Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B01793g8.267ON98984972e-66
TPHA0A017708.267ON1041022413e-27
Kwal_56.237768.267ON130912424e-27
Kpol_543.428.267ON112772283e-25
NCAS0B038208.267ON1151052267e-25
SAKL0H16918g8.267ON111952232e-24
KLTH0G13574g8.267ON112902205e-24
KAFR0B054908.267ON85722185e-24
KNAG0H032208.267ON86542116e-23
Ecym_43038.267ON109872092e-22
TDEL0F039408.267ON110892093e-22
Smik_4.3598.267ON105532065e-22
NDAI0J013408.267ON141502095e-22
Suva_2.2748.267ON105502056e-22
Skud_4.3758.267ON105502057e-22
YDR115W8.267ON105502031e-21
ZYRO0C01540g8.267ON97501961e-20
KLLA0F19250g8.267ON116961962e-20
AGR081C8.267ON130501972e-20
TBLA0E044708.267ON94751934e-20
KLTH0A02332g8.83ON117957651.2
ZYRO0A00858g8.860ON31466604.1
Skud_13.342singletonON116527605.6
TPHA0A025801.141ON137831605.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B01793g
         (98 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...   196   2e-66
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    97   3e-27
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    98   4e-27
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    92   3e-25
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    92   7e-25
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    91   2e-24
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    89   5e-24
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    89   5e-24
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    86   6e-23
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    85   2e-22
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    85   3e-22
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    84   5e-22
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    85   5e-22
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    84   6e-22
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    84   7e-22
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    83   1e-21
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    80   1e-20
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    80   2e-20
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    80   2e-20
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    79   4e-20
KLTH0A02332g Chr1 complement(196782..200321) [3540 bp, 1179 aa] ...    30   1.2  
ZYRO0A00858g Chr1 (60861..61805) [945 bp, 314 aa] {ON} no simila...    28   4.1  
Skud_13.342 Chr13 (586679..590176) [3498 bp, 1165 aa] {ON} YMR17...    28   5.6  
TPHA0A02580 Chr1 complement(552345..556481) [4137 bp, 1378 aa] {...    28   5.8  

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
          similarities with uniprot|Q04598 Saccharomyces
          cerevisiae YDR115w
          Length = 98

 Score =  196 bits (497), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%)

Query: 1  MLSSSFGVLRPMNLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQ 60
          MLSSSFGVLRPMNLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQ
Sbjct: 1  MLSSSFGVLRPMNLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQ 60

Query: 61 PSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
          PSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH
Sbjct: 61 PSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 97.4 bits (241), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 69/102 (67%), Gaps = 6/102 (5%)

Query: 2   LSSSFGVLRPMNLTPGNGMIG--KNSVSLIRNEISSGTSFSSILTL---FPLQRRWKSRG 56
           L+ SF  L    + P N ++   KNS+ L  N I S T  +SIL L     LQRRWKSRG
Sbjct: 4   LTRSFNQLMTGRVIPNNTLVDSIKNSI-LGGNAIGSRTGLASILGLNLDLGLQRRWKSRG 62

Query: 57  NTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           NTYQPSTLKRKR+ GFLAR  +K+  KI++RRK KGRWYLTH
Sbjct: 63  NTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 97.8 bits (242), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 71/91 (78%), Gaps = 5/91 (5%)

Query: 13  NLTPGNGMIGKNSVSLIRNEISSGTSFSS----ILTLFPL-QRRWKSRGNTYQPSTLKRK 67
           + +P N  + ++ VS + N I++G+S S+    + +LF L Q+RWKSRGNTYQPSTLKRK
Sbjct: 40  SFSPLNVCMFRSPVSQVNNSIATGSSSSAMPSYLSSLFGLTQKRWKSRGNTYQPSTLKRK 99

Query: 68  RKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           R+ GFLAR+ +K+ +KI+KRR+EKGRWYLTH
Sbjct: 100 RRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 92.4 bits (228), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 58/77 (75%), Gaps = 1/77 (1%)

Query: 22  GKNSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRT 81
           G NSV L     ++ T  S+I  L  LQRRWKSRGNTYQPSTLKRKRKFGFLAR  ++  
Sbjct: 37  GLNSVGLFPGT-ATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSG 95

Query: 82  AKIIKRRKEKGRWYLTH 98
           +KI++RRK KGRWYL+H
Sbjct: 96  SKILERRKAKGRWYLSH 112

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 91.7 bits (226), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 64/105 (60%), Gaps = 15/105 (14%)

