Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B01859g8.270ON62262231610.0
Skud_4.3788.270ON6524265496e-61
Smik_4.3628.270ON6484355242e-57
Suva_2.2778.270ON6494265128e-56
TDEL0F039708.270ON6194254993e-54
YDR118W (APC4)8.270ON6524374943e-53
KAFR0B054608.270ON6104904801e-51
ZYRO0C01474g8.270ON5994204763e-51
TPHA0J007908.270ON6853764796e-51
Kpol_392.18.270ON4244254532e-49
KNAG0H031908.270ON6224124142e-42
NCAS0B037908.270ON6124233939e-40
NDAI0J012708.270ON7353863604e-35
TBLA0C045708.270ON6084503141e-29
SAKL0H16852g8.270ON6444813098e-29
KLTH0G13508g8.270ON6454202883e-26
Kwal_56.237668.270ON7404172573e-22
Ecym_43008.270ON7153831573e-10
AGR078C8.270ON7153801531e-09
KLLA0F19316g8.270ON6713141332e-07
Skud_16.245na 1ON94783780.80
KNAG0D035004.115ON90183780.95
Suva_16.280na 1ON93486761.4
NDAI0D035204.115ON90986751.8
YPL036W (PMA2)na 1ON94783751.9
Suva_7.2734.115ON91683742.9
NDAI0B02650singletonON92983733.0
Suva_16.2408.540ON52342733.1
KNAG0K009903.140ON43673724.0
NCAS0A065404.115ON91383724.8
KNAG0C065705.698ON59046715.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B01859g
         (622 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...  1222   0.0  
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   216   6e-61
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   206   2e-57
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   201   8e-56
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   196   3e-54
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   194   3e-53
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   189   1e-51
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   187   3e-51
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   189   6e-51
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   179   2e-49
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   164   2e-42
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   155   9e-40
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   143   4e-35
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   125   1e-29
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   123   8e-29
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   115   3e-26
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   103   3e-22
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    65   3e-10
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    64   1e-09
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    56   2e-07
Skud_16.245 Chr16 (447878..450721) [2844 bp, 947 aa] {ON} YPL036...    35   0.80 
KNAG0D03500 Chr4 (635954..638659) [2706 bp, 901 aa] {ON} Anc_4.1...    35   0.95 
Suva_16.280 Chr16 (486077..488881) [2805 bp, 934 aa] {ON} YPL036...    34   1.4  
NDAI0D03520 Chr4 (831794..834523) [2730 bp, 909 aa] {ON} Anc_4.115     33   1.8  
YPL036W Chr16 (482843..485686) [2844 bp, 947 aa] {ON}  PMA2Plasm...    33   1.9  
Suva_7.273 Chr7 complement(471202..473952) [2751 bp, 916 aa] {ON...    33   2.9  
NDAI0B02650 Chr2 (657989..660778) [2790 bp, 929 aa] {ON}               33   3.0  
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    33   3.1  
KNAG0K00990 Chr11 complement(194211..195521) [1311 bp, 436 aa] {...    32   4.0  
NCAS0A06540 Chr1 (1292273..1295014) [2742 bp, 913 aa] {ON} Anc_4...    32   4.8  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...    32   5.7  

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score = 1222 bits (3161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/622 (97%), Positives = 609/622 (97%)

Query: 1   MGEDIVLDRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID 60
           MGEDIVLDRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID
Sbjct: 1   MGEDIVLDRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID 60

Query: 61  GKYLALFLKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSEL 120
           GKYLALFLKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSEL
Sbjct: 61  GKYLALFLKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSEL 120

Query: 121 RIPNNDLTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKKVVDVHLGYSCSSAQV 180
           RIPNNDLTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKKVVDVHLGYSCSSAQV
Sbjct: 121 RIPNNDLTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKKVVDVHLGYSCSSAQV 180

Query: 181 TILINGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDD 240
           TILINGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDD
Sbjct: 181 TILINGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDD 240

Query: 241 KLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLDVLERLFLIGELDT 300
           KLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLDVLERLFLIGELDT
Sbjct: 241 KLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLDVLERLFLIGELDT 300

Query: 301 KLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDL 360
           KLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDL
Sbjct: 301 KLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDL 360

Query: 361 QESQETSLLDISELQSFXXXXXXXXXXXXXDETYFKQDFLPWLTDKVYESINNEYKSVFF 420
           QESQETSLLDISELQSF             DETYFKQDFLPWLTDKVYESINNEYKSVFF
Sbjct: 361 QESQETSLLDISELQSFLNLVLKLLAELNEDETYFKQDFLPWLTDKVYESINNEYKSVFF 420

Query: 421 KAEYGNNKRILNIIKYFEATVIEIDYSLRTHLNKLKDENEKIINLFQKFSKSSLKTCLSE 480
           KAEYGNNKRILNIIKYFEATVIEIDYSLRTHLNKLKDENEKIINLFQKFSKSSLKTCLSE
Sbjct: 421 KAEYGNNKRILNIIKYFEATVIEIDYSLRTHLNKLKDENEKIINLFQKFSKSSLKTCLSE 480

Query: 481 FETKLFEPKKAVKLLACEKICNDVCNYVQVLMSKDYILEILLVDAVTGTVLLSEKYNSIQ 540
           FETKLFEPKKAVKLLACEKICNDVCNYVQVLMSKDYILEILLVDAVTGTVLLSEKYNSIQ
Sbjct: 481 FETKLFEPKKAVKLLACEKICNDVCNYVQVLMSKDYILEILLVDAVTGTVLLSEKYNSIQ 540

Query: 541 NPFGYEITLDNIISCTLVGTEKVNKDDTYMQDILAGGNSLVQENDNKIEIYAVFGTALDV 600
           NPFGYEITLDNIISCTLVGTEKVNKDDTYMQDILAGGNSLVQENDNKIEIYAVFGTALDV
Sbjct: 541 NPFGYEITLDNIISCTLVGTEKVNKDDTYMQDILAGGNSLVQENDNKIEIYAVFGTALDV 600

Query: 601 DIENIIQVKLHPPKISLKLRTA 622
           DIENIIQVKLHPPKISLKLRTA
Sbjct: 601 DIENIIQVKLHPPKISLKLRTA 622

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  216 bits (549), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 138/426 (32%), Positives = 227/426 (53%), Gaps = 29/426 (6%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALF 67
           D F+ YNP++ +F        L I R SD+  I  I VRNI L+ +Y WD   GK+L++F
Sbjct: 7   DYFIDYNPRFPIFA-TRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIF 65

