Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B01837g8.269ON56955926750.0
Suva_2.2768.269ON56556315690.0
NCAS0B038008.269ON56556215520.0
Skud_4.3778.269ON56256515050.0
YDR117C (TMA64)8.269ON56556315000.0
Smik_4.3618.269ON56556314690.0
TDEL0F039608.269ON55855914450.0
ZYRO0C01496g8.269ON56756414290.0
KAFR0B054708.269ON56256613750.0
TPHA0J007808.269ON58356713690.0
NDAI0J013108.269ON57957813610.0
KLTH0G13530g8.269ON57457713520.0
Kwal_56.237718.269ON56257613171e-176
SAKL0H16874g8.269ON56356312781e-170
Kpol_392.28.269ON56656412411e-165
KNAG0H032008.269ON56157111611e-153
Ecym_43018.269ON56456611451e-150
TBLA0I032008.269ON56356210871e-142
KLLA0F19294g8.269ON57056910821e-141
AGR079W8.269ON5425599681e-124
SAKL0G14344g5.144ON19197780.35
ZYRO0D09636g7.152ON181184731.3
KAFR0E019305.144ON20097722.4
Kpol_1050.295.144ON20697722.5
NDAI0C029205.144ON20297712.9
Suva_13.4845.32ON37534705.7
CAGL0B03927g5.144ON19677686.0
CAGL0I06358g1.127ON1981113706.7
CAGL0E00451g6.373ON209044706.7
NCAS0D017705.144ON19775687.1
KNAG0M013405.144ON202105679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B01837g
         (569 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...  1035   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   608   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   602   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   584   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   582   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   570   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   561   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   555   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   534   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   531   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   528   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   525   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   511   e-176
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   496   e-170
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   482   e-165
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   451   e-153
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   445   e-150
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   423   e-142
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   421   e-141
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   377   e-124
SAKL0G14344g Chr7 (1238204..1238779) [576 bp, 191 aa] {ON} highl...    35   0.35 
ZYRO0D09636g Chr4 complement(819030..819564,819630..819640) [546...    33   1.3  
KAFR0E01930 Chr5 (390365..390967) [603 bp, 200 aa] {ON} Anc_5.14...    32   2.4  
Kpol_1050.29 s1050 (69445..70065) [621 bp, 206 aa] {ON} (69445.....    32   2.5  
NDAI0C02920 Chr3 complement(670916..671524) [609 bp, 202 aa] {ON...    32   2.9  
Suva_13.484 Chr13 (838813..839940) [1128 bp, 375 aa] {ON} YMR294...    32   5.7  
CAGL0B03927g Chr2 (386875..387465) [591 bp, 196 aa] {ON} highly ...    31   6.0  
CAGL0I06358g Chr9 complement(608945..614890) [5946 bp, 1981 aa] ...    32   6.7  
CAGL0E00451g Chr5 complement(37236..43508) [6273 bp, 2090 aa] {O...    32   6.7  
NCAS0D01770 Chr4 complement(331343..331936) [594 bp, 197 aa] {ON...    31   7.1  
KNAG0M01340 Chr13 complement(241640..242248) [609 bp, 202 aa] {O...    30   9.0  

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/559 (91%), Positives = 512/559 (91%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
           GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240
           EEPPA                ADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240

Query: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300
           YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH
Sbjct: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300

Query: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIKIVTL 360
           FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIKIVTL
Sbjct: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIKIVTL 360

Query: 361 YKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXXMTMIY 420
           YKPINLAKDFISSNKVPLKQLYMEPEIKELINKYIT                   MTMIY
Sbjct: 361 YKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDMLMTMIY 420

Query: 421 KKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKINIVT 480
           KKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKINIVT
Sbjct: 421 KKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKINIVT 480

Query: 481 EMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQGPHGQ 540
           EMKIGRKVITKVSNFEVFQIDPEEFAADIRKKC            AKKTAEVQVQGPHGQ
Sbjct: 481 EMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQGPHGQ 540

Query: 541 LIMSYLNDLGIPNKWIDFE 559
           LIMSYLNDLGIPNKWIDFE
Sbjct: 541 LIMSYLNDLGIPNKWIDFE 559

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/563 (53%), Positives = 389/563 (69%), Gaps = 11/563 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKKEPHIKALSNLKNSERKKL + C+ QT+NEEY+F ++TIKQTNF G  ++GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PI FKEKH+E+L+PTV +CW    L+P+VLTH  V+E+H+FNGANLMISG+IPPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           R  +GT+CG+A ++ P +++AVGIV+M+LPS++RVIGETGVAV+IVHH  D L K FKVK
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240
            EPPA                      +T  ++  + ++   N++++AEVLD L + D+D
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300
           YFITRALYYT++QD  L  P SASNF+SNHI  NLP   +  EVN+K++SWKK+AKFLKH
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPP-IDHNEVNVKRTSWKKSAKFLKH 299

Query: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT----TIK 356
           FEKEGFLKLKG GDDLTIV  N DKDE+K F+PY +  N  +    E  N+K      + 
Sbjct: 300 FEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMY 359

Query: 357 IVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXXM 416
            +TLYKP NLAKD +    +P +  Y   +I+  I +YI+                    
Sbjct: 360 SLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLY 419

Query: 417 TMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKI 476
            M+ KKK+D    +RVIPRA IL P+L NNF + Y +++   N+ T L++TP+KG PP+I
Sbjct: 420 NMVNKKKKDPDV-ARVIPRAQILDPLLANNFTEFYQIYK---NDDTLLSRTPMKGSPPRI 475

Query: 477 NIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQG 536
            I+TEMKIGRKVITKVSNFE  QIDPE  AAD+RK C              K+AEVQVQG
Sbjct: 476 KIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF--KSAEVQVQG 533

Query: 537 PHGQLIMSYLNDLGIPNKWIDFE 559
           PHGQLI+ +LN  G+PNKWIDFE
Sbjct: 534 PHGQLIIDHLNKSGVPNKWIDFE 556

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/562 (54%), Positives = 387/562 (68%), Gaps = 10/562 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MF+KEPHIKALSNLKNS+RKKL +    QT N++Y+  S  +KQTNF+  TTIGTIYTDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PIWFKEKHD +LY TV  CW C +L+P+ L+H  V+++ +FNGANLMISGTIPPFDE
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RLTVGTVCGIADKRTPNLIV-AVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKV 179
           +L VGT+CG+A  + P  +V A+GIV M+LP F +V+GE+GVAVQI+HH EDELFK FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KEEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDI 239
             +PP                     E   + +  +      +N++D+AEVLD L ++D+
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQDV 239