Query: 9   LRPMNLTPGN---GMIGKNSVSLIR------------NEISSGTSFSSILTLFPLQRRWK 53
           LRP+ L  G     M   +S+ LIR            N +S      S+L    LQRRWK
Sbjct: 11  LRPVTLGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLLPFGILQRRWK 70

Query: 54  SRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           SRGNTYQPSTLKRKRKFGFLA+  + +  KI+KRR+ KGRWYLTH
Sbjct: 71  SRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 90.5 bits (223), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/95 (55%), Positives = 66/95 (69%), Gaps = 4/95 (4%)

Query: 4   SSFGVLRPMNLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPST 63
           SSF  LR +N      ++  N+  L +++    +S  +IL L   QRRWKSRGNTYQPST
Sbjct: 21  SSFSPLRSLN---SQALVNHNNPLLSQSQSQQPSSIMNIL-LGLTQRRWKSRGNTYQPST 76

Query: 64  LKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           LKRKR+ GFLAR  NK+ +KI+K RKEKGRWYLTH
Sbjct: 77  LKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 89.4 bits (220), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (66%), Gaps = 4/90 (4%)

Query: 11  PMNLTPGNGMIGKNSVSLIRNEISSGTS--FSSILTLFPLQRRWKSRGNTYQPSTLKRKR 68
           P+N       + + +  +     S G+S  FS++      QRRWKSRGNTYQPSTLKRKR
Sbjct: 25  PLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFGF--TQRRWKSRGNTYQPSTLKRKR 82

Query: 69  KFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           + GFLAR  +K+  K++KRR+EKGRWYLTH
Sbjct: 83  RVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa]
          {ON} Anc_8.267 YDR115W
          Length = 85

 Score = 88.6 bits (218), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 27 SLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIK 86
          S+I N + S   F  IL  F  Q+RWKSRGNTYQPSTLKRKRKFGFL+R  +K+ +KI+K
Sbjct: 16 SVILNTVQSTNVFF-ILPFFG-QKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILK 73

Query: 87 RRKEKGRWYLTH 98
           RKEKGRWYL+H
Sbjct: 74 DRKEKGRWYLSH 85

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
          Anc_8.267 YDR115W
          Length = 86

 Score = 85.9 bits (211), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%)

Query: 45 LFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
          +  L RRWKSRGNTYQPSTLKRKRKFGFLAR+     +K++KRRKEKGRWYL+H
Sbjct: 33 VVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 85.1 bits (209), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/87 (52%), Positives = 59/87 (67%), Gaps = 1/87 (1%)

Query: 13  NLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPL-QRRWKSRGNTYQPSTLKRKRKFG 71
           + +P   ++   + S     +S+    S I  +F L QRRWKSRGNT+QPSTLKRKR+ G
Sbjct: 23  SFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQPSTLKRKRRVG 82

Query: 72  FLARMTNKRTAKIIKRRKEKGRWYLTH 98
           FLAR  +K   KI+KRRKEKGRWYLT+
Sbjct: 83  FLARARSKTGQKILKRRKEKGRWYLTY 109

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 85.1 bits (209), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 60/89 (67%), Gaps = 3/89 (3%)

Query: 13  NLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFP---LQRRWKSRGNTYQPSTLKRKRK 69
           + +P   +  +N    +     + +  SSI  LFP   +QRRWKSRGNT+QPSTLKRKR+
Sbjct: 22  SFSPLRSLFAQNKSQGLLGVPETHSPLSSISLLFPFGIMQRRWKSRGNTFQPSTLKRKRR 81

Query: 70  FGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
            GFLAR  +K  +++++RRK KGRWYLT+
Sbjct: 82  IGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 84.0 bits (206), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (86%)

Query: 46  FPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           F  QRRWKSRGNTYQPSTLKRKR FGFLAR  +K+ +KI+KRRK KGRW+L+H
Sbjct: 53  FIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 85.1 bits (209), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 47/50 (94%)

Query: 49  QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           Q+RWKSRGNTYQPSTLKRKRK+GFL+RM +++ +KI+KRRK KGRW+L+H
Sbjct: 92  QKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 83.6 bits (205), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%)

Query: 49  QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           QRRWKSRGNTYQPSTLKRKR FGFLAR  +K+ +KI+KRRK KGRW+L+H
Sbjct: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 83.6 bits (205), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%)

