Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B01815g8.268ON29029013450.0
Smik_4.3608.268ON2852457038e-92
YDR116C (MRPL1)8.268ON2852456845e-89
Suva_2.2758.268ON2852456585e-85
Kpol_392.38.268ON2812456533e-84
KLLA0F19272g8.268ON2662456513e-84
ZYRO0C01518g8.268ON2772456498e-84
Skud_4.3768.268ON2852456421e-82
TPHA0J007708.268ON2782456333e-81
KLTH0G13552g8.268ON2812456272e-80
NCAS0B038108.268ON3142456302e-80
SAKL0H16896g8.268ON2852456254e-80
NDAI0J013308.268ON3142456233e-79
Ecym_43028.268ON2752466072e-77
Kwal_56.237758.268ON2812456072e-77
AGR080W8.268ON2752456037e-77
TDEL0F039508.268ON2762455976e-76
KAFR0B054808.268ON2802455447e-68
KNAG0H032108.268ON2852455333e-66
TBLA0I031908.268ON2412223693e-42
CAGL0J00473g5.278ON36552780.24
Smik_12.595.213ON617107770.35
YLL004W (ORC3)5.213ON61697760.50
TPHA0E025403.544ON883136731.1
TDEL0D028004.172ON383129721.3
Ecym_20795.100ON512175676.1
Kwal_33.135031.104ON80966667.8
ZYRO0B01606g2.516ON23932658.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B01815g
         (290 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   522   0.0  
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   275   8e-92
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   268   5e-89
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   258   5e-85
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   256   3e-84
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   255   3e-84
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   254   8e-84
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   251   1e-82
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   248   3e-81
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   246   2e-80
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   247   2e-80
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   245   4e-80
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   244   3e-79
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   238   2e-77
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   238   2e-77
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   236   7e-77
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   234   6e-76
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   214   7e-68
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   209   3e-66
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   146   3e-42
CAGL0J00473g Chr10 (39305..40402) [1098 bp, 365 aa] {ON} similar...    35   0.24 
Smik_12.59 Chr12 (128051..129904) [1854 bp, 617 aa] {ON} YLL004W...    34   0.35 
YLL004W Chr12 (141073..142923) [1851 bp, 616 aa] {ON}  ORC3Subun...    34   0.50 
TPHA0E02540 Chr5 (539071..541722) [2652 bp, 883 aa] {ON} Anc_3.5...    33   1.1  
TDEL0D02800 Chr4 complement(534568..535719) [1152 bp, 383 aa] {O...    32   1.3  
Ecym_2079 Chr2 complement(135814..137352) [1539 bp, 512 aa] {ON}...    30   6.1  
Kwal_33.13503 s33 (254111..256540) [2430 bp, 809 aa] {ON} YNL256...    30   7.8  
ZYRO0B01606g Chr2 complement(131244..131963) [720 bp, 239 aa] {O...    30   8.0  

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/290 (89%), Positives = 260/290 (89%)

Query: 1   MLRIGSKVRYCNANRVIFNSALFGRRLLXXXXXXXXXXXXXXXXKEQAKKREMXXXXXXX 60
           MLRIGSKVRYCNANRVIFNSALFGRRLL                KEQAKKREM       
Sbjct: 1   MLRIGSKVRYCNANRVIFNSALFGRRLLATEAAPIPQAAAPTLTKEQAKKREMKRLALKK 60

Query: 61  XXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPH 120
                  NIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPH
Sbjct: 61  AEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPH 120

Query: 121 PLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIF 180
           PLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIF
Sbjct: 121 PLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIF 180

Query: 181 PTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCN 240
           PTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCN
Sbjct: 181 PTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCN 240

Query: 241 FSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPGIVIDFQ 290
           FSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPGIVIDFQ
Sbjct: 241 FSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPGIVIDFQ 290

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  275 bits (703), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 186/245 (75%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+QAKKRE+                +PLYMP+ +ALRYLR+AEVGRP   QTI +TTLVV
Sbjct: 46  KDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVV 105

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
            ++G A L+G++ FP PL+ +K+A F++++ KL+EL+ KY     + GG D++A IKSG+
Sbjct: 106 GERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELRKKYPNH--LIGGADLVARIKSGE 163