Query: 68  LKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDL 127
            KDG+VRI+DIF  G+L+SFLRV    +          +WDRI + +   SE    N  +
Sbjct: 66  FKDGTVRIHDIFKDGRLVSFLRVPSTKISRG-------IWDRIPLKREYDSETFAYN--V 116

Query: 128 TESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEK---KVVDVHLGYSCSSAQVTILI 184
            + +P L++FV+D+K++ I+P      LWR    ++    +++DVH+ ++  + ++TI  
Sbjct: 117 IDILPKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFF 176

Query: 185 NGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDL 244
           NG+Y I   + DI    ++I  S+ K +  +  Y   ++D S   ++L  +L +   +DL
Sbjct: 177 NGDYTILLPMDDIE--NERILESVVKVQ--DGFYHCFYNDGSVRTLNLQPLLRSKPSVDL 232

Query: 245 IETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIG----GINDLDV-LERLFLIGELD 299
           +   + +      +  H  LI + ++ PY +F++ I     G N L   LE LFL+GE+ 
Sbjct: 233 LHYIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVS 292

Query: 300 TKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGID 359
             L +W   ++ EKNLKKW  LG E Y    Q+L +VFVP CER+++   ++ G ++   
Sbjct: 293 CDLEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFS 352

Query: 360 LQ-ESQETSLLDISEL-----QSFXXXXXXXXXXXXXDETYFKQDFLPWLTDKVYESINN 413
           +Q +S  TS L   EL     Q               +ET F++ F+ W  D+++E ++ 
Sbjct: 353 VQNKSNNTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFI-WFNDRIHEGLDE 411

Query: 414 EYKSVF 419
           +YK  F
Sbjct: 412 DYKLKF 417

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  206 bits (524), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 126/435 (28%), Positives = 226/435 (51%), Gaps = 53/435 (12%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALF 67
           D F+ YNP++ +F        L I R SD+  +  I +RNI L+ +Y WD + GK+L++F
Sbjct: 7   DYFIDYNPRFPIFAT-RTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIF 65

Query: 68  LKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIII-PKSGSSELRIPNND 126
            KDG++RI+DIF  G+L+SFLR+    +           WDRI +  +SG+  L     +
Sbjct: 66  FKDGTIRIHDIFKDGRLVSFLRIPSTKISKGT-------WDRIPLESESGNGNLAY---N 115

Query: 127 LTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIG-----NNEKKVVDVHLGYSCSSAQVT 181
           + + +P L+++V+D+K+I+I+P      LWR        NNEK  +D+H+ ++    ++T
Sbjct: 116 IIDYLPKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEK--LDIHIIFNEGHDKIT 173

Query: 182 ILINGEYLI---------EKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDL 232
           +  NG+Y I         E+ V  I +IQ             +  Y   +DD +   ++L
Sbjct: 174 VFFNGDYAIFVPVGADENERFVKSIVKIQ-------------DGFYHCFYDDGTVRTLNL 220

Query: 233 TGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFL-----ESIGGINDLD 287
             +L ++  +++++  + +      + +H   I + ++ PY EF+     E+ G    + 
Sbjct: 221 GPLLRSEPSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLIS 280

Query: 288 VLERLFLIGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVL 347
            LE LFL+GE+   L +W   ++ EKN K+W  LG E Y    Q+L ++FVP CER+++ 
Sbjct: 281 ELECLFLLGEVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIF 340

Query: 348 TNRINGMIKGIDLQ----ESQETSLLD--ISELQSFXXXXXXXXXXXXXDETYFKQDFLP 401
             ++ G+++   +Q    +S + + +D  +   Q               DET F+  F+ 
Sbjct: 341 VEKLRGILEAFSIQNKFNDSSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFI- 399

Query: 402 WLTDKVYESINNEYK 416
           WL D+++E ++ +YK
Sbjct: 400 WLNDRIHEVLDEDYK 414

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  201 bits (512), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 127/426 (29%), Positives = 219/426 (51%), Gaps = 29/426 (6%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALF 67
           D F+ YNP++ +F +      L I R SD+  +  I VRNI L+ +Y WD   GK+L++F
Sbjct: 3   DYFIDYNPRFPIFAIRV-VKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIF 61

Query: 68  LKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDL 127
            KDG++RI+DIF  G+L+SFLR+        +  +   +WDR  IP    S  R   N++
Sbjct: 62  FKDGTIRIHDIFKDGRLVSFLRI-------PRTKISRGIWDR--IPLKYESSNRNFANNV 112

Query: 128 TESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEK---KVVDVHLGYSCSSAQVTILI 184
            + +P L++FV+D+K++ I P      LWR    ++    + +D+H+ ++  + ++T+  
Sbjct: 113 IDVLPKLIRFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFF 172

Query: 185 NGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDL 244
           NG+Y I   VSDI    +KI  S+ K +     Y   ++D +    +L  +L ++  +DL
Sbjct: 173 NGDYAILLPVSDIE--NEKILKSVVKVQ--NGFYHCFYNDGTVSTFNLERLLQSEPSVDL 228

Query: 245 IETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIG----GINDLDV-LERLFLIGELD 299
           +   + +      +  H   I + +  PY +F++ I     G + L   L+ LFL+GE+ 
Sbjct: 229 LRYMMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVP 288

Query: 300 TKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGID 359
           + L +W    + EKN K+W  LG E Y    QV  + FVP CER+++   ++ G+++   
Sbjct: 289 SDLDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFS 348

Query: 360 LQESQETSL------LDISELQSFXXXXXXXXXXXXXDETYFKQDFLPWLTDKVYESINN 413
           +Q             L + + Q               DET F++ FL W  D+++E ++ 
Sbjct: 349 IQXXXXXXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEK-FLMWFNDRIHEVLDE 407

Query: 414 EYKSVF 419
           +YK  F
Sbjct: 408 DYKPKF 413

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  196 bits (499), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 134/425 (31%), Positives = 220/425 (51%), Gaps = 44/425 (10%)

Query: 13  YNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGS 72
           YNP Y L+   + N  L I R +DN  I  + VR++ +L  + WDPI GK + +F KDG+
Sbjct: 11  YNPLYSLYA-KKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGN 69

Query: 73  VRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIP-NNDLTESM 131
            RIYD F  GKL++ LR+       +K  +D  +WDRI + +    E+    ++ +  SM
Sbjct: 70  ARIYDAFQAGKLLALLRI-------SKTRVDGAIWDRIELSRQ---EVTFKFDHFVLNSM 119

