Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B01875g8.273ON74743794e-49
Kpol_YGOB_YDR119W-A8.273ON75431303e-11
YDR119W-A (COX26)8.273ON66411191e-09
TPHA0A017408.273ON79741201e-09
Skud_4.3808.273ON66411156e-09
Smik_4.3648.273ON65411146e-09
NDAI0J012908.273ON75691122e-08
TDEL0F040008.273ON62381103e-08
Suva_2.2808.273ON66411071e-07
SAKL0H16786g8.273ON74381052e-07
TBLA0F030308.273ON75581034e-07
KLLA0F19371g8.273ON8058992e-06
KAFR0B054408.273ON6653973e-06
Kwal_YGOB_YDR119W-A8.273ON7430983e-06
KLTH0G13442g8.273ON7438861e-04
KLLA0F19382gsingletonON7549800.001
KNAG0H031708.273ON7159790.002
Ecym_42978.273ON7445760.004
ZYRO0D06908g8.273ON7762760.006
NCAS0B037708.273ON6027670.077
KAFR0B027608.273ON7936601.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B01875g
         (74 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...   150   4e-49
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    55   3e-11
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    50   1e-09
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    51   1e-09
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    49   6e-09
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    49   6e-09
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    48   2e-08
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    47   3e-08
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    46   1e-07
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    45   2e-07
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    44   4e-07
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    43   2e-06
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    42   3e-06
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    42   3e-06
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    38   1e-04
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    35   0.001
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    35   0.002
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    34   0.004
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    34   0.006
NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}       30   0.077
KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273...    28   1.4  

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score =  150 bits (379), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%)

Query: 1  MFRSVGINRMRYVMNSSMTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVT 60
          MFRSVGINRMRYVMNSSMTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVT
Sbjct: 1  MFRSVGINRMRYVMNSSMTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVT 60

Query: 61 LGWPFGIYFWKKPN 74
          LGWPFGIYFWKKPN
Sbjct: 61 LGWPFGIYFWKKPN 74

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 54.7 bits (130), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%)

Query: 32 GRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKKPN 74
          G IG SW + E KR+ PT+IGW + LT  L WPF IY +K P+
Sbjct: 32 GHIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYHYKAPD 74

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 50.4 bits (119), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%)

Query: 32 GRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKK 72
          GRIG SW I E +RL P +  W++ L+V LGWP  +YF+ K
Sbjct: 22 GRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSK 62

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 50.8 bits (120), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%)

Query: 1  MFRSVGINRMRYVMNSSMTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVT 60
          MF  +       + N  + R  S+ A+T     +G SW + E KR+ P L+ W S +T  
Sbjct: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60

Query: 61 LGWPFGIYFWKKPN 74
          L WP  I ++K PN
Sbjct: 61 LLWPSFIKYFKDPN 74

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 48.9 bits (115), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 32 GRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKK 72
          GR+G SW I E +RL P ++ W++ L++ LGWP  +YF  K
Sbjct: 22 GRVGESWVITEGRRLIPEVLQWSAALSICLGWPGAVYFLSK 62

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 48.5 bits (114), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 32 GRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKK 72
          GR+G SW I E +RL P +  W++ L++ LGWP  +YF+ K
Sbjct: 22 GRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFFSK 62

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 47.8 bits (112), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 9/69 (13%)

Query: 13 VMNSSMTRSLSSTARTQ-----AQGRIGP----SWTIAEIKRLTPTLIGWASFLTVTLGW 63
          + NS + RS+ +TA  Q     A   I P     W  +EI+R+ PT++ W++FL V LGW
Sbjct: 2  LFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLGW 61

Query: 64 PFGIYFWKK 72
          P   Y++ K
Sbjct: 62 PAPFYYYHK 70

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 47.0 bits (110), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 37 SWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKKPN 74
          SW ++E KRLTP ++GW  FL   LGWPF I  +   N
Sbjct: 25 SWAVSEAKRLTPAILGWGGFLAGCLGWPFAIKHFMSAN 62

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 45.8 bits (107), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%)