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           I VD  +K FATP+I PT+ SQ+ R+LGP+G++P+LKK    TV +D++SL+EE+LG + 
Sbjct: 164 IPVD-FDKAFATPDIVPTLQSQVARILGPRGVLPSLKK---GTVSDDINSLLEESLGSMP 219

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRGNS+S+ VG+C FSDR+IL+NII+ R+AFK +V++Q +KKP++L KTT+S+T GPG
Sbjct: 220 FRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPG 279

Query: 285 IVIDF 289
           IVIDF
Sbjct: 280 IVIDF 284

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  268 bits (684), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 129/245 (52%), Positives = 180/245 (73%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+QAKKRE+                 PLYMP+  ALRYLR+AEVGRP   QTI +TTLVV
Sbjct: 46  KDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVV 105

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
            ++G A L+G++ FP PL+ +KIA F++++ KL+EL+ KY     + GG D++A IKSG+
Sbjct: 106 GERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNH--LIGGADLVAKIKSGE 163

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           I VD  +K FATP+I P + SQ+ R+LGP+G++P++KK    TV +D+ SL++E+LG + 
Sbjct: 164 ISVD-FDKAFATPDIVPALQSQVARILGPRGVLPSVKK---GTVSDDISSLLQESLGSMP 219

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRGNS+S+ VG+C F+DR+IL+NII+ R AFK +V +Q +KKP+IL KTT+S+T GPG
Sbjct: 220 FRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPG 279

Query: 285 IVIDF 289
           IVIDF
Sbjct: 280 IVIDF 284

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  258 bits (658), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 122/245 (49%), Positives = 179/245 (73%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+QAKKRE+                 PL+MP+ +ALRYLR+AEVGRP   QTI +TTLVV
Sbjct: 46  KDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVV 105

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
            ++G A ++GN+ F  PL+ +K+A+F++++ KL EL+ KY     I GG D++A IK+ +
Sbjct: 106 GERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKYPNL--IVGGTDLVAKIKNNE 163

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
             VD  +K FATP+I PT+ SQ+ R+LGP+G++P++KK    TV +D+ SL++E+LG + 
Sbjct: 164 SPVD-FDKAFATPDIVPTLQSQVARILGPRGVLPSVKK---GTVSDDITSLLQESLGSMP 219

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRGN++S+ +G+C F+DR++L+NII+ R AF+ +V +Q AKKPS+L KTT+S+T GPG
Sbjct: 220 FRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAKKPSLLSKTTLSSTHGPG 279

Query: 285 IVIDF 289
           IVIDF
Sbjct: 280 IVIDF 284

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  256 bits (653), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 178/245 (72%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K++ K+RE+              + +PLYMPI  ALRYLR+AEVG+P   Q IT+TT VV
Sbjct: 42  KDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITTDVV 101

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           +++GN  L GNI +  P+K +KIA+FS++ EKL ++K +++    + GG D++  IKSGK
Sbjct: 102 SERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHN--CHLIGGTDLVEKIKSGK 159

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
             VD  +K FATP+I P + SQL RVLGP+G++P +KK    TV ED+ SLI+ ++G + 
Sbjct: 160 QPVD-FDKAFATPDISPMLTSQLARVLGPRGVLPTIKK---GTVSEDVSSLIKGSIGLMP 215

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQ GNS+SVSVGRCNFSD+ ILENIIAVR+A+  ++SSQ +KKPS+LGKTTI++T GPG
Sbjct: 216 FRQTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPG 275

Query: 285 IVIDF 289
           I IDF
Sbjct: 276 ITIDF 280

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  255 bits (651), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 178/245 (72%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           KEQ +KRE+              + HPLYMP+  ALRYLR+ EVG+P   QTIT+TTLVV
Sbjct: 27  KEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTTLVV 86

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           A++G   L GN+ F  PLK +K+A+F++++ +   +K KYS  V + GG D+++ IK+G+
Sbjct: 87  AERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYS--VHLVGGSDLVSQIKAGE 144

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           + +D  +K FATP+I P +ASQ+GR+LGP+GL+P  KK    TV EDL+ LI++++  V 
Sbjct: 145 VSID-FDKAFATPDIVPQLASQVGRILGPRGLLPTAKK---GTVAEDLEPLIKDSMSSVP 200

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRGNS+S+ V + +F+D+++LEN++A + AFKQS+++Q  KKPSIL +TT+++T GPG
Sbjct: 201 FRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPG 260