Query: 132 PTLVKFVQDAKQIDIIPNRSITKLWRSIG------NNEKKVVDVHLGYSCSSAQVTILIN 185
           P +++F +D +QI I+P     K WR           EK+++DVHL +   +  V ++++
Sbjct: 120 PKMIRFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLV-LMLD 178

Query: 186 GEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLI 245
           G++++  +        K I ++         +Y   ++D +   + L  ++  D  + LI
Sbjct: 179 GDFILRLAAGPSGPALKDIVVA------DRGLYHCFYEDATVESLSLDQLIQCDATIQLI 232

Query: 246 ET--QIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI-----GGINDLDVLERLFLIGEL 298
           +    IK  NH+  ++DH +LI++ ++APY EFL  I     G     + LE L L G L
Sbjct: 233 QHFIAIKQLNHY--LQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGL 290

Query: 299 DTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGI 358
             +L NWF  T+ EKN KKW ++G E Y    Q+L + F+P CER+++L+ R    +K +
Sbjct: 291 SVELENWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKAL 350

Query: 359 DLQESQETSLLDISEL-------QSFXXXXXXXXXXXXXDETYFKQDFLPWLTDKVYESI 411
            L ES  T+  D SE        Q++              E  F Q FL W  D+++E++
Sbjct: 351 QLIESSTTT--DSSEFANLTSLSQTYLRSTVETIQGVSAQEVLF-QTFLQWFDDRLHEAL 407

Query: 412 NNEYK 416
           + +YK
Sbjct: 408 DEDYK 412

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  194 bits (494), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 128/437 (29%), Positives = 222/437 (50%), Gaps = 51/437 (11%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALF 67
           D F+ YNP + +F        L I R SD+  +  I +RNI L+ +Y WD   GK+L++F
Sbjct: 7   DYFIDYNPLFPIFA-TRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIF 65

Query: 68  LKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRI-PNN- 125
            KDG++RI+DIF  G+L+SFLR+    +          +WDRI         LR  PNN 
Sbjct: 66  FKDGTIRIHDIFKDGRLVSFLRIPSTKISKG-------IWDRI--------PLRYEPNNR 110

Query: 126 ----DLTESMPTLVKFVQDAKQIDIIPNRSITKLWRS-----IGNNEKKVVDVHLGYSCS 176
               ++ + +P L++FV+D+K+I+I+P      LWR      + +NEK  +DVH+ ++  
Sbjct: 111 DFACNIIDDLPKLIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEK--LDVHVVFNEG 168

Query: 177 SAQVTILINGEYLIEKSVSDI---NQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLT 233
           + ++T+  NG+Y +  SV +I   N ++  I +        +  Y+  ++D +   ++L 
Sbjct: 169 NDKITVFFNGDYAVFLSVDNIENENSLKSIIKVQ-------DGFYQCFYEDGTVQTLNLG 221

Query: 234 GILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFL-----ESIGGINDLDV 288
            +L +   ++L+   + +      +  H   I + +  PY +F+     E+ G       
Sbjct: 222 PLLQSKSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSE 281

Query: 289 LERLFLIGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLT 348
           LE LFL+GE+   L +W   ++ EKN K+W  LG E Y    Q+L ++FVP CER+++  
Sbjct: 282 LEALFLLGEISCDLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYV 341

Query: 349 NRINGMIKGIDLQES-QETSLLDISEL-----QSFXXXXXXXXXXXXXDETYFKQDFLPW 402
            ++  +++   +Q     TS L   E+     Q               DET F++ F  W
Sbjct: 342 EKLRAILQAFSIQNKLSYTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEK-FFIW 400

Query: 403 LTDKVYESINNEYKSVF 419
             D+++E+++ +YK  F
Sbjct: 401 FNDRLHEALDEDYKLKF 417

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  189 bits (480), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 129/490 (26%), Positives = 242/490 (49%), Gaps = 40/490 (8%)

Query: 13  YNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGS 72
           YN K  L+   +    L++ R SDN  I    ++   L+   +WD I GKYL++F +DGS
Sbjct: 14  YNKKLPLY-TEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGS 72

Query: 73  VRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMP 132
           +RI D+F  GKL++FLR       +   ++DC  WDR  I +  ++E++  N ++ + MP
Sbjct: 73  IRIIDVFKDGKLVAFLR-------TQFKNVDCTYWDR--IEEQTTNEMKQFNKNIVDLMP 123

Query: 133 TLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKK--VVDVHLGYSCSSAQVTILINGEYLI 190
           +L++FV  A ++ +IP       WR +    KK  V+D+H  +   +    +++NG+Y +
Sbjct: 124 SLIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYL 183

Query: 191 EKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIETQIK 250
                + +  +K    SL K     ++Y+  + D S  +ID +  L +   +DL+E  + 
Sbjct: 184 TLKTPETDLSEKVPACSLIKS--ANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILS 241

Query: 251 MTNHFDLIKDHFNLIEKSVLAPYYEFLESI-----GGINDLDVLERLFLIGELDTKLGNW 305
           + +     ++H +L+E+ ++ PY +FLE I     G    ++ L+  FL+G +  +L +W
Sbjct: 242 LKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDW 301

Query: 306 FKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDLQESQE 365
              ++ +KN+ +W  L ++ Y    ++  I  +  CER+++L+ R  G+I     +   +
Sbjct: 302 LHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGAD 361

Query: 366 --TSLLDISELQSFXXXXXXXXXXXXXDETYFKQD----FLPWLTDKVYESINNEYKSVF 419
             + L +++EL S              +E+  K +    FL WL D+V+E ++++YK   
Sbjct: 362 DNSRLHELNELMS-NLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQL 420

Query: 420 FKAEYGNNKRILNIIKYFEATVIEIDYSLRTHLNKLKDENEKIINL-FQKFSKSSLKTCL 478
              +  N             T  ++  S    L + K ++E I+N    K +   ++  +
Sbjct: 421 SITQNSN-------------TCYKLGKSFEYLLQEGKKDSEDILNFDIIKHTLEKIEANI 467

Query: 479 SEFETKLFEP 488
           S   TK  EP
Sbjct: 468 SRMNTKYIEP 477

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  187 bits (476), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 128/420 (30%), Positives = 210/420 (50%), Gaps = 31/420 (7%)

Query: 10  FLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLK 69
           ++ YNP Y L+ + +      + R +D+  I  I VR++  +  Y WDPI GK+L++F K
Sbjct: 5   YVDYNPVYPLY-VKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYK 63