Query: 240 DYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLK 299
           DYFITRALYYTI+ DTKL  P SASNF+S HIN NLP   +  EVNIKKSSWKKTAKFLK
Sbjct: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPD-VDHNEVNIKKSSWKKTAKFLK 298

Query: 300 HFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGS--EGGNAKTTIKI 357
           HFEKEGFLKLKG GDDLT+V +NK KDE+K F+PY +  + G N G+  EG +    +  
Sbjct: 299 HFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYS 358

Query: 358 VTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXXMT 417
           +T YKPINLAKD I  + +P+K LY+  EI++ +N YIT                     
Sbjct: 359 ITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFG 418

Query: 418 MIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKIN 477
           M+ KK+ D  T SR I RA IL+P L+NNF +++ ++   G   TPL K+P++G PP+I 
Sbjct: 419 MVNKKRTD-PTVSRSISRAQILEPTLKNNFTEHFQIYDSQG---TPLFKSPMRGSPPRIK 474

Query: 478 IVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQGP 537
           I+TEMKIGRKVITKVSNFE F I+PE  AAD+RK C            + KTAEVQVQGP
Sbjct: 475 ILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMC-SGSTTIGETMTSPKTAEVQVQGP 533

Query: 538 HGQLIMSYLNDLGIPNKWIDFE 559
           HGQ+I+ +LN LG+P KWID+E
Sbjct: 534 HGQIIIDHLNKLGVPTKWIDYE 555

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/565 (51%), Positives = 385/565 (68%), Gaps = 18/565 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKKEPHIKALSNLKNSERKKL + C+ QT+N+EY+F ++TIKQTNF    ++G +YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PI FKEKH+E+L+PTV +CW  P L+P++LTH  V+E+H+FNGANLMISG+IPPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           R  VGT+CG+A +  P +++A+GIV+M+LPS+ RV+GETGVAV+++HH  D L K  KVK
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNS--DTEKEKSNLDDMAEVLDELRLED 238
            +PP                      +E K+  N+  + +K + +++++AEVLD   + D
Sbjct: 181 LDPPIAKSGDEDINSKQVQP-----PEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSD 235

Query: 239 IDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFL 298
           +DYFITRALYYT++QD  L  P S SNF+SNHI  NLP   +  EVN+KK+SW+K+AKFL
Sbjct: 236 VDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPP-IDHNEVNVKKTSWRKSAKFL 294

Query: 299 KHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAK----TT 354
           KHFEKEGFLKLKG GDDLTIV    DKDE+K F+PY V  +  +    E  N+K      
Sbjct: 295 KHFEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGM 354

Query: 355 IKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXX 414
           +  +TLYKP ++AKDF+    +  +  Y   +I+  +++YI+                  
Sbjct: 355 MYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDL 414

Query: 415 XMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPP 474
              M+ KKK++    +R++PRA IL P+L NNF + Y +F+   N+ + L K P+KG PP
Sbjct: 415 LFNMVNKKKKN-LNAARIMPRAQILDPLLANNFTEFYQIFK---NDDSLLFKAPIKGSPP 470

Query: 475 KINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQV 534
           +I I TEMKIGRKVIT+VSNFEVFQIDPE  A D+RK C              K+AEVQV
Sbjct: 471 RIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF--KSAEVQV 528

Query: 535 QGPHGQLIMSYLNDLGIPNKWIDFE 559
           QGPHGQLI+ +LN+LG+PNKWIDFE
Sbjct: 529 QGPHGQLIIDHLNNLGVPNKWIDFE 553

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/563 (52%), Positives = 378/563 (67%), Gaps = 11/563 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKKEPHIKALSNLKNSERKKL +  + QT+NEEYSF ++TIKQTNF G  ++GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PI FKEKH E+L+PTV +CW  P L+P+VLTH  V+E+H+FNGANLMISG+IPPFD 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           R  +GT+CGIA K+ P  ++A+GIV+++LPSF +VIGETGVAV+I+HH  D L KVFK+K
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240
            EPP                     + +   +   D ++   +++++AEVLD   + D+D
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300
           YFITRALYYT++QD  LE P SASNF+SNHI  NLP   +  EVN+KK+SWKK+AKFLKH
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPP-IDHNEVNVKKTSWKKSAKFLKH 299

Query: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT----TIK 356
           FEKEGFLKLKG GDDLTIV  N DKDE+K F+PY +  ++ +    E   +K      + 
Sbjct: 300 FEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMY 359

Query: 357 IVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXXM 416
            +TLYKP NLAKD +    +     Y   +I+  +++YI+                    
Sbjct: 360 SLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLF 419

Query: 417 TMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKI 476
            M+ KKK+     SR+I R  IL P+L NNF + Y +F+   ++ T L K P+KG  P I
Sbjct: 420 DMVNKKKK-VLNASRIIARGEILHPLLTNNFTEFYQIFK---SDDTLLFKAPMKGSLPHI 475

Query: 477 NIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQG 536
            I+TEMKIGRKVIT+VSNFEVFQ+DPE  AAD+RK C              K AEVQVQG
Sbjct: 476 KIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF--KCAEVQVQG 533

Query: 537 PHGQLIMSYLNDLGIPNKWIDFE 559
           PHGQ I+ +LN LGIP+KWIDFE
Sbjct: 534 PHGQSIIDHLNKLGIPSKWIDFE 556

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/563 (53%), Positives = 384/563 (68%), Gaps = 11/563 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKKEPHIKALSNLKNSERKKL + C  QT+NEEY+F ++ IKQTNF G  ++GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PI FKEKH E+LYPTV +CW+ P+L+P+VLTH  V+E+H+FNGANLMISG+IPPFD 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           R  VGT+CG+A K++P +++A+G+V+++LPS+ RVIGETGVAV+++HH  D LFK FKVK
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240
            EPP                     + ++  +S    +K   +L+++AEVLD L + D+D
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240

Query: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300
           YFITRALYY+++QD  L  P SAS F+SNHI  NLP   +  EVN+KKSSWKK+AKFLKH
Sbjct: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPP-IDHNEVNVKKSSWKKSAKFLKH 299

Query: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT----TIK 356
           FEKEG LKLKG GDDLTIV  N DKDE+K F+PY +  +  S    E   +K      + 
Sbjct: 300 FEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMH 359

Query: 357 IVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXXM 416
            +TLYKP +LAKD +   K+     Y   +++  +++YI+                    
Sbjct: 360 SLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDDLLF 419

Query: 417 TMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKI 476
            M+ KKK+   T +R+I R+ ILQP+L NNF + Y +FR   N+ T L + P+KG PP+I
Sbjct: 420 NMVNKKKKTPDT-TRIIARSEILQPLLSNNFTEFYQIFR---NDDTLLFRVPMKGCPPRI 475