Query: 285 IVIDF 289
           IVIDF
Sbjct: 261 IVIDF 265

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  254 bits (649), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 173/245 (70%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           KEQ +KRE+              + HPLYMP PLALRYLR+ EVG P   Q ITVTT VV
Sbjct: 38  KEQLRKREVRRAARRKVEAKKPAHTHPLYMPTPLALRYLRAVEVGYPASQQVITVTTSVV 97

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           AD+GN  +AGN+  P PLK + +A+FS+++++L   + K+  +  + GG D+IA IK G+
Sbjct: 98  ADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKF--RCHLVGGSDIIAKIKQGE 155

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           I VD  +K FATP+I   + SQ+ R+LGPK ++P  K+    TV  DL+ LI+++ G + 
Sbjct: 156 IPVD-FDKAFATPDIAQELTSQVARILGPKQVLPMAKR---GTVASDLEPLIKDSFGSIP 211

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQ+GNS+S++V +C FSDR +LEN++AV+ AFK++VS+Q AK+PSILG+TT++TT GPG
Sbjct: 212 FRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPG 271

Query: 285 IVIDF 289
           IVID 
Sbjct: 272 IVIDL 276

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  251 bits (642), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 181/245 (73%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           KEQAKKRE+                +PLYMP+ +ALRYLR+AEVGRP   QTI +TTLVV
Sbjct: 46  KEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVV 105

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
            ++G A L+G++ FP PL+ +K+A+F++++ KL EL+ KY     + GG D+++ IK+G+
Sbjct: 106 GERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKELREKYPNH--LIGGADLVSRIKNGE 163

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           I VD  +K +AT +I P + SQ+ R+LGP+G++P++KK    TV +D+ SL++E+LG + 
Sbjct: 164 IPVD-FDKAYATADIVPALQSQVARILGPRGVLPSVKK---GTVSDDITSLLQESLGSMP 219

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRGNS+S+ +G+C F+DR++L+NIIA R AFK +VS Q +KKP+IL KTT+S+T GPG
Sbjct: 220 FRQRGNSISLGIGKCYFTDREVLQNIIAARAAFKAAVSDQKSKKPNILSKTTLSSTHGPG 279

Query: 285 IVIDF 289
           IVIDF
Sbjct: 280 IVIDF 284

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  248 bits (633), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 127/245 (51%), Positives = 177/245 (72%), Gaps = 7/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+Q KKRE+                HPLYM +P ALR+LR+AEVG+P   QTI +TTLVV
Sbjct: 40  KDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVV 99

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           ++KG+  LAG+I F  PLK++KIAIF++++ ++   K K++    + GG ++I+ IK+G+
Sbjct: 100 SEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFN--CYVVGGSELISKIKNGE 157

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           I+VD  +K FATP+I   + S + R+LGP+G+ P++KK    TV E+++ LI+ NLG + 
Sbjct: 158 IEVD-FDKAFATPDIVQELGS-VARILGPRGVFPSIKK---GTVSENVEDLIKGNLGSIP 212

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQ GN +SV++G+CNFSDR ILEN+I+VR AFK SVS+Q  KKPSILGKT +STT GPG
Sbjct: 213 FRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPG 272

Query: 285 IVIDF 289
           IVIDF
Sbjct: 273 IVIDF 277

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  246 bits (627), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 183/245 (74%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+Q KKRE+              + HPLYMP+  ALR+LR+AEVG+P   QT++VTT+V+
Sbjct: 42  KDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVI 101

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           +++G   L+GN+ FP+ LK++KIA+F++++++    + K++    + GG +++  IK G+
Sbjct: 102 SERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFN--CHVVGGSELVEKIKQGQ 159

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           + +D  +K FATPEI   +ASQLGR+LGP+GL+P  KK    TV E+L+SLI++++G + 
Sbjct: 160 VPLD-FDKSFATPEIATLLASQLGRILGPRGLLPAAKK---GTVSENLESLIKDSMGTLP 215

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRGN++S++VGRC+F+D+ +LENI+A + + K+++++Q AKKPS+LG+TT+++T GPG
Sbjct: 216 FRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPG 275

Query: 285 IVIDF 289
           IVIDF
Sbjct: 276 IVIDF 280

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  247 bits (630), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 173/245 (70%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           KEQ KKRE+              +IHPLYMP+  ALRY+R+AEVGRP+  QTIT+T+LVV
Sbjct: 75  KEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVV 134