Query: 70  DGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSS--ELRIPNNDL 127
           DG+VRIYD F  G+L+S LR       SN       +WDRI +  S  +  +  I ++D+
Sbjct: 64  DGTVRIYDGFRSGRLVSLLRA-----SSNGAV--SGIWDRIELLHSEENIKDWSI-DHDV 115

Query: 128 TESMPTLVKFVQDAKQIDIIPNRSITKLWR-SIGNNEKKVVDVHLGYSCSSAQVTILING 186
           TE MP +VKF +D++Q+ ++P    + +WR    ++   ++D H+   C  + ++++ +G
Sbjct: 116 TEMMPKMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHV-IRCHDS-LSVMFDG 173

Query: 187 EYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIE 246
           E+ I   ++        IP  L K    +  Y   + D S  + DL  ++ +   L L++
Sbjct: 174 EFTISIQLA-------AIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLK 226

Query: 247 TQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI--GGINDLDVLER----LFLIGELDT 300
             I M      ++DH  LI++ +L PY EFLE    G     D+L      L L+G++  
Sbjct: 227 NVITMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTP 286

Query: 301 KLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRING-MIKGID 359
           +L +W   ++ EKNLK+W +LG + Y    QVL +  +P CERL+ L  R  G ++    
Sbjct: 287 ELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLSRQL 346

Query: 360 LQESQETSLLDISELQSFXXXXXXXXXXXXXDETYFKQDFLPWLTDKVYESINNEYKSVF 419
             +      +D   LQ F              +      FL W  D+V ESI+ +YK  F
Sbjct: 347 TLQLPLLPPIDC--LQFFLKNVLEAIASLSSQQRLLGS-FLDWFDDRVRESIDEDYKLRF 403

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  189 bits (479), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 119/376 (31%), Positives = 193/376 (51%), Gaps = 32/376 (8%)

Query: 10  FLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLK 69
           + K NP Y L+    D   L I   SD+  +  I +++  L++D+FWD I GK+L     
Sbjct: 11  YYKLNPIYQLYTFKSD-KGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFN 69

Query: 70  DGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTE 129
           DGS+R+YDIF  G+L+SF R       S    + C  WDRIII ++   +L+I + DLT 
Sbjct: 70  DGSIRVYDIFKLGRLVSFFR-------SPLKQIKCVYWDRIIITETLDQQLKIFDYDLTN 122

Query: 130 SMPTLVKFVQDAKQIDIIPNRSITKLWRSIG-------NNEKK------VVDVHLGYSCS 176
           SMPTLVKFV+D + + ++P    T+ WR I         N K       V+D+HL Y+ S
Sbjct: 123 SMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTES 182

Query: 177 SA-QVTILINGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGI 235
                 +L+NG Y     +SDI+   +     +   +  +  Y   +++ S   ID+T  
Sbjct: 183 GMDNFAVLVNGVY----DLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPF 238

Query: 236 LLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI------GGINDLDVL 289
             ND +++L+   I + N   L+K+   +I+K +++P+  F+  +      G  N    +
Sbjct: 239 SSNDIRVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSM 298

Query: 290 ERLFLIGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTN 349
             L L GE+  +  +W   TI E+NL+KW  LG E      Q+L ++F+PI E+ ++   
Sbjct: 299 TNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAE 358

Query: 350 RINGMIKGIDLQESQE 365
           RI   I  + L ++ +
Sbjct: 359 RIQNYITAMRLSDNSK 374

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  179 bits (453), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/425 (26%), Positives = 217/425 (51%), Gaps = 31/425 (7%)

Query: 10  FLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLK 69
           + KYNP + L+    D   L + R  D+  +  I +++   +  Y WD   G+++++FL 
Sbjct: 11  YSKYNPCFQLYVTRSD-QGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLT 69

Query: 70  DGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTE 129
           DG++RIYDIF  G+L+S++R       S++ ++D CLWDR     S  S+L++ ++++ E
Sbjct: 70  DGTIRIYDIFKNGRLVSYIR------SSSQKNVDSCLWDRAEF--SIPSKLQLFDSNIIE 121

Query: 130 SMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNE---------KKVVDVHLGYSCSSAQV 180
            +PTL+KFV+D++ I+II        WR +             + ++DVH+ ++ +    
Sbjct: 122 CLPTLIKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNF 181

Query: 181 TILINGEYLIEKSV-SDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLND 239
           TI++NG Y I   V  DI++ +    + L+  E+       H+      +I+   +L  +
Sbjct: 182 TIILNGVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYR-----KINFNNLLSCN 236

Query: 240 DKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI------GGINDL-DVLERL 292
               L+   +++ N    + DH +LI++ ++ PY +F++ I      GG+  L D LE L
Sbjct: 237 VSNGLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESL 296

Query: 293 FLIGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRIN 352
            L GE++ +  +W    I ++N KKW +LG + +    ++L +  +P CER M+   R +
Sbjct: 297 LLTGEINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTD 356

Query: 353 GMIKGIDLQESQETSLLDISELQSFXXXXXXXXXXXXXDETYFKQDFLPWLTDKVYESIN 412
           G + G    ++    ++ + E  S              ++  + + F  W+ DK+ E  +
Sbjct: 357 GYLNGYMKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITD 416

Query: 413 NEYKS 417
            +YK+
Sbjct: 417 EDYKN 421

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  164 bits (414), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 111/412 (26%), Positives = 191/412 (46%), Gaps = 27/412 (6%)

Query: 29  LVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGSVRIYDIFNGGKLISFL 88
           LV+ R +D+  I    +R+   ++ Y WD I G+ +++  +DGS+RI D+    KL++ L
Sbjct: 30  LVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIRINDVMYDAKLVALL 89

Query: 89  RVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMPTLVKFVQDAKQIDIIP 148
           R       + +  LDC LWDRI +P    S    P+  +T+S+P LVKF+       + P
Sbjct: 90  R-------TQRTGLDCVLWDRIRLPSRAQSMEWDPDI-ITQSLPRLVKFMGSDASPSMSP 141

Query: 149 NRSITKLWRSIGNNEKK-VVDVHLGYSCSSAQVTILINGEY---LIEKSVSDINQIQKKI 204
                  WR   +     ++DVH  +      +  L+NGEY   L      D ++++K I
Sbjct: 142 YLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQSELRKII 201

Query: 205 PISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNL 264
             + +K+     +Y  ++      Q+DLTG + + D + L+E  +   ++      H   
Sbjct: 202 ARTDSKRH----VYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEP 257