Query: 477 NIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQG 536
            IVTEMKIGRKVITKVSNFEVF IDPE  AAD+RK C              K+AEVQVQG
Sbjct: 476 KIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF--KSAEVQVQG 533

Query: 537 PHGQLIMSYLNDLGIPNKWIDFE 559
           PHGQ I+ YLN  GIP+KWIDFE
Sbjct: 534 PHGQFIIDYLNKSGIPSKWIDFE 556

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/559 (49%), Positives = 369/559 (66%), Gaps = 12/559 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKKEPHIKALSNLKNSERKKL + C+ QT   +Y+F ++ +KQTN+KG  + GT+YTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PIWFKEKH E L+PTV +CW  PNL+P+VLTH  V+E+ +FNGANLM++GT+PPFDE
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           R     VCGIA +  P +I+A+G+VQ+NLPS++ VIG+ G+AV+++H+  D L + FK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240
            EP                                +T   + +++D+A+VLDEL +ED+D
Sbjct: 181 IEPAVLSSEPVEEEEEEEGKEK------LTESPKRETFHTEISIEDVAQVLDELSVEDVD 234

Query: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300
           +F TRALYYT + DT L  P +ASNF+SNHI  NLP   + ++VN+KK+SWKKTAKFLKH
Sbjct: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPP-VDQSQVNMKKTSWKKTAKFLKH 293

Query: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIKIVTL 360
           FEK GFL+LKG GDDL IV VNK+KDE+K F+PY   G   S   S   ++   +    L
Sbjct: 294 FEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGMMYSEKL 353

Query: 361 YKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXXMTMIY 420
           YKPINL KDFI  + +P K LY   E+K+ +N+YIT                     M Y
Sbjct: 354 YKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFDMFY 413

Query: 421 KKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKINIVT 480
           +KK+ Q T  R + RA I+ P + NNF + Y LF+   +E TPL K P++G  P++ IVT
Sbjct: 414 RKKKTQET-PRCVSRAQIMDPFIANNFTEFYQLFK---DEDTPLFKNPIRGPLPRVKIVT 469

Query: 481 EMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQGPHGQ 540
           EMKIGRKV+T+VS+FE F++DPE+ AA++RK C            + K AEVQVQG HG 
Sbjct: 470 EMKIGRKVVTRVSHFETFKLDPEDLAANLRKLC-SGSTTIGETVTSPKVAEVQVQGAHGP 528

Query: 541 LIMSYLNDLGIPNKWIDFE 559
           LI+ YLN  GIP KWIDFE
Sbjct: 529 LIIDYLNKQGIPTKWIDFE 547

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/564 (51%), Positives = 371/564 (65%), Gaps = 14/564 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKK+PH+KALSNLKNSE KKL   CR QT N+EYSF +  IKQTNF+  + IGT+YTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PIWFKEKH   LYPTV ACW  P L+PVVLTH  V+E+ +FNGANLM++GT+ PFD 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           RL  GTVCGIA K  P++++AVG+VQ++LPS+  V+G+TGVAVQ+VH+L D L KVFKV 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240
            EPP                  +  +  +  E  S  +++  ++DD+AEVLDE RLED+D
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPS--QEKAVDIDDIAEVLDEFRLEDVD 238

Query: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300
            F+TRALYYT++ DTKLE P SASNF+SNHINHNLP   +  +VN+KKSSWKKTAKFLK+
Sbjct: 239 QFLTRALYYTLTHDTKLELPISASNFISNHINHNLP-SVDHEKVNVKKSSWKKTAKFLKN 297

Query: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT----TIK 356
           FEKEGFLKLKG GDDLTI+ +NK K E++ F PY + G  G    S   N K      ++
Sbjct: 298 FEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQLR 357

Query: 357 IVTLYKPINLAKDFISSNKV-PLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXX 415
             TLYKPINLAKDFI    + P   LY   E+K  +N YI                    
Sbjct: 358 CETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLL 417

Query: 416 MTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPK 475
             ++ KK++D  T  R++ RA I++P+L N+F  ++ +++       PL K P +G  P 
Sbjct: 418 YHLVNKKQKD-TTAPRLVSRATIIEPLLANSFTPHFQIYK----GDIPLFKNPSRGNLPN 472

Query: 476 INIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQ 535
           I IVTEMKIGRKVIT+VS FE+F ID +E AA +R+ C            + K  EV VQ
Sbjct: 473 IEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLC-SGSTTIGETMTSPKYKEVTVQ 531

Query: 536 GPHGQLIMSYLNDLGIPNKWIDFE 559
           GPHG LI+ +LN LGIP KWI F+
Sbjct: 532 GPHGPLIIDHLNSLGIPTKWIKFD 555

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/566 (50%), Positives = 368/566 (65%), Gaps = 21/566 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQT-SNEEYSFGSNTIKQTNFKGITTIGTIYTD 59
           MFKKEP IKALS LKNS+RKKL +  + Q  S+E+ S   ++I QTNF   T  GTIYTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  EGNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFD 119
             + PI FK KH + LYPT    W    L+  V THS+V+E++IFNGA+LMI+GT+PPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 ERLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKV 179
             LT+GT+C +A K  P++ +AVGIV++NLP + +V+G+TGVAV+I+HH ED LF  FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KEEPPAXXXXXXXXXXXXXXXXADI-HEDETKVESNSDTEKEKSN--LDDMAEVLDELRL 236
           K E PA                AD+  E + + ES S TE    +   DD+AEVLDEL +
Sbjct: 181 KLEIPA-----SVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTV 235

Query: 237 EDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAK 296
           ED+DYFI RALY+T+ QD  L  P  AS F+SNHI  NLP   +  +VNIK++SWKKTAK
Sbjct: 236 EDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPD-VDHKKVNIKRTSWKKTAK 294

Query: 297 FLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT--- 353
           FLK+FEKEGFLKLKG GDDL IV +NKDKDE+K F+PY  IGN      S+  + +T   
Sbjct: 295 FLKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYK-IGNTAKKAASKSDSTQTQGV 353

Query: 354 TIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXX 413
           ++  V LYKPINL + FI  + +    +Y   EI+  IN YI                  
Sbjct: 354 SVSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDD 413

Query: 414 XXMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEP 473
               M+ +K ++     R+IPRANIL+P++ NNFN+ + L++    + TPL K P+KG+ 
Sbjct: 414 LLFAMVNRKIQNPIF-PRIIPRANILEPLIANNFNEYFQLYK---GDNTPLFKNPIKGQT 469