Query: 32 GRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKK 72
          GR+G +W I E +RL P +  W + +   LGWP  +YF+ K
Sbjct: 22 GRVGEAWMITESRRLIPEVFQWGAVICTCLGWPGAVYFFSK 62

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 45.1 bits (105), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 30 AQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGI 67
          + GR+G  W I E KRL PT+  W + +   LGWPF +
Sbjct: 31 SHGRLGEPWAITEAKRLVPTIFLWGASMAAVLGWPFAV 68

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 44.3 bits (103), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 5/58 (8%)

Query: 20 RSLSSTARTQ-----AQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKK 72
          RS +S AR Q      +     SW + E+KR+ P +  WA+ L+V+LGWPF   +++ 
Sbjct: 8  RSSASMARMQLRRSFTRSYTQESWAVTEVKRIVPNIAFWATLLSVSLGWPFCFVWYQD 65

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 42.7 bits (99), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 10 MRYVMNSSMTRSLSSTARTQAQG--RIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPF 65
          +R     +M  +  +T +T  +   R+G +W + E +RL PT++ + +F+   LGWPF
Sbjct: 7  LRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVLGWPF 64

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 42.0 bits (97), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 17 SMTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYF 69
          +  R  ++T++T AQ  IGP +   + K+   T+  W +FL V LGWP  IY+
Sbjct: 11 NFARFYAATSKTHAQ-HIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 42.4 bits (98), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 38 WTIAEIKRLTPTLIGWASFLTVTLGWPFGI 67
          W + E KR+ PT+  WA+ +T+ LGWPFG+
Sbjct: 40 WAVIEAKRIVPTVAMWATSMTIMLGWPFGV 69

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 37.7 bits (86), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 35 GPS-----WTIAEIKRLTPTLIGWASFLTVTLGWPFGI 67
          GPS     W + E KRL P +  W +F+   LGWPF +
Sbjct: 32 GPSSRARKWAVIEAKRLVPAIGMWGAFMGAVLGWPFAV 69

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 20 RSLSSTAR--TQAQGR-IGPSWTIAEIKRLTPTLIGWASFLTVTLGWPF 65
          +  ++TAR    A G  +G SWT +E +RL P LI +A F+   + WP+
Sbjct: 10 KEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPY 58

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 35.0 bits (79), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 13 VMNSSMTRSLSSTAR------TQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPF 65
          +  S +++SL   ++        + GR+GP +   EIKR  P +  W S L + L WPF
Sbjct: 1  MFRSQVSKSLQRMSKPIGLRYASSGGRVGPGFYRTEIKRRIPQVALWGSGLFLVLEWPF 59

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 33.9 bits (76), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 27 RTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWP--FGIYF 69
          R      IG  W + E KRL PT++ W   +T  L WP  F +Y 
Sbjct: 25 RAATSKHIGEPWMVTETKRLVPTILIWGGTMTGILLWPIIFRVYI 69

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 33.9 bits (76), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%)

Query: 13 VMNSSMTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKK 72
          V+ +S   +    A+  ++   G  W + E +RL+   + WA  L++ L WP  I  + +
Sbjct: 6  VLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAIIKFSE 65

Query: 73 PN 74
           N
Sbjct: 66 HN 67

>NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}
          Length = 60

 Score = 30.4 bits (67), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 17/27 (62%)

Query: 35 GPSWTIAEIKRLTPTLIGWASFLTVTL 61
          G  W   E+KR+TPTL  WAS L  TL
Sbjct: 33 GVRWLKGEVKRVTPTLGVWASILITTL 59

>KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 79

 Score = 27.7 bits (60), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query: 32 GRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGI 67
          GR G  W + E KR    + G+   L+V   WPF I
Sbjct: 29 GRAGGPWGLMEFKRQIVLIPGFLLTLSVLCFWPFSI 64

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.133    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,382,931
Number of extensions: 172577
Number of successful extensions: 651
Number of sequences better than 10.0: 21
Number of HSP's gapped: 651
Number of HSP's successfully gapped: 21
Length of query: 74
Length of database: 53,481,399
Length adjustment: 46
Effective length of query: 28
Effective length of database: 48,206,763
Effective search space: 1349789364
Effective search space used: 1349789364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)