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
            +KG A L G+I  P PLK +K+A+FS N+E L  +K KY     + GG ++I  IK+G+
Sbjct: 135 NEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKY--HCHLVGGVELINKIKNGE 192

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           +K D  +K FA+ ++   +++QLG+ LG +GL+PN KK    TV +DL+SL+ + +G + 
Sbjct: 193 VKTD-FDKAFASSDMANILSAQLGKTLGRRGLLPNAKK---GTVSDDLESLLADKIGSLP 248

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQ GN +S+ +G+C+FSD +IL NIIA R+A  +++S Q +KKPSILGKTT+S+T GPG
Sbjct: 249 FRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPG 308

Query: 285 IVIDF 289
           IVIDF
Sbjct: 309 IVIDF 313

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  245 bits (625), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 178/245 (72%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+Q K+RE+                HPLYMP+  ALR+LR+AEVG+P   QTI++TTLV+
Sbjct: 46  KDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVI 105

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           +++G   L GNI FP PLK +KIA+F+++++KL   + +++    + GG ++I  IK G+
Sbjct: 106 SERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFN--CHLVGGSELIEKIKKGE 163

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           + +D  +K FATP+I  ++ SQLGR+LGP+GL+PN KK    TV ED+ SLI++++G + 
Sbjct: 164 VPLD-FDKAFATPDIAISLTSQLGRILGPRGLLPNAKK---GTVTEDISSLIKDSMGTLP 219

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRGN +S++V +C+F+D  +LENI+A + +FK ++++Q AKKPSILG+TT++TT GPG
Sbjct: 220 FRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPG 279

Query: 285 IVIDF 289
           +VIDF
Sbjct: 280 LVIDF 284

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  244 bits (623), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 175/245 (71%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           KEQ KKRE+              N HPLYM +  ALR++R+AEVGRP   QTIT+TTL+V
Sbjct: 75  KEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTLIV 134

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           ++KG + L GN+    PLK++KIA+FS++KE L+E+KS+++ Q  + GG + +  IK G 
Sbjct: 135 SEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQ--LVGGNETVEGIKDGT 192

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           I+ +  +  FATPEI P I SQLG+ LG +G++PN KK    TV +DL +L+   +G + 
Sbjct: 193 IRAN-FDVAFATPEIVPFINSQLGKQLGRRGILPNTKK---GTVSDDLVTLMNAKMGNIP 248

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           F+Q GN++S+ +G+C FSD+DIL NIIA R+AFK+++++Q AK+PSIL KTT+S+T GPG
Sbjct: 249 FKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPG 308

Query: 285 IVIDF 289
           IVIDF
Sbjct: 309 IVIDF 313

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  238 bits (607), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 118/246 (47%), Positives = 173/246 (70%), Gaps = 6/246 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           KEQ KK+E+                HPLYMP+  A R+LR+AEVG+P   QTI++TT+VV
Sbjct: 36  KEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVV 95

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           +DKG   L+GNILFP+PL+ +K+A+F++NKE+ +  + ++  +  + GG ++I  IK+G 
Sbjct: 96  SDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQF--KCHLVGGTELIEAIKNGD 153

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
             +D  +K  ATP++   + SQL  VLGP+ L+P +KK    TV E++ +LI EN+  V 
Sbjct: 154 TPID-FDKALATPDVVAQLTSQLASVLGPRRLLPAVKK---GTVSENIANLIRENMFTVP 209

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRG  LSV+VG+C+FSD+ +L+NI+AV+ AFKQ+++ Q  KK SILGKTT+++T GPG
Sbjct: 210 FRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPG 269

Query: 285 IVIDFQ 290
           IVIDF+
Sbjct: 270 IVIDFR 275

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  238 bits (607), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 173/245 (70%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+Q +KRE+                HPLYMP+  ALR+LR+AE G+P   QT++VTT+V+
Sbjct: 42  KDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVI 101

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           +++G   L+GN+ FP PLK +KIA+F++++++    + K+     + GG D++  IK G 
Sbjct: 102 SERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFG--CHLVGGSDLVEKIKEGA 159