Query: 474 PKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQ 533
           PKI+IVTEMKIGRKV+T+VSNFE F+I PEE AAD+RK C             KK +EVQ
Sbjct: 470 PKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLC---SGSTTISETPKKVSEVQ 526

Query: 534 VQGPHGQLIMSYLNDLGIPNKWIDFE 559
           VQGPHGQLI+ + N  GIP+K+I FE
Sbjct: 527 VQGPHGQLIIDHFNKSGIPSKFIQFE 552

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/567 (48%), Positives = 377/567 (66%), Gaps = 16/567 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKK P++KA SNLKNSERKKL + C+ Q ++ +Y+F S+ IKQ N+KG T+ GT+YTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PIWFKEKH + L+P+V  CW+ P L+P+++T+S V+E+ I NGANLMISGT+ PFDE
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           RL  G +CGIA  + PN+++A+GIVQ++L S+T+V+GETGVAV ++H+L D L   FK+ 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 EEPP-AXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDI 239
            EPP                   D++ + T   SN D   +    DD+AEVL+ L ++ I
Sbjct: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELT--NSNKDLAPDARPNDDLAEVLETLPVDII 238

Query: 240 DYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLK 299
           D FIT++LYY+++ D KLE P SASNF+SN+I  NLP   N   VN+KKSSWKKTAKFL+
Sbjct: 239 DDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDN-DMVNLKKSSWKKTAKFLR 297

Query: 300 HFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTT----- 354
           HFEKEGF+KLKG  DDL I   NK+K E+K F+PY   GN G++T S+      T     
Sbjct: 298 HFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRT-GN-GNSTKSKKDKTNDTSDNGD 355

Query: 355 -IKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXX 413
            ++ V+ YKPI+L KD I  +  P K LY   E+++ I +YI                  
Sbjct: 356 MMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDD 415

Query: 414 XXMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNE-QTPLTKTPLKGE 472
              +++YKKK   + + R+I RA++++P+ +NNFN+++ +++   NE   PL K P++G 
Sbjct: 416 LMYSLVYKKK--NSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGS 473

Query: 473 PPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEV 532
            PK+ IVTEMKIGRKVIT+VSNFEVF ID E  AAD+RK C            + KTAEV
Sbjct: 474 IPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLC-NGATTIGETLTSPKTAEV 532

Query: 533 QVQGPHGQLIMSYLNDLGIPNKWIDFE 559
           QVQGPH Q+I+ +LN L IP KWIDF+
Sbjct: 533 QVQGPHSQVIIKHLNSLSIPTKWIDFK 559

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/578 (49%), Positives = 377/578 (65%), Gaps = 30/578 (5%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFG-SNTIKQTNFKGIT--TIGTIY 57
           MFKKEPHIKALSNLKNS+RKKL +  + QT+ E Y+F  SN IKQTNF+     +IGTI+
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDEGNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPP 117
           T++ N PIWFK KH++ LYPTV  CW   +++P +L+H  V+++ +FNGANLMISGTIPP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDERLTVGTVCGIADKRTPNLIV-AVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKV 176
           FD RL  GT+CGIA  + P  IV A+G+V+MN+PSF +V+GETGVAV+++HH EDELFK+
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKVKE-EPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELR 235
           FK  + +P                  AD  ED T+ +     E  +SN  D  EVLD  +
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVAD--EDTTRKKE----ENRESNEPDF-EVLDHFK 233

Query: 236 LEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTA 295
            ED+DYFITR+LYYTI+QDTK+E P SASNF+S HIN NLP  ++  EVNIKK+SWKKTA
Sbjct: 234 TEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISH-NEVNIKKTSWKKTA 292

Query: 296 KFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPY-------PVIGNQGSNTGSEG 348
           KFLKHFEKEGFLKLKG GDDLT+V +NK KDE+K F+PY       P       NT ++ 
Sbjct: 293 KFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNT-NDK 351

Query: 349 GNAKTTIKIVTLYKPINLAKDFISS-NKVPLKQLYMEPEIKELINKYITXXXXXXXXXXX 407
            + K  +   T YKPIN AKD + +   +P K LY + EI++++  YI            
Sbjct: 352 SDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKK 411

Query: 408 XXXXXXXXMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGN------EQ 461
                     M++K++ +     R + R  IL+P+L NNF ++Y ++R          + 
Sbjct: 412 MILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDV 471

Query: 462 TPLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXX 521
            PL K+P +G  P+I+I+TEMKIGRKVITKVSNFE+F I  +  AAD+RK C        
Sbjct: 472 EPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLC-SGSTTIG 530

Query: 522 XXXXAKKTAEVQVQGPHGQLIMSYLN-DLGIPNKWIDF 558
               + KT EVQVQGPHGQ+I+ +LN   G+P KWI++
Sbjct: 531 ETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/577 (47%), Positives = 372/577 (64%), Gaps = 33/577 (5%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKKEP IKALSNLKNSERK +Q +C+ QT + EY+F S  IKQT FK   T GT++TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PIWFKEK  + LYPTV  CW    L+P+VL H  V+E+ +  GANLM+ GT+PPFDE
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           R     +  +A    P+++ A+GIVQ+NLP ++RVIGE+GVAV+IVH   DEL KVFKVK
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESN----------SDTEKEKSNLDDMAEV 230
            +PP                 ADI ED+T V S            D ++   N++D++E 
Sbjct: 181 LQPP---EGSAAILDSESEEEADI-EDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQ 236

Query: 231 LDELRLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSS 290
           L ELR+ED+D+F TR+LYY+++ D KLETP SASNFVSNHI  NLP   +  +VN+KK+S
Sbjct: 237 LTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPP-IDHTQVNMKKTS 295

Query: 291 WKKTAKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGN 350
           WKKTAKFLK+FEKEGFLKLKG GDDLTI+ V++ K E+K F PY + G  G+++  +G +
Sbjct: 296 WKKTAKFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGG--GASSSEKGAS 353

Query: 351 A-------KTTIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXX 403
           +        + +K V+LY+PI+  K F+S+  +P  Q++ + +IK  ++KYI+       
Sbjct: 354 SVANEKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSP 413

Query: 404 XXXXXXXXXXXXMTMIYK--KKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQ 461
                         ++ +  KKE+     R I RA I+ PVL+ NF++++ + +  G   
Sbjct: 414 DNKSAVRLDDLLYDLVNRSSKKENAV---RTIARAQIMAPVLKGNFSEHFLILKADG--- 467

Query: 462 TPLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXX 521
           TPL K P+KG  P++ IVTEMKIGRKV+TKVSNFE FQ+D +E A  +RKKC        
Sbjct: 468 TPLFKHPVKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKC-SGSTTIG 526