Query: 265 IEKSVLAPYYEFLE-----SIGGINDLDVLERLFLIGELDTKLGNWFKETINEKNLKKWS 319
           I+   + PY EF+E     + G     + L   FL+G +D +L +W   ++ E+NL++W 
Sbjct: 258 IQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLGERNLEEWK 317

Query: 320 RLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDLQESQETSLLDISELQSFXX 379
            L N  Y    QV+++  VP+ ERL++L  ++  ++    L E      L+ISE      
Sbjct: 318 SLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEISEFTDLLE 377

Query: 380 XXXXXXXXXXXDETYFKQD------FLPWLTDKVYESINNEYKSVFFKAEYG 425
                            +D      FL WL + +  +IN +Y   F  +E G
Sbjct: 378 NCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSECG 429

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  155 bits (393), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 113/423 (26%), Positives = 201/423 (47%), Gaps = 29/423 (6%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALF 67
           +  + YNP Y    + + ++   +RRT D+  IVKI +RN+  ++   W+     YL + 
Sbjct: 6   EELVSYNPSYPA-KLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVM 64

Query: 68  LKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRI-IIPKSGSSELRIPNND 126
             DGS RI+DIF  GKL++ LR+     G  K  +D  +W ++ +  K    E    + D
Sbjct: 65  FNDGSARIHDIFREGKLMTLLRLQD---GFQK-CMDTGIWSKLEVRQKPNEGEF---DRD 117

Query: 127 LTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGN--NEKKVVDVHLGYSCSSAQVTILI 184
           ++  MP+ +KFV +A Q++++P       WR++        ++D+H+ ++ ++ +  ++I
Sbjct: 118 ISGLMPSPIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMI 177

Query: 185 NGEY--LIEKSVSD---INQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLND 239
           NG Y   I+ + +D    NQ+ K I +         AI+   + D     IDLT ++ + 
Sbjct: 178 NGVYKLTIQPNSTDENASNQLHKIIHLEKT------AIFHCFYKDRKTSTIDLTTLMEST 231

Query: 240 DKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLE--SIGGINDLD-VLERLFLIG 296
             + L+    +M      I DH ++I+  +  P  +FLE  +I  I DL   L+   L G
Sbjct: 232 PHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNILNIKDLSKSLKSFILYG 291

Query: 297 ELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIK 356
            +   L +W    + EKNLKKW RL    Y    Q++ +  +P  E+L +L+ R   ++ 
Sbjct: 292 LMAKSLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVV 351

Query: 357 GIDLQES---QETSLLD-ISELQSFXXXXXXXXXXXXXDETYFKQDFLPWLTDKVYESIN 412
            I L  S   QE    D +    +              +E      F+ W+ D ++E ++
Sbjct: 352 AIALPASGHMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVD 411

Query: 413 NEY 415
            +Y
Sbjct: 412 EDY 414

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  143 bits (360), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 114/386 (29%), Positives = 192/386 (49%), Gaps = 44/386 (11%)

Query: 14  NPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGSV 73
           NP + L+ + + ++S++ RRT D   I  I +RN+  ++   WD   GKYL +   DG+ 
Sbjct: 28  NPSFPLY-LTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTF 86

Query: 74  RIYDIFNGGKLISFLRVLPVVLG-SNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMP 132
           RIYDIF  GKLI+ +R    +L    K  +D  +WDR+II  S   EL   N+D+T+ MP
Sbjct: 87  RIYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNS-IQELEF-NHDITKLMP 144

Query: 133 TLVKFVQDAKQIDIIPNRSITK--LWRS------------------IGNNEK-----KVV 167
           TL+KFV+D+  I I+P     K  +WR                   +  N++     + +
Sbjct: 145 TLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYL 204

Query: 168 DVHLGYSCSSAQVTILINGEY---LIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDD 224
           D+H+ +       TI ING Y   L+ K+++  N+   KI   L  K     +Y    ++
Sbjct: 205 DLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNR--NKIVRIL--KSTVHGVYHCFHEN 260

Query: 225 YSRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFL------- 277
            S   +  +    +   ++L+E  +++       + H +LI K +L  + +FL       
Sbjct: 261 GSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEE 320

Query: 278 -ESIGGINDLDVLERLFLIGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIV 336
            ++ GG + L  L+   L GE+  +L  W   +I EKNLKKW RL  E YS   Q+  + 
Sbjct: 321 KQNGGGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLA 380

Query: 337 FVPICERLMVLTNRINGMIKGIDLQE 362
            +P CE  ++L+ +   ++  I++++
Sbjct: 381 LIPACELTLLLSQKCLAILNAIEIEK 406

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 113/450 (25%), Positives = 203/450 (45%), Gaps = 44/450 (9%)

Query: 12  KYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDG 71
           K NP   L     D+   VIR T+D   I+   +RN   ++ Y W+   G Y+A+F + G
Sbjct: 11  KSNPTLPLTLCKSDSGLKVIR-TADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRG 69

Query: 72  SVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESM 131
           +V IYD     +L++       +L   KP++D  +WDR   P    +E  I ++D+T  M
Sbjct: 70  TVMIYDGIKTSRLLA-------MLNGGKPNVDAGIWDRYYFPND--NEKDIFDSDITLYM 120

Query: 132 PTLVKFVQDAKQI---DIIPNRSITKLWRSIGNNEKK--VVDVHLGYSCSSAQVTILING 186
           PTL++ ++D ++I      P  S    WR+      K   +D+HL +       T ++NG
Sbjct: 121 PTLIQIIRDKEKICPGTYFPPHST---WRAKKEESLKNEFLDIHLLHHSVDDSFTFILNG 177

Query: 187 EYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIE 246
           E  +    +  +     I    N    C       + D +   ID   +L       L++
Sbjct: 178 ELKLPFPSNSTSGRAIGIIKGENNCFIC------FYQDLTVRMIDCHDLLQLKGNEILVD 231

Query: 247 TQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLDVLER----LFLIGELDTKL 302
             I++ +    +K+H   I+ ++  P+ EFL S+ G    +++      + + G + T+L
Sbjct: 232 HFIRINHLLKYLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTEL 291

Query: 303 GNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMI------- 355
             W + TI  KNL +W+ LG  FY     ++ ++ +P CER M+L  R+ G+I       
Sbjct: 292 EEWIRNTIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRN 351