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           + +D  +K FATPEI   +ASQLGR+LGP+GL+P  KK    TV E+L+ L++ ++G + 
Sbjct: 160 VSLD-FDKSFATPEITTLLASQLGRILGPRGLLPAAKK---GTVAENLEPLLKNSMGTLP 215

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRGN +SV+VG+C+F+D+ +LENI+A +   K+++++Q  KKPS+LG+TT+++T GPG
Sbjct: 216 FRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPG 275

Query: 285 IVIDF 289
           IVIDF
Sbjct: 276 IVIDF 280

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  236 bits (603), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 172/245 (70%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+Q KKRE+              +  PLYMP+  ALR+LR+AEVG+P   QTI+V T+V+
Sbjct: 35  KDQLKKRELRRLAQRKAAARRPASASPLYMPVQQALRFLRAAEVGQPATQQTISVNTMVI 94

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
            DKG A L+G +  P P+++ K+A+F+++ E+ +  ++KY     + GG +++  +KSG+
Sbjct: 95  GDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETARTKYG--CYLVGGAELVEQLKSGE 152

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           +KVD  +K FATP+I P +A++LGRVLGPKGL+P++KK    TV  DL  L+ +++    
Sbjct: 153 VKVD-FDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKK---GTVAGDLSELLGDDINSTP 208

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           F+QR N +S+++G+C+FSDR I+EN++AV+ AF+ +++SQ  KK S+ G TT+++T GPG
Sbjct: 209 FKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQKTKKTSLFGTTTLTSTHGPG 268

Query: 285 IVIDF 289
           IVIDF
Sbjct: 269 IVIDF 273

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  234 bits (597), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 180/245 (73%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+Q KKRE+              + HPLYM IP+ALR+LR+AEVG+P   QTIT+TT VV
Sbjct: 37  KDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPMALRFLRAAEVGQPQTQQTITLTTAVV 96

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           A++G  ALAG++ FP PLK++KIA+FS ++++L   + K++    + GG ++I  IKSG+
Sbjct: 97  AERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLKVAREKFN--CHLVGGTEIIEKIKSGE 154

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           I VD  +K FATP+I P + SQL R+LGP+G++P +KK    TV  D+  L+++++G + 
Sbjct: 155 IPVD-FDKAFATPDIAPALTSQLARILGPRGVLPTVKK---GTVATDVSRLVQDSMGSMP 210

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQRGN++S++VG+ +FSDR ILEN IA  +A K+++++QV+KK S+LGKTT+S+T GPG
Sbjct: 211 FRQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQVSKKTSLLGKTTLSSTHGPG 270

Query: 285 IVIDF 289
           IVIDF
Sbjct: 271 IVIDF 275

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  214 bits (544), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 160/245 (65%), Gaps = 5/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           K+QAKK+ +              + HPLYM +P ALR+LR+ EVG+P   QTIT+TTLV+
Sbjct: 40  KQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVI 99

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           ++KG   + GN+  P PL+  K+ + S + +KL+E++  + K V + GG +++   K+  
Sbjct: 100 SEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNF-KNVHLVGGRELVDKFKNED 158

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           I++D  +KV ATP+I       LG++ GPKGL+PN+KK    TV E+L  L+ EN+  + 
Sbjct: 159 IEID-FDKVVATPDILNYTNQNLGKMFGPKGLLPNVKK---GTVSENLIELMNENVSSMP 214

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQR   +S+ +G+  FSD+ ILENIIA R AF  ++S+Q  KK S LGKTT+++T GPG
Sbjct: 215 FRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPG 274

Query: 285 IVIDF 289
           IVIDF
Sbjct: 275 IVIDF 279

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  209 bits (533), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 165/245 (67%), Gaps = 6/245 (2%)

Query: 45  KEQAKKREMXXXXXXXXXXXXXXNIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104
           KEQ ++RE+              +   +Y+ +P A+R LR+ EVG+PT  QTIT+TT+VV
Sbjct: 46  KEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTMVV 105

Query: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164
           ++KG   L G+++ P PLK ++IA FS++ E L  L+ +   +++I GG ++I  +KSG+
Sbjct: 106 SEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEV--ELEIVGGAELIDQLKSGE 163

Query: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224
           + V   +K FATP+I P + S+LG +LG +GL+PN+KK    TVG DL ++I   +G + 
Sbjct: 164 VPVQ-FDKAFATPDIAPQLNSKLGALLGRRGLLPNIKK---GTVGPDLLAMIRSKVGAMP 219