Query: 522 XXXXAKKTAEVQVQGPHGQLIMSYLNDLGIPNKWIDF 558
               + KT EV VQGPHG  ++  LN+ GIP KWI+F
Sbjct: 527 EANTSPKTLEVTVQGPHGPAVIELLNESGIPTKWINF 563

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  511 bits (1317), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 279/576 (48%), Positives = 364/576 (63%), Gaps = 43/576 (7%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKKEP IKALSNLKNSERKKLQ +CR Q    +YSF S  IKQT FK   T GT+YTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PIWFKEK  + LYPTV +CW   +L+P+VL H  V+E+ +  GANLM+ GT+PPFDE
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           R     + G+A   +P+++ A+GIVQ+NLP ++RVIGE+GVAV+IVH  +DEL K FKVK
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKS----------------NL 224
            +PP                       E+  E NSD E   +                N+
Sbjct: 181 LQPPEGADGIA----------------ESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNI 224

Query: 225 DDMAEVLDELRLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEV 284
           DD AE L +L +ED+D+F TRALYYT++QD+KLE P SASNFVSNHI  NLP   +  +V
Sbjct: 225 DDAAEQLSQLSVEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPP-LDHTQV 283

Query: 285 NIKKSSWKKTAKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNT 344
           N+KK+SWKKTAKFLKHFEKEGFLKLKG GDDLTIV ++K KDE+K F+PY   GN G +T
Sbjct: 284 NMKKTSWKKTAKFLKHFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGST 343

Query: 345 GSEGGNAKTTIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXX 404
           GSE     + +K + +YKP++ AK F+ +  +    ++   E+K  ++ YI         
Sbjct: 344 GSESEQ-NSMMKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQD 402

Query: 405 XXXXXXXXXXXMTMIYK--KKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQT 462
                       +++ +  KKE+     R I RA I+ P+L+ NF +++ + +  G   T
Sbjct: 403 NKAAVRLDDLLFSLVNRSTKKENAV---RTILRAQIMPPILKGNFAEHFLVLKPDG---T 456

Query: 463 PLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXX 522
           PL K P+KG+ P+I IVTEMKIGRKV+TKVSNFE FQ+D +E A  +RKKC         
Sbjct: 457 PLFKHPVKGDIPQIQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKC-SGSTTIGE 515

Query: 523 XXXAKKTAEVQVQGPHGQLIMSYLNDLGIPNKWIDF 558
              + KT EV VQGPHG  ++  LN L IP KWI+F
Sbjct: 516 TTTSPKTTEVTVQGPHGPAVIELLNQLAIPTKWINF 551

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  496 bits (1278), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 269/563 (47%), Positives = 362/563 (64%), Gaps = 16/563 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKK+PHIKALSNLKNSERKKL    R Q    +Y F +  +KQT FKG T+ GT+YTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PIWFKEKH   ++PTV  CW  P+++PVV TH  V+E+ +  GA+LM+ G +PPF  
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           + + G++ G+A  R+P +I A+GIVQ++LPS+TRVIGETGVAV I+H  +D L K FK+K
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240
            EPP                  D   DE K  + + T+    N +D +E L+EL  EDID
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVD-SADEAKAIATT-TQARMVNTEDASEQLNELSAEDID 238

Query: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300
           +F+TR+LYYT++QD +L+ P +ASNFVSNHI HNLP   +  ++N+KKSSWKK+AKFLKH
Sbjct: 239 HFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPP-VDHNQINMKKSSWKKSAKFLKH 297

Query: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQG--SNTGSEGGNAKTTIKIV 358
           FEK  FLKLKG GDDL +V +NKDKDE+K+F+PY  IG+ G  + T ++       ++ V
Sbjct: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPY-RIGSHGEPTQTKAKAQENSNMMQAV 356

Query: 359 TLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXXMTM 418
           +LYKPI+ AK+F  +  +P  +++   E+K  ++ YI                      M
Sbjct: 357 SLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLFPM 416

Query: 419 IYK--KKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKI 476
           I +  KKE+     R I RA I+ P L NNF +++ + +       PL KT LKG  P+I
Sbjct: 417 INRSTKKENAL---RTISRAQIMPPFLANNFTEHFQILK----GDVPLFKTALKGAIPEI 469

Query: 477 NIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQG 536
            IVTEMKIGRKV+TKVSNFE FQ+D E  AA++RK+C            + KT EV VQG
Sbjct: 470 QIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRC-SGSTTIGETMSSPKTLEVTVQG 528

Query: 537 PHGQLIMSYLNDLGIPNKWIDFE 559
           PHG +++  LN+ GIP KWI+F+
Sbjct: 529 PHGAIVIGMLNEYGIPTKWINFQ 551

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  482 bits (1241), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 268/564 (47%), Positives = 359/564 (63%), Gaps = 13/564 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKK PHIK+LSNLKNSERKKL + C+ QT + +Y+F ++ IKQTNF   T++G IYTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
             +P+WFKEKH E L+PTV  CW  P L+P+VLTH IV+ +HIFNGANLMISGT+PPFD 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           RL   T+CGIA +  PN IVAVG+VQ+++PS++ VIG+TGVAV ++H+  D +   FK+K
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXAD-IHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDI 239
            + P                 +  I  +E K E +S  E   +++ ++A+    L +EDI
Sbjct: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240

Query: 240 DYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPK-GTNLAEVNIKKSSWKKTAKFL 298
           D+FITR+LYYT++ D KL  P  +S+F+SNHI  NLP    NL  VNIKK+SWKK++KFL
Sbjct: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNL--VNIKKTSWKKSSKFL 298

Query: 299 KHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPV---IGNQGSNTGSEGGNAKTTI 355
           KHFEKEGF+KLKG G+DLTIV  NK+K+E+K+F PY +     N G    S    ++  +
Sbjct: 299 KHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESENMM 358

Query: 356 KIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXX 415
             +  Y P   AK F++  ++P K  Y   E+K  + +YI                    
Sbjct: 359 YSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRL 418

Query: 416 MTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPK 475
             M Y KK       R I RA +++    NNF + Y LF+   N+ TPLTK P++G PP+
Sbjct: 419 YDMCYTKK--STNPPRHITRAAVIESFTTNNFTELYQLFK---NDDTPLTKNPVRGSPPR 473

Query: 476 INIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQ 535
           I IVTEMKIGRK++T+VSNFE F ID +  A D+R+ C            + KT EVQVQ
Sbjct: 474 IKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLC-SGSTTIGETTTSPKTTEVQVQ 532