Query: 356 ----KGIDLQESQETSLLDISELQSFXXXXXXXXXXXXXDETYFKQDFLPWLTDKVYESI 411
               +G++L  S   ++   +  + F              +  F++ FL W ++ V   +
Sbjct: 352 RCDNRGVNLNSSYIENVKHAA--KRFMKEALRMLEQLQLQKQLFEK-FLHWFSENVRGVV 408

Query: 412 NNEYKSVFFKAEYGNNKRILNIIKYFEATV 441
            +E  S     +  NN R  +I++Y E ++
Sbjct: 409 QDEAVSGNILVKNVNNCR--DIVEYLEWSM 436

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  123 bits (309), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 108/481 (22%), Positives = 222/481 (46%), Gaps = 45/481 (9%)

Query: 13  YNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGS 72
           +NP   LF +      + + R  D   I  ++V++   ++DY W+  +G+  A+   +G 
Sbjct: 20  WNPVLSLF-LVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGI 78

Query: 73  VRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMP 132
           +R+YD    GK +       V+LG +   +    W +      GS    + ++++T  MP
Sbjct: 79  IRLYDSSLAGKSVG-----SVILGDSDCDVLKFCWSQDSW-TFGSKFSNVFDHEITSLMP 132

Query: 133 TLVKFVQDAKQIDIIPN--RSITKLWRSIGNNEKKVVDVHLGYSCSSAQVTILINGEYLI 190
            LVKFV+D++Q+ ++P         W  +  N+  +    LGY     ++ + I+G + +
Sbjct: 133 RLVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIF---LGYDSKRQKILMAIDGAFKL 189

Query: 191 EKSVSDINQIQKKI----PISLNKKEFCE---AIYEIHFDDYSRLQIDLTGILLNDDKLD 243
             SV+ +    +++     +  N ++  +     Y +  DD+   +I    +  N  + +
Sbjct: 190 SFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDFLNCNLTR-E 248

Query: 244 LIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLDV---LERLFLIGELDT 300
           +I    ++ +    + +  +L++  ++ PY +F+E + G  + D+   L  L   G +  
Sbjct: 249 MISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLIGDLTELLFTGSVPP 308

Query: 301 KLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKG--- 357
           +L +W   TI +KNL++W +L +  Y N  +++++  VP+CERL++   R++G+IKG   
Sbjct: 309 ELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGIIKGLKL 368

Query: 358 IDLQESQETSLLDISELQSFXXXXXXXXXXXXXD------ETYFKQDFLPWLTDKVYESI 411
           I L+E ++   L++ E Q                      ++   + F+ W  D V E++
Sbjct: 369 IGLKELEDN--LEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAV 426

Query: 412 NNEYKSVFFKAEYGNNKRILNIIKYFEATVIEI------DYSLRTHLNKLKDENEKIINL 465
           + +YK    K  Y  N   L I ++   ++  +       YS     N+L  + E +  L
Sbjct: 427 DEDYKR---KTSY--NCDPLKIQQFMSGSLTGVHTYEWCQYSFPAVTNRLGKQFETVEQL 481

Query: 466 F 466
           +
Sbjct: 482 Y 482

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  115 bits (288), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 98/420 (23%), Positives = 189/420 (45%), Gaps = 26/420 (6%)

Query: 9   RFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFL 68
           R + +NP+  L+ +  D  ++ + R  D   I  +N+R    L+   W+  +GK  ALF 
Sbjct: 17  RGVVWNPRLSLYLVLGDK-TVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFF 75

Query: 69  KDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLT 128
            +G+VRIYD   GG L   + ++     ++  ++D  +W      +    E +  N ++T
Sbjct: 76  GNGAVRIYDCATGGSLREVVDLVDEGQSADV-TVDTAVWSGAQWAQF-RQEYKGLNIEIT 133

Query: 129 ESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKKVVDVHLGYSCSSAQVTILINGEY 188
           + +P +V+ V+DAKQ+ ++P  +    W +   +  K   + LG+   S    + ++G  
Sbjct: 134 KQLPGMVRLVRDAKQLSVVPLETGKLRWLA---DPGKDAAIFLGHDEKSGDYLMTVDG-L 189

Query: 189 LIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIETQ 248
           L  +  S I ++ K +      ++  +  + +       +Q  +   L +    +LI   
Sbjct: 190 LSVRVPSGIKKMHKIL------RQGEDGTF-VGVGADGTVQWVVLRFLNSALMRELIRYS 242

Query: 249 IKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLDVLERLF----LIGELDTKLGN 304
            ++      + ++ N+ +  ++ PY +FL  I    +   L   F    L G +   L +
Sbjct: 243 GQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDLED 302

Query: 305 WFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDLQE-- 362
           W   +I +KN K+W +L    Y +   VL +  +P CERL++   ++ G+ KG+ LQE  
Sbjct: 303 WLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFG 362

Query: 363 ---SQETSLLDISELQSFXXXXXXXXXXXXXD---ETYFKQDFLPWLTDKVYESINNEYK 416
               QE    +++EL +              D   +T     F  W  D V E+++ +YK
Sbjct: 363 LASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYK 422

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 180/417 (43%), Gaps = 28/417 (6%)

Query: 13  YNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGS 72
           +NP+  L+ +  D   + + R  D   I  +N+R+   ++   W+  + K  A+F  +G 
Sbjct: 21  WNPRLSLYLVLTDK-KIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGV 79

Query: 73  VRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMP 132
           VRIYD   GG L   + ++     +    +D  +W  +   K   S  R  + D+T  MP
Sbjct: 80  VRIYDCSIGGSLREMVNLVEEGQAAEV-KVDAVVWMTVEWAKFPES-YRGLDFDITTLMP 137

Query: 133 TLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKKVVDVHLGYSCSSAQVTILINGEYLIEK 192
            +V+ V+D+KQ+ + P   + KL  S  + +     + L + C S +  + I+G+ L  +
Sbjct: 138 GMVRLVRDSKQLSLAP-LDLGKL--SWLDGKYGDAAIFLAHDCESTEYMVAIDGQ-LSLR 193

Query: 193 SVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIETQIKMT 252
             S I  + K +P       F      +       LQ      L      +L+++  ++ 
Sbjct: 194 FPSGIRNVHKILPQG-GSGSF------LAVGKDGTLQWVTLKFLECALMRELVKSSGQIR 246

Query: 253 NHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLD----VLERLFLIGELDTKLGNWFKE 308
                + ++ +L    ++ PY  FL  + G  + D     L  + L G +   L  W   
Sbjct: 247 FLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDLEEWLCN 306