Query: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284
           FRQR  +L+  + +C+FSDR +L N+IA R AF+ ++ +Q +KK SILG++T+S+T GPG
Sbjct: 220 FRQRAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPG 279

Query: 285 IVIDF 289
           IVID 
Sbjct: 280 IVIDL 284

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  146 bits (369), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 137/222 (61%), Gaps = 12/222 (5%)

Query: 70  HPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPHPLKQMKIAI 129
           HPL M +PLALRYLR+ E GR +  QT+T+ T+V A +GN  L G I F   +++  IA+
Sbjct: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88

Query: 130 FSSNKEKLDELKSKYSKQ--VKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQL 187
           F+ + E+      K +K+  + I GG ++I  I SG+ K+      FAT ++   +A ++
Sbjct: 89  FTEDPEQ-----HKIAKEMGIDIIGGSELIDKIASGEQKIT-FQTAFATTDMVQDLA-RV 141

Query: 188 GRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCNFSDRDIL 247
            + LG + ++P LKK+   TVG+++  L+++ L  V F ++ + +S  VG+C+F+D +IL
Sbjct: 142 AQKLGKQKVLPQLKKK---TVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEIL 198

Query: 248 ENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPGIVIDF 289
            N+I  R   ++++  Q  KKPS + K T+++T GPGI ID 
Sbjct: 199 RNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>CAGL0J00473g Chr10 (39305..40402) [1098 bp, 365 aa] {ON} similar to
           uniprot|P38779 Saccharomyces cerevisiae YHR052w
          Length = 365

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 6/52 (11%)

Query: 228 RGNSLSVSVGRCN-FSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTIS 278
           RGN L+V +GR N F+D +I++NI +V +A  +      AK  +I+ KTT S
Sbjct: 215 RGNMLNVHLGRVNWFTDEEIIDNIESVADALIKD-----AKIRNIMLKTTTS 261

>Smik_12.59 Chr12 (128051..129904) [1854 bp, 617 aa] {ON} YLL004W
           (REAL)
          Length = 617

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 53/107 (49%), Gaps = 6/107 (5%)

Query: 176 TPEIFPTIASQL-GRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSV 234
           T  IFP+  S L   +L  + ++P+L K+   T  EDLD+++   +GQ+    R  ++++
Sbjct: 477 TQSIFPSYKSNLEDNLLSWEQVLPSLNKEVNGTASEDLDNIMAPVVGQLFKLYREANMTI 536

Query: 235 SVGRCNFSDRDILENIIAVRNAFKQSVSS----QVAKKPSILGKTTI 277
           ++     + R+ L     + N  KQ  S+     +A+ P    K T+
Sbjct: 537 NIYDFYTAFRETLPE-KEILNFIKQDPSNSKLLDLAEAPDAFEKVTL 582

>YLL004W Chr12 (141073..142923) [1851 bp, 616 aa] {ON}  ORC3Subunit
           of the origin recognition complex, which directs DNA
           replication by binding to replication origins and is
           also involved in transcriptional silencing
          Length = 616

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 176 TPEIFPTIASQL-GRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSV 234
           T  IFP+  S +   +L  + ++P+L K++ +T+  DLD ++   LGQ+    R  ++++
Sbjct: 476 TQSIFPSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTI 535

Query: 235 SVGRCNFSDRDILENIIAVRNAF-KQSVSSQVAKKPS 270
           +          I +  IA R    K+ + + + K PS
Sbjct: 536 N----------IYDFYIAFRETLPKEEILNFIRKDPS 562

>TPHA0E02540 Chr5 (539071..541722) [2652 bp, 883 aa] {ON} Anc_3.544
           YGL227W
          Length = 883

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 58/136 (42%), Gaps = 27/136 (19%)

Query: 170 VNKVFATPEIFPTIASQLGRVLGPKGLMPN-----LKKQHQNTVGEDLDSLI-------- 216
           +N + A+ EI      QLGR L  K +  +     LK   +NT+ +DL  L+        
Sbjct: 730 LNTILASSEITIIDIIQLGRELSNKFVYSSSISEVLKPTFKNTL-DDLSRLLVYEDPVND 788