Query: 536 GPHGQLIMSYLNDLGIPNKWIDFE 559
           GPH ++I+ +LN L IP KWIDFE
Sbjct: 533 GPHSKIIIDHLNSLSIPTKWIDFE 556

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  451 bits (1161), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 252/571 (44%), Positives = 357/571 (62%), Gaps = 32/571 (5%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKK PHIK LSNLKNSE++KLQ++ + Q   +E+ F  NT+KQTNF+  T++GTIY ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  GN--APIWFKEKHDE-KLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPP 117
                P++FKEKH    L+P+V ACW  P L+P++LTHS+V+EDH+FNGANLMISGT+PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-ERLTVGTVCGIADKRTPNLIVAVGIVQMNLPSF--TRVIGETGVAVQIVHHLEDELF 174
           FD   L  G  CGIA+ ++P++I+AVG ++M+L  F  T V+G +GV V++ HH  D L 
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 KVFKVKEEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTE-KEKSNLDDMAEVLDE 233
             F++K + P                      +E  VE+   +       +DD+AEVL+ 
Sbjct: 181 DAFRLKLDIPDKLESATTQEVA----------EEPPVEAKPTSPVTNPVAVDDLAEVLET 230

Query: 234 LRLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKK 293
           L +ED+DYF+TRALYYT++Q+ KL  P +ASNF+S H+   LPKG +  EVN+KKSSWKK
Sbjct: 231 LSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKK 290

Query: 294 TAKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDE--IKQFLPYPVIGNQGSNTGSEGGNA 351
           TAK+LKHFEKEG LKLKG GDDL +V     K    +K F+PY ++GN  + +G +    
Sbjct: 291 TAKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPY-LVGNSIAESGPKSQTT 349

Query: 352 KTTIKI-VTLYKPINLAKDFISSNKVPL--KQLYMEPEIKELINKYITXXXXXXXXXXXX 408
              +   VT ++P     D  +   +PL  ++ +  PEI+E++N+YIT            
Sbjct: 350 NGPVMFAVTSFQP-----DSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKM 404

Query: 409 XXXXXXXMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTP 468
                    M+ K  E++ T  R++ R  IL+ V++ +F   Y LF+   ++ TPLTK P
Sbjct: 405 VLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFK---DKDTPLTKHP 461

Query: 469 LKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKK 528
            KGEPPK++I+TEMKIGRKV+T+V NF+   I   EFAAD+RK C               
Sbjct: 462 QKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLC-SASTTIGKTVSTPV 520

Query: 529 TAEVQVQGPHGQLIMSYLNDLGIPNKWIDFE 559
            +E+QVQG HG LI+ +L +LG+P+ W+ FE
Sbjct: 521 VSEIQVQGAHGPLIIDHLRELGVPSSWVVFE 551

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  445 bits (1145), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 232/566 (40%), Positives = 349/566 (61%), Gaps = 17/566 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKK+P IK+ SNLKNSERKKL    R Q +N+E+ F +  +KQ  FK  T  GTI+TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PI+FKEKH E L PT+L CW+ P L+ VVLTH  VL++ + NGA+LM+ GTIPPF +
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
             T G + G+A   TP ++ A+G+ Q+NL    +V+GETGVAV+++H + D L++VFK+ 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 EEPPAXXXXXXX-----XXXXXXXXXADIHEDET--KVESNSDTEKEKSNLDDMAEVLDE 233
            EPP+                       I EDE     ++ S   +E ++L ++AE L+E
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240

Query: 234 LRLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKK 293
           L +E +D+F+T+A+YYT++ D  L+ P  ASNF++NH+  NLP+  +  +V++K+SSW +
Sbjct: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPR-IHKTQVSLKRSSWAR 299

Query: 294 TAKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT 353
            +KFLK+FE +GFLKLKG  ++LT+V VNKDK EIK F PY  I  Q S + S   N K 
Sbjct: 300 ASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTI--QKSVSTSSKNNDKH 357

Query: 354 TIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXX 413
            +++V  Y+P+N AK  + +       +    +IK ++NKY+T                 
Sbjct: 358 DVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLDD 417

Query: 414 XXMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEP 473
              ++ YKK    +T  R + RA +   +L  +F + + +F+    +  PL+  PLK + 
Sbjct: 418 TLFSLAYKKSASDST--RKVLRAKMFDLILSTSFTEVFFIFK----DGKPLSSKPLKSKN 471

Query: 474 PKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQ 533
             ++++TEMKI RK++T++SNFE++ +DPEE + ++RK+C             + T EVQ
Sbjct: 472 RNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTL-QSTTEVQ 530

Query: 534 VQGPHGQLIMSYLNDLGIPNKWIDFE 559
           VQGPHG   ++ LN+ GIP+K+IDF+
Sbjct: 531 VQGPHGNTAINILNEHGIPSKYIDFD 556

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  423 bits (1087), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 230/562 (40%), Positives = 323/562 (57%), Gaps = 14/562 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKK   I  LSNLKNSE + +++ CR   SN EY F  + +KQT F+     G IYTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N PIWFK+K+   + PTV   W  PN IP++ TH  ++E  IFNGANLMI GT+ P DE
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
           RL  G +CGIA  + P  I+A+G+   ++ +    +G+TGVAV+++H   DEL  +FK+K
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXA---DIHEDETKVESNSD-TEKEKSNLDDMAEVLDELRL 236
             PP                 +   +I E E++V+ ++   +   SN DD+AE L++LR+
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240

Query: 237 EDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAK 296
           EDID F+T++LYYTI+Q+T L+ P  +S FVS ++  NLP   +  +VNIKKSSWKKTAK
Sbjct: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLP-NVDHNQVNIKKSSWKKTAK 299

Query: 297 FLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIK 356
           FLKHFEKEGFLKLKG GDDLTI   NK+K ++K F+PY +    G+    +  + K  +K
Sbjct: 300 FLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFLK 359

Query: 357 IVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXXM 416
           +VTLY P        ++  +  K  +   EI   I  YI                     
Sbjct: 360 VVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLF 419

Query: 417 TMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKI 476
            ++     ++A  +R I R+ +++PVL NNF   + LF    ++   L+K P KG PP +
Sbjct: 420 DLVI--TNNKANANRNIMRSQVVEPVLVNNFLLYHQLFT---HDNISLSKHPKKGSPPTV 474

Query: 477 NIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQG 536
            +VTE     KVIT+VSNFEVF ID ++ + +++  C                +EVQVQG
Sbjct: 475 KMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLC----SGSTSIEELPNGSEVQVQG 530