Query: 309 TINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDLQE-----S 363
           ++ +KN K+W +L    Y +   VL +  VP CERL++   R+ G+ K + LQ      +
Sbjct: 307 SVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYA 366

Query: 364 QETSLLD----ISELQSFXXXXXXXXXXXXXDETYFKQDFLPWLTDKVYESINNEYK 416
            E + ++    ISE Q+              D     Q F  W  D V E+++ +YK
Sbjct: 367 GELTTVELQTLISECQTLLEFTLNLITELNRDAA-LHQVFAEWFYDVVMETVDEDYK 422

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 77/383 (20%), Positives = 169/383 (44%), Gaps = 50/383 (13%)

Query: 4   DIVLDRFLKYNPKYGLFGMNEDNHSLVIRRT-SDNVGIVKINVRNIVLLLDYFWDPIDGK 62
           D ++D F  +N +  L+G++E  +  + R      +G + + +++   +L    +P DG 
Sbjct: 13  DGLVDPF--WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGD 70

Query: 63  YLALFLKDGSVRIY---------DIFNGGKLISFLRVLPVVLGSNKP-SLDCCLWDRIII 112
             A+ L+ GSV++Y         D  +G  ++       +VLG  +  +++  +W+RI  
Sbjct: 71  LFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVG-----TIVLGRGEWFNMEQFVWNRIKW 125

Query: 113 PKSGSSELRIPNNDLTESMPTLVKF-VQDAKQIDIIPNRSITKLWR-SIGNNEKKVVDVH 170
              G+ +    +  LT+ +P L +  V    ++   P       W  S+  NE    ++ 
Sbjct: 126 KSRGAFKGDF-DTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENES---NMF 181

Query: 171 LGYSCSSAQVTILINGEY--------LIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHF 222
           L Y  ++ +V + I+G +             V++I        + LN +++   I ++ F
Sbjct: 182 LTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLEF 241

Query: 223 DDYSRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI-- 280
            +  ++              +L++   ++      ++D+  +I   ++ P+  F+ S+  
Sbjct: 242 TESHQMH-------------ELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFP 288

Query: 281 --GGINDLDVLERLFLIG-ELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVF 337
                  L  L+ +F +G   +  + NWF   +    +  W +  + F+S+ + +L+   
Sbjct: 289 DEQASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCM 348

Query: 338 VPICERLMVLTNRINGMIKGIDL 360
           +P CERL+V   R+ G+IK + L
Sbjct: 349 IPACERLIVAVKRLQGLIKSLKL 371

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 85/380 (22%), Positives = 165/380 (43%), Gaps = 60/380 (15%)

Query: 13  YNPKYGLFGMNEDNHSLVIRRTSDN--VGIVKINVRNIVLLLDYFWDPIDGKYLALFLKD 70
           +N +  L+G+ E    L I R  D   VG + + +R    LL   W+P DG+  A+ L+ 
Sbjct: 20  WNDRLSLWGVLE-KEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRS 78

Query: 71  GSVRIY---------DIFNGGKLISFLRVLPVVLGSNKP-SLDCCLWDRIIIPKSGSSEL 120
           GSV+IY         +   G +L+       VVLG      ++  +W+RI         +
Sbjct: 79  GSVKIYRGRLDPEGTEGSEGAELVG-----TVVLGRGDAFQMEQFVWNRI------KWRV 127

Query: 121 RIP-----NNDLTESMPTLVKFVQDAK-QIDIIPNRSITKLWRS-IGNNEKKVVDVHLGY 173
           R P     ++ L + +P L +    A+ ++   P       W + +  +E    ++ L +
Sbjct: 128 REPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADES---NMFLTF 184

Query: 174 SCSSAQVTILINGEYLI---EKS-----VSDINQIQKKIPISLNKKEFCEAIYEIHFDDY 225
             ++ +V + I+G +     EKS     V+ I    +   + +N +++   +  + F +Y
Sbjct: 185 DNNTRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLEFTEY 244

Query: 226 SRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGIND 285
            ++              +L++    +      I+D+  LI   ++ P+  F  S+     
Sbjct: 245 HQVH-------------ELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ 291

Query: 286 ----LDVLERLFLIGELDTK-LGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPI 340
               +  L+ +F +G  D K + NWF   +       W +  + F+S+ + VL+   +P 
Sbjct: 292 FTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPA 351

Query: 341 CERLMVLTNRINGMIKGIDL 360
           CERL+V   R+ G++K + L
Sbjct: 352 CERLIVSAKRLLGLVKSLKL 371

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 130/314 (41%), Gaps = 37/314 (11%)

Query: 51  LLDYFWDPIDGKYLALFLKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRI 110
           L+D  W    G  L      G+V IY    G +L+  L  +P           C L D +
Sbjct: 61  LIDVVWH---GNDLFCCYNSGTVSIYR--EGRELVKQLTFIP-----KGAKTKCILCDNL 110

Query: 111 IIPKSGSSELRIPNNDLTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKKVVDVH 170
           +          + + +L  SMP L K+       D+I N    +L  +    +KK +D+ 
Sbjct: 111 V---PSDDRYSLSDGNLLNSMPKLNKW-------DMIKNELDNELILNSELGKKKPIDIF 160

Query: 171 LGYSCSSAQVTILINGEYLIE-----KSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDY 225
           +     + ++ + I G   I+     K   DI +I   I +S  K       Y     D+
Sbjct: 161 MAIDSKTNKLILSIEGTLNIKVGEKLKLPKDIKRI---IKVSSGK-------YMCLGKDW 210

Query: 226 SRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGIND 285
           S   +DLT  L + +   LI+T  + +     +K     +   +  PY+EF+E++     
Sbjct: 211 SYQVLDLT-FLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEH 269

Query: 286 LDVLERLFLIGELDTKLGNWFKET-INEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERL 344
            + L+ LF IG    ++     E  +    L KWS L N+  SN   +++   +P+ ER+
Sbjct: 270 KNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERM 329

Query: 345 MVLTNRINGMIKGI 358
           +VL   I  + + I
Sbjct: 330 IVLAASIEALCEAI 343

>Skud_16.245 Chr16 (447878..450721) [2844 bp, 947 aa] {ON} YPL036W
           (REAL)
          Length = 947

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID-GKYLAL 66
           D   K   KYGL  M E+N SL+I+     VG ++  +    +L     D +D G   AL
Sbjct: 120 DEVAKRRKKYGLNQMAEENESLIIKFLMFFVGPIQFVMEAAAILAAGLSDWVDFGVICAL 179