Query: 49  QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           QRRWKSRGNTYQPSTLKRKR FGFLAR  +K+ +KI+KRRK KGRW+L+H
Sbjct: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 82.8 bits (203), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%)

Query: 49  QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           QRRWKSRGNTYQPSTLKRKR FGFLAR  +K+ +KI+KRRK KGRW+L+H
Sbjct: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
          similar to uniprot|Q04598 Saccharomyces cerevisiae
          YDR115W
          Length = 97

 Score = 80.1 bits (196), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%)

Query: 49 QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
          QRRWKSRGNT+QPSTLKRKR+ GFLAR  +K+ +KI++RRK KGRW+LTH
Sbjct: 48 QRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 80.1 bits (196), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 4   SSFGVLRPMNLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPL-QRRWKSRGNTYQPS 62
           SSF  LR ++      +   N + +     +     S    LF L QRRWKSRGNT+QPS
Sbjct: 21  SSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFGMLFDLTQRRWKSRGNTFQPS 80

Query: 63  TLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           TLKRKR+ GFLAR  ++   +I+KRRK KGRWYLT+
Sbjct: 81  TLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 80.5 bits (197), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%)

Query: 49  QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98
           Q+RWKSRGNTYQPSTLKRKR+ GFLAR  ++    I+KRR+EKGRWYLTH
Sbjct: 81  QKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON}
          Anc_8.267 YDR115W
          Length = 94

 Score = 79.0 bits (193), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 41/75 (54%), Positives = 50/75 (66%)

Query: 24 NSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAK 83
          NS+SL+   +    +      L    RRWKSRGNTYQPSTLKRKRK GFL+R  +    K
Sbjct: 20 NSMSLLNKSLLINNNIIGNNKLMIDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNK 79

Query: 84 IIKRRKEKGRWYLTH 98
          I+KRRK KGRW+L+H
Sbjct: 80 ILKRRKAKGRWFLSH 94

>KLTH0A02332g Chr1 complement(196782..200321) [3540 bp, 1179 aa]
           {ON} similar to uniprot|Q12200 Saccharomyces cerevisiae
           YPL006W NCR1 Vacuolar membrane protein that transits
           through the biosynthetic vacuolar protein sorting
           pathway involved in sphingolipid metabolism glycoprotein
           homologous to human Niemann Pick C1 (NPC) protein
          Length = 1179

 Score = 29.6 bits (65), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 24  NSVSLIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKR 80
           ++VSL+ N +   +++ SILTL+  +R + +  NT    +   K K  ++  +T KR
Sbjct: 705 SAVSLVFNVLLQLSAYVSILTLY--ERTFSATENTVSSESTPSKLKSAYVELLTKKR 759

>ZYRO0A00858g Chr1 (60861..61805) [945 bp, 314 aa] {ON} no
           similarity
          Length = 314

 Score = 27.7 bits (60), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 13/66 (19%)

Query: 28  LIRNEISSGTSFSSILTLFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKR 87
           +I  +++      SI + FPL+ R+     TY           G++ R+TNKRT   I  
Sbjct: 236 MIELDVNPNLVIPSIPSYFPLEARFSKLPGTY-----------GYMRRLTNKRTE--IPE 282

Query: 88  RKEKGR 93
           + E  R
Sbjct: 283 QDEVER 288

>Skud_13.342 Chr13 (586679..590176) [3498 bp, 1165 aa] {ON} YMR176W
            (REAL)
          Length = 1165

 Score = 27.7 bits (60), Expect = 5.6,   Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 71   GFLARMTNKRTAKIIKRRKEKGRWYLT 97
            G L R   +R AK+IKR +E GR  +T
Sbjct: 1135 GPLTRYCQERDAKVIKRLEENGRTIIT 1161

>TPHA0A02580 Chr1 complement(552345..556481) [4137 bp, 1378 aa] {ON}
           Anc_1.141 YCR033W
          Length = 1378

 Score = 27.7 bits (60), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 31  NEISSGTSFSSILTLFPLQRRWKSRGNTYQP 61
           N++S  T F+S     PLQ +WK+   TY P
Sbjct: 206 NDLSKDTQFNSQRNSLPLQNKWKT---TYSP 233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,259,628
Number of extensions: 383060
Number of successful extensions: 1003
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1002
Number of HSP's successfully gapped: 30
Length of query: 98
Length of database: 53,481,399
Length adjustment: 69
Effective length of query: 29
Effective length of database: 45,569,445
Effective search space: 1321513905
Effective search space used: 1321513905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)