0: 239
Number of HSP's gapped: 12881
Number of HSP's successfully gapped: 294
Length of query: 643
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 527
Effective length of database: 40,180,143
Effective search space: 21174935361
Effective search space used: 21174935361
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)