Query: 537 PHGQLIMSYLNDLGIPNKWIDF 558
           PHG ++M Y    GIP KW D+
Sbjct: 531 PHGDIVMEYFEKHGIPRKWFDY 552

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  421 bits (1082), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 235/569 (41%), Positives = 329/569 (57%), Gaps = 20/569 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MF KEPHIK LSNLKNS+RKKLQ   + Q  NEEY+  +  IKQT+F+     G+IYTDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCP-NLIPVVLTHSIVLEDHIFNGANLMISGTIPPFD 119
            N PIWFK K +++LYPT+ + W     L+P++LTH  V+E HI  GA LM+ GT+PPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 ERLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKV 179
             +  G++ GIA  + P L+ A+GI +M+L   + VIG  G+AV++VH+L+D LFK FK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KEEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNS-DTEKEKSNLDDMAEVLDELRLED 238
           + EPPA                   + ++   ESN  +    +S ++++A+ L+E+ +ED
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239

Query: 239 IDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPK-GTNLAEVNIKKSSWKKTAKF 297
           +D+ + RA+ Y+I  D K+  P  AS F+SNH+  NLP   TN+  VNIKKSSWKK  K 
Sbjct: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNM--VNIKKSSWKKATKL 297

Query: 298 LKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIG-----NQGSNTGSEGGNAK 352
           LK+ E EGFLKLKG  D  T++ +NK+  ++     Y  +      + G  T     N  
Sbjct: 298 LKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKI 357

Query: 353 TTIKIVTLYKPINLAKDFISSNKVPLKQ-LYMEPEIKELINKYITXXXXXXXXXXXXXXX 411
           T      LYKP++  + FI+     + Q  Y + E+K+L++ Y+                
Sbjct: 358 TAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKY 417

Query: 412 XXXXMTMIYKKKEDQATKSRVIPRANILQPV-LQNNFNKNYHLFRITGNEQTPLTKTPLK 470
                 M  +  ++   +   I R  I+ P  L  NFN  + +++  G    PL K P K
Sbjct: 418 DDTLYQMSNRAPQNGGIQK--IARGLIVSPTFLSKNFNTYHQIYKPNGE---PLLKVPEK 472

Query: 471 GEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTA 530
           G  P + IVTE KIGRKVIT+V+NFE F+ID EE AA +RKKC            + KTA
Sbjct: 473 GPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKC--SGSTTIGESKSTKTA 530

Query: 531 EVQVQGPHGQLIMSYLNDLGIPNKWIDFE 559
           EVQVQGPHG +++S LND GIP KWI FE
Sbjct: 531 EVQVQGPHGSIVISILNDYGIPTKWISFE 559

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  377 bits (968), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/559 (37%), Positives = 303/559 (54%), Gaps = 26/559 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60
           MFKKEP++   SN KNSERK+LQ   R Q   E Y F S  IK   FK  +T+GT+YTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120
            N P+WF+ KHD+   PTV +CW  P+L+PVV TH  V+E  +  GA+LM+ GT+PPF  
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180
               G V GIA  R P ++ AVGI +M+L   T V   TGVAV+++H   D L +VFKV+
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 EEPPAXXXXXXXXXXXXXXXXADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240
            E P                  +  E E +    +  E        +AE L+ L +ED+D
Sbjct: 181 REAP--------EASEAKGASPEAREPEAEPPKTAPGE-------GLAEELERLTMEDVD 225

Query: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300
           + +TRA+YYTI  D +L+ P +AS F++ H+  NLP   +L++V +K+SSW K AK LKH
Sbjct: 226 HLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPP-MDLSQVTVKRSSWGKAAKLLKH 284

Query: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIKIVTL 360
           FE +G L LKG  +  T+V VN   + +K F PY  + ++ S TGS+  +   +++IV  
Sbjct: 285 FEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKAS-TGSKNSSTTQSLEIVYH 343

Query: 361 YKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITXXXXXXXXXXXXXXXXXXXMTMIY 420
           Y P       ++   +         +I++ + +Y+                      +++
Sbjct: 344 YVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLH 403

Query: 421 KKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKINIVT 480
           K     A   R +PR   L  +L  +F++ + + R       PL+K P KG  P I +  
Sbjct: 404 KNV--NADTPRSLPRPEALAALLSRSFSEYFVVMR----GDAPLSK-PQKGRAPPIKVTN 456

Query: 481 EMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQVQGPHGQ 540
           E KI +KV+TKVSNFEV+ +DPEE AA++R +C              K  EVQVQGPH  
Sbjct: 457 ERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT--KAVEVQVQGPHEA 514

Query: 541 LIMSYLNDLGIPNKWIDFE 559
            I+S LN  GIP+K+I  +
Sbjct: 515 TIVSILNKHGIPSKYITLD 533

>SAKL0G14344g Chr7 (1238204..1238779) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P47089 Saccharomyces cerevisiae
           YJR014W RBF22 Hypothetical ORF
          Length = 191

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 3/97 (3%)

Query: 453 LFRITGNEQTPLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKK 512
           L R+   +++   +   K    K+ I  E +  RK +  +S  EVF+ID ++ A     K
Sbjct: 73  LLRLQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFEIDMKKLAKTFASK 132

Query: 513 CXXXXXXXXXXXXAKKTAEVQVQGPHGQLIMSYLNDL 549
                        A+K  E+ VQG     + +Y++ L
Sbjct: 133 ---FATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSL 166

>ZYRO0D09636g Chr4 complement(819030..819564,819630..819640) [546
           bp, 181 aa] {ON} similar to uniprot|P89886 Saccharomyces
           cerevisiae YER007C-A TMA20 Protein of unknown function
           that associates with ribosomes
          Length = 181

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 82/184 (44%), Gaps = 18/184 (9%)

Query: 1   MFKK--EPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYT 58
           MF+K  +  + + SN+K+S ++ L+ K   Q    E        K++  + I     I  
Sbjct: 1   MFRKFAKEDVHSRSNVKSSVQRSLKSKLVSQYPKLEDVIDELIPKKSQVELIKCEDKIQL 60

Query: 59  DEGNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISG----- 113
              +  I F +K  E L PT+    + P+  P V      ++  + +GAN+M  G     
Sbjct: 61  YSVDGEILFFQKFAE-LIPTLKLVHKFPDAYPTVQVDRGAIK-FVLSGANIMCPGLTSPG 118

Query: 114 -TIP--PFDERLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLE 170
            ++P  P  E+ +V  V    +K +    +A+G + M+      +    G  V+++HHL 
Sbjct: 119 ASLPEAPGYEKDSV-VVINAENKESA---LAIGKLMMSTEEIKSI--NKGHGVEMIHHLS 172

Query: 171 DELF 174
           D L+
Sbjct: 173 DPLW 176

>KAFR0E01930 Chr5 (390365..390967) [603 bp, 200 aa] {ON} Anc_5.144
           YJR014W
          Length = 200

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 3/97 (3%)