Query: 67  FLKDGSVRIYDIFNGGKLISFLR 89
            L + SV     F  G ++  L+
Sbjct: 180 LLLNASVGFIQEFQAGSIVDELK 202

>KNAG0D03500 Chr4 (635954..638659) [2706 bp, 901 aa] {ON} Anc_4.115
           YGL008C
          Length = 901

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID-GKYLAL 66
           D   K   KYGL  MNE+N SLV++     +G ++  +    +L     D +D G    L
Sbjct: 73  DEVAKRRKKYGLNQMNEENESLVVKFLMFFIGPIQFVMEAAAILAAGLSDWVDFGVICGL 132

Query: 67  FLKDGSVRIYDIFNGGKLISFLR 89
            + + SV     F  G ++  L+
Sbjct: 133 LMLNASVGFIQEFQAGSIVDELK 155

>Suva_16.280 Chr16 (486077..488881) [2805 bp, 934 aa] {ON} YPL036W
           (REAL)
          Length = 934

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 1/86 (1%)

Query: 5   IVLDRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID-GKY 63
           +  D   +   KYGL  M E+N SLV++     VG ++  +    +L     D +D G  
Sbjct: 104 LTADEVTRRRKKYGLNQMAENNESLVVKFIMFFVGPIQFVMEAAAILAAGLSDWVDFGVI 163

Query: 64  LALFLKDGSVRIYDIFNGGKLISFLR 89
            AL L + SV     F  G ++  L+
Sbjct: 164 CALLLLNASVGFIQEFQAGSIVEELK 189

>NDAI0D03520 Chr4 (831794..834523) [2730 bp, 909 aa] {ON} Anc_4.115
          Length = 909

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 5   IVLDRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID-GKY 63
           +  D   +   KYGL  M+EDN SLV++     VG ++  +    +L     D +D G  
Sbjct: 78  LTADEVSRRRKKYGLNQMSEDNESLVVKFVMFFVGPIQFVMEAAAILAAGLSDWVDFGVI 137

Query: 64  LALFLKDGSVRIYDIFNGGKLISFLR 89
             L L +  V     F  G ++  L+
Sbjct: 138 CGLLLLNAGVGFVQEFQAGSIVEELK 163

>YPL036W Chr16 (482843..485686) [2844 bp, 947 aa] {ON}  PMA2Plasma
           membrane H+-ATPase, isoform of Pma1p, involved in
           pumping protons out of the cell; regulator of
           cytoplasmic pH and plasma membrane potential
          Length = 947

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID-GKYLAL 66
           D   +   KYGL  M E+N SL+++     VG ++  +    +L     D +D G   AL
Sbjct: 120 DEVARRRKKYGLNQMAEENESLIVKFLMFFVGPIQFVMEAAAILAAGLSDWVDVGVICAL 179

Query: 67  FLKDGSVRIYDIFNGGKLISFLR 89
            L + SV     F  G ++  L+
Sbjct: 180 LLLNASVGFIQEFQAGSIVDELK 202

>Suva_7.273 Chr7 complement(471202..473952) [2751 bp, 916 aa] {ON}
           YGL008C (REAL)
          Length = 916

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID-GKYLAL 66
           D  LK   KYGL  M E+N SL+I+     VG ++  +    +L     D +D G    L
Sbjct: 89  DEVLKRRKKYGLNQMAENNESLIIKFIMFFVGPIQFVMEAAAILAAGLSDWVDFGVICGL 148

Query: 67  FLKDGSVRIYDIFNGGKLISFLR 89
            + +  V     F  G ++  L+
Sbjct: 149 LMLNAGVGFIQEFQAGSIVEELK 171

>NDAI0B02650 Chr2 (657989..660778) [2790 bp, 929 aa] {ON} 
          Length = 929

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID-GKYLAL 66
           D  LK   KYGL  M+E++ +L+++     VG ++  +    +L     D +D G    L
Sbjct: 101 DEVLKRRKKYGLNQMSEESENLIVKFLMFFVGPIQFVMEAAAILAAGLSDWVDFGVICGL 160

Query: 67  FLKDGSVRIYDIFNGGKLISFLR 89
            L + SV     F  G +++ L+
Sbjct: 161 LLLNASVGFIQEFQAGSIVAELK 183

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
           (REAL)
          Length = 523

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 146 IIPNRSITKLWRSIGNNEKKVVDVHLGYSCSSAQVTILINGE 187
           ++P RS  KL + + N+E ++++   GYSC   QV  ++N E
Sbjct: 255 MVPQRSSEKLMKILANDETEIIE---GYSCLICQVRAILNHE 293

>KNAG0K00990 Chr11 complement(194211..195521) [1311 bp, 436 aa] {ON}
           Anc_3.140 YGR072W
          Length = 436

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 194 VSDINQIQKKIPISLNKKEFCEAIYE---IHFDDYSRLQ---IDLTGILLNDDKLDLIET 247
           +SDI  +Q    +    K F E I+     HFDD   L+   + L GI+L DD+ + ++ 
Sbjct: 148 ISDIYYVQGHYSV----KAFNEPIFSRCYFHFDDMENLKAFVMKLQGIMLVDDRDNAVKP 203

Query: 248 QIKMTNHFDLIKD 260
            IK+T +   + D
Sbjct: 204 TIKLTPYAKKLSD 216

>NCAS0A06540 Chr1 (1292273..1295014) [2742 bp, 913 aa] {ON}
           Anc_4.115
          Length = 913

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPID-GKYLAL 66
           D   +   KYGL  M+E+N SLV++     VG ++  +    +L     D +D G    L
Sbjct: 86  DEVARRRKKYGLNQMSEENESLVVKFIMFFVGPIQFVMEAAAILAAGLSDWVDFGVICGL 145

Query: 67  FLKDGSVRIYDIFNGGKLISFLR 89
            L +  V     F  G ++  L+
Sbjct: 146 LLLNAGVGFVQEFQAGSIVEELK 168

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%)

Query: 300 TKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLM 345
           T  G      + + ++ +   L N+F+     + IIVF+P+CE L+
Sbjct: 356 TCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLL 401

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.140    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,144,826
Number of extensions: 3257819
Number of successful extensions: 11523
Number of sequences better than 10.0: 92
Number of HSP's gapped: 11862
Number of HSP's successfully gapped: 95
Length of query: 622
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 506
Effective length of database: 40,180,143
Effective search space: 20331152358
Effective search space used: 20331152358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)