Query: 217 ----------EENLGQVSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVA 266
                      E L +  F+    S+   +   N  + D LENII+      Q++S Q  
Sbjct: 789 APGELKKYLSSEYLKERLFQIVNTSI---LNHLNKGNEDSLENIISYTRTMLQTMSEQNI 845

Query: 267 KKPSILGKTTISTTAG 282
           K PS+  K+TI + + 
Sbjct: 846 KNPSVANKSTIESDSN 861

>TDEL0D02800 Chr4 complement(534568..535719) [1152 bp, 383 aa] {ON}
           Anc_4.172 YGR031W
          Length = 383

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 27/129 (20%)

Query: 154 EDMIAD-IKSGKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDL 212
           ED+++D I S K+  D +N    T +  P  AS    V+   GL  N  + +  T+G +L
Sbjct: 83  EDLLSDSIPSVKLAFDLIND--HTCQFIPEKAS----VIVLHGLFGN--RMNNRTIGREL 134

Query: 213 DSLIEENLGQVSFRQRGNSLSVSVGRCNFS------DRDILENIIAVRNAFKQSVSSQVA 266
           + L+E ++     R  G   S  +GR +++      +R I ENI+          +   A
Sbjct: 135 NELLERDVYLPDLRNHG--ASPHIGRHDYTAMALDVERFIRENIL----------THPDA 182

Query: 267 KKPSILGKT 275
           K+P I+G +
Sbjct: 183 KRPIIIGHS 191

>Ecym_2079 Chr2 complement(135814..137352) [1539 bp, 512 aa] {ON}
           similar to Ashbya gossypii ADL139W
          Length = 512

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 69/175 (39%), Gaps = 25/175 (14%)

Query: 130 FSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQLGR 189
           +++N     ++   Y+KQ K+    D I   K G I    V  V+A P   P +  Q G 
Sbjct: 206 YNNNPHLHKDISQNYNKQFKM----DKIP--KQGSIPPLAVQPVYAHPGWIPMVTDQAGN 259

Query: 190 VLGPKGLMPNLKKQHQNTV--GEDLDS--LIEENLGQ-----VSFRQRGNSLSVS----- 235
            +G   L P  K ++   +  G D D+  ++ +N G      V+  ++GN + V      
Sbjct: 260 HIGVD-LAPGPKGKYAQVILFGRDFDTKFVVADNWGDFLLNFVNDLEKGNWVFVDNTDDY 318

Query: 236 ---VGRCNFSDRDILENIIAVRNAFKQSVSSQVAK-KPSILGKTTISTTAGPGIV 286
               G   F D+     I+      K+ V     K KP +    + S  + P + 
Sbjct: 319 LNGEGDLMFIDKSTRGPILEYMGVLKKRVWDNWQKTKPMVSAPGSASNASNPALT 373

>Kwal_33.13503 s33 (254111..256540) [2430 bp, 809 aa] {ON} YNL256W
           (FOL1) - dihydroneopterin aldolase,
           dihydro-6-hydroxymethylpterin pyrophosphokinase,
           dihydropteroate synthetase [contig 116] FULL
          Length = 809

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 137 LDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGL 196
           +D  +SK + ++ I  G D++ DI  G+       ++FAT   +PT+A  +    G    
Sbjct: 591 IDTYRSKVA-EMAIEAGVDLVNDISGGQFD----PEMFATIAKYPTVAYAMSHTRGDIST 645

Query: 197 MPNLKK 202
           M  L K
Sbjct: 646 MSKLTK 651

>ZYRO0B01606g Chr2 complement(131244..131963) [720 bp, 239 aa] {ON}
           similar to uniprot|Q02204 Saccharomyces cerevisiae
           YKR006C MRPL13 Mitochondrial ribosomal protein of the
           large subunit not essential for mitochondrial
           translation
          Length = 239

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 140 LKSKYSKQVKIAGGEDMIADIKSGKIKVDGVN 171
            KSK  ++V++   +D+I DI+SGK + D  N
Sbjct: 25  FKSKKQQEVQVQDTKDVIKDIESGKAQTDSGN 56

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,443,982
Number of extensions: 918576
Number of successful extensions: 3081
Number of sequences better than 10.0: 39
Number of HSP's gapped: 3125
Number of HSP's successfully gapped: 39
Length of query: 290
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 182
Effective length of database: 41,097,471
Effective search space: 7479739722
Effective search space used: 7479739722
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)