Query: 453 LFRITGNEQTPLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKK 512
           L ++   E+    +   K    K+ I  E +  RK I  +S  EVF+ID ++ A     K
Sbjct: 76  LLKLQAKEENRQQRELQKKLSSKVIIKREARTKRKFIVAISGLEVFEIDMKKLAKTFASK 135

Query: 513 CXXXXXXXXXXXXAKKTAEVQVQGPHGQLIMSYLNDL 549
                        A+K  E+ +QG     + +Y++ L
Sbjct: 136 ---FATGCSVSKNAEKKEEIVIQGDVIDEVEAYIHSL 169

>Kpol_1050.29 s1050 (69445..70065) [621 bp, 206 aa] {ON}
           (69445..70065) [621 nt, 207 aa]
          Length = 206

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 3/97 (3%)

Query: 453 LFRITGNEQTPLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKK 512
           L R+   ++    +   K    K+ I  E +  RK I  +S  EVF+ID ++ A     K
Sbjct: 75  LLRLQAKQENREQRELAKKLSSKVVIKREARTKRKFIVAISGLEVFEIDMKKLAKTFASK 134

Query: 513 CXXXXXXXXXXXXAKKTAEVQVQGPHGQLIMSYLNDL 549
                        A+K  E+ +QG   + +  Y++ L
Sbjct: 135 ---FATGCSVSKNAEKKDEIVIQGDVLEEVEKYIHSL 168

>NDAI0C02920 Chr3 complement(670916..671524) [609 bp, 202 aa] {ON}
           Anc_5.144 YJR014W
          Length = 202

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 3/97 (3%)

Query: 453 LFRITGNEQTPLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKK 512
           L ++   E+    +   K    K+ I  E +  RK I  +S  EVF+ID ++ A     K
Sbjct: 76  LLKLQTKEENREQRELAKKLASKVIIKREARTKRKYIIAISGLEVFEIDMKKLAKTFASK 135

Query: 513 CXXXXXXXXXXXXAKKTAEVQVQGPHGQLIMSYLNDL 549
                        A+K  EV VQG   + + +Y++ L
Sbjct: 136 ---FATGCSVSKNAEKKEEVIVQGDVLEEVEAYIHSL 169

>Suva_13.484 Chr13 (838813..839940) [1128 bp, 375 aa] {ON} YMR294W
           (REAL)
          Length = 375

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 205 HEDETKVESNSDTEKEKSNLDDMAEVLDELRLED 238
           ++DE KV SN DTE  +  LD + + L+EL+ ED
Sbjct: 81  YDDERKVTSNEDTESRQEKLDRIRQELEELKTED 114

>CAGL0B03927g Chr2 (386875..387465) [591 bp, 196 aa] {ON} highly
           similar to uniprot|P47089 Saccharomyces cerevisiae
           YJR014w
          Length = 196

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 3/77 (3%)

Query: 473 PPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEV 532
             K+ +  E +  RK I  +S  EVF+ID ++ A     K             A+K  EV
Sbjct: 94  SSKVIVKREARTKRKYIVAISGLEVFEIDMKKLAKTFASK---FATGCSVSKNAEKKEEV 150

Query: 533 QVQGPHGQLIMSYLNDL 549
            VQG     +++Y++ L
Sbjct: 151 VVQGDVLDEVVAYIHSL 167

>CAGL0I06358g Chr9 complement(608945..614890) [5946 bp, 1981 aa]
           {ON} similar to uniprot|P39526 Saccharomyces cerevisiae
           YJL207c
          Length = 1981

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 50/113 (44%), Gaps = 19/113 (16%)

Query: 234 LRLEDIDYFITRALYYTISQDTKLETPTSASNFVS--NHINHNLPKGTNLAEV------- 284
           + LED   F  +    + S+D K     S  +F+S  N++NH+  KGTN  ++       
Sbjct: 310 ISLEDALDFYVQLFCESKSRDIKSGCFESLIHFISLNNNVNHSYLKGTNYLKIVKHLSTI 369

Query: 285 ----NIKKSSWKKTAKFLKHFEKEGFLKLKGVGDD------LTIVEVNKDKDE 327
               NIKK      ++++++F     + L  +G+       L IV +  D  E
Sbjct: 370 FLDYNIKKKHLDSLSRYMRYFTYMHRIFLPRIGESSKCQMLLNIVAIKTDDSE 422

>CAGL0E00451g Chr5 complement(37236..43508) [6273 bp, 2090 aa] {ON}
           similar to uniprot|P25655 Saccharomyces cerevisiae
           YCR093w CDC39
          Length = 2090

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 25/44 (56%)

Query: 440 QPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKINIVTEMK 483
           QP +  + ++  H   +  N+ TP+TK PL+  P K  ++ E+K
Sbjct: 745 QPQVYQSLSEAAHGIDVAKNQSTPITKQPLELYPMKFFVIDELK 788

>NCAS0D01770 Chr4 complement(331343..331936) [594 bp, 197 aa] {ON}
           Anc_5.144 YJR014W
          Length = 197

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 475 KINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCXXXXXXXXXXXXAKKTAEVQV 534
           K+ I  E +  RK I  +S  EVF+ID ++ A     K             A+K  E+ +
Sbjct: 97  KVIIKREARTKRKFIIAISGLEVFEIDMKKLAKTFASK---FATGCSVSKNAEKKEEIVI 153

Query: 535 QGPHGQLIMSYLNDL 549
           QG   + + +Y++ L
Sbjct: 154 QGDVLEAVEAYIHSL 168

>KNAG0M01340 Chr13 complement(241640..242248) [609 bp, 202 aa] {ON}
           Anc_5.144 YJR014W
          Length = 202

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 4/105 (3%)

Query: 453 LFRITGNEQTPLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKK 512
           L ++   E+    +   K    K+ I  E +  RK I  +S  EVF+ID ++ A     K
Sbjct: 78  LLKLQTREENREQRELQKKLASKVVIKREARTKRKSIVAISGLEVFEIDMKKLAKTFASK 137

Query: 513 CXXXXXXXXXXXXAKKTAEVQVQGPHGQLIMSYLNDLGIPNKWID 557
                         +K  EV +QG   + + +Y++ L +  K +D
Sbjct: 138 ---FATGCSVAKNVEKKEEVIIQGDVMEQVEAYIHQL-LKEKGLD 178

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,003,323
Number of extensions: 2661454
Number of successful extensions: 7727
Number of sequences better than 10.0: 49
Number of HSP's gapped: 7851
Number of HSP's successfully gapped: 49
Length of query: 569
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 454
Effective length of database: 40,294,809
Effective search space: 18293843286
Effective search space used: 18293843286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)