Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B01771g8.262ON53652228250.0
TDEL0F038908.262ON4763857454e-92
KAFR0B055408.262ON5193836971e-84
SAKL0H17028g8.262ON5503866973e-84
Kwal_56.237998.262ON4883886863e-83
AGR086C8.262ON5344476615e-79
ZYRO0C01650g8.262ON5864046551e-77
YDR110W (FOB1)8.262ON5664126497e-77
Smik_4.3568.262ON5764306497e-77
Suva_2.2708.262ON6324286458e-76
NDAI0J013808.262ON6243936441e-75
KLTH0G13684g8.262ON5083906333e-75
Ecym_43088.262ON5294346311e-74
Skud_4.3718.262ON5803896252e-73
Kpol_392.68.262ON4573866032e-71
Kpol_543.388.262ON4423565742e-67
NCAS0B038508.262ON5883885712e-65
KLLA0F19140g8.262ON5274645576e-64
KNAG0H032408.262ON5194125382e-61
TBLA0E044308.262ON4814015128e-58
TPHA0J007408.262ON4083774193e-45
TPHA0A018108.262ON4573264119e-44
TBLA0F030708.262ON4453933633e-37
KLLA0F19514g8.278ON739137770.84
TPHA0F003604.39ON115156724.1
TDEL0C014907.398ON107363714.8
TPHA0H001508.171ON64982705.6
Suva_2.317.414ON46839697.5
NDAI0J030104.375ON1655138698.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B01771g
         (536 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...  1092   0.0  
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   291   4e-92
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   273   1e-84
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   273   3e-84
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   268   3e-83
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   259   5e-79
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   256   1e-77
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   254   7e-77
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   254   7e-77
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   253   8e-76
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   252   1e-75
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   248   3e-75
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   247   1e-74
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   245   2e-73
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   236   2e-71
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   225   2e-67
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   224   2e-65
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   219   6e-64
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   211   2e-61
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   201   8e-58
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   166   3e-45
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   162   9e-44
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   144   3e-37
KLLA0F19514g Chr6 complement(1804838..1807057) [2220 bp, 739 aa]...    34   0.84 
TPHA0F00360 Chr6 (80013..83468) [3456 bp, 1151 aa] {ON} Anc_4.39...    32   4.1  
TDEL0C01490 Chr3 complement(256744..259965) [3222 bp, 1073 aa] {...    32   4.8  
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    32   5.6  
Suva_2.31 Chr2 complement(57816..59222) [1407 bp, 468 aa] {ON} Y...    31   7.5  
NDAI0J03010 Chr10 (748394..753361) [4968 bp, 1655 aa] {ON} Anc_4...    31   8.0  

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/522 (100%), Positives = 522/522 (100%)

Query: 1   MVKSAKKTGTQDVDAIMKMNGTNLPSERPKFDIDGFRATKRRPAGTSNMSSTELELYNKF 60
           MVKSAKKTGTQDVDAIMKMNGTNLPSERPKFDIDGFRATKRRPAGTSNMSSTELELYNKF
Sbjct: 1   MVKSAKKTGTQDVDAIMKMNGTNLPSERPKFDIDGFRATKRRPAGTSNMSSTELELYNKF 60

Query: 61  VMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMET 120
           VMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMET
Sbjct: 61  VMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMET 120

Query: 121 VMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNG 180
           VMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNG
Sbjct: 121 VMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNG 180

Query: 181 HLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERV 240
           HLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERV
Sbjct: 181 HLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERV 240

Query: 241 HIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVD 300
           HIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVD
Sbjct: 241 HIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVD 300

Query: 301 NIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKRF 360
           NIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKRF
Sbjct: 301 NIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKRF 360

Query: 361 KTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKKLKY 420
           KTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKKLKY
Sbjct: 361 KTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKKLKY 420

Query: 421 IEQSFSENIKTYPKSGGCIFIEHVQDYEKTMESIDRTGTYKSGRKADQLPAEDTPTSHEP 480
           IEQSFSENIKTYPKSGGCIFIEHVQDYEKTMESIDRTGTYKSGRKADQLPAEDTPTSHEP
Sbjct: 421 IEQSFSENIKTYPKSGGCIFIEHVQDYEKTMESIDRTGTYKSGRKADQLPAEDTPTSHEP 480

Query: 481 VANTTAINNRSTKANKLNGPNLRKRTKEITEIPMSDSDDDEP 522
           VANTTAINNRSTKANKLNGPNLRKRTKEITEIPMSDSDDDEP
Sbjct: 481 VANTTAINNRSTKANKLNGPNLRKRTKEITEIPMSDSDDDEP 522

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  291 bits (745), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 151/385 (39%), Positives = 233/385 (60%), Gaps = 21/385 (5%)

Query: 58  NKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLT 117
           ++F+ P++ E+Y++Y    +S ++++ L+RGE+D+ ++ E + G++    Y L+  N+LT
Sbjct: 37  SQFLAPSMGESYKEY---ANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLT 93

Query: 118 METVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHL 177
            ET+    + W  ++AE+KY  L++R+Y +  G +RD +  + IV EP  +F+LI+ AHL
Sbjct: 94  PETLASNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHL 152

Query: 178 KNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPL 237
            N H+    ++ CL ++Y+N TRDFVQ A+ YC+ CNPD + +P+EK RH+NI + LLPL
Sbjct: 153 MNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPL 212

Query: 238 ERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKT 297
           ERVHIE+F  F+ E               I  K+++V YCRD+ TR+VW  PLKN KFK 
Sbjct: 213 ERVHIEIFEVFDNES--------------ISNKFTNVLYCRDYHTRFVWLAPLKNTKFKH 258

Query: 298 LVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGI 357
           LV  + T  + + Y  PIF+ESST+D+ DL +I E L  KY +KLGLG  + ++FH  GI
Sbjct: 259 LVSAVGTLLLGMTY-VPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGI 317

Query: 358 KRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKK 417
           KR K  L+  K +C  DW MCL+ G Y  NR      G   N L         +  R K+
Sbjct: 318 KRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQ 377

Query: 418 LKYIEQSFSENIKTYPKSGGCIFIE 442
              I++  ++N+    K  G +++E
Sbjct: 378 EMIIDELPAQNVVHVNK--GLLYLE 400

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  273 bits (697), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 142/383 (37%), Positives = 220/383 (57%), Gaps = 20/383 (5%)

Query: 60  FVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTME 119
           +++P + E+Y  Y    DS ++++ LKRGE+++ +F + + G LT+ETY L+  ++LT E
Sbjct: 47  YIVPRMGESYTSYT---DSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPE 103

Query: 120 TVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKN 179
           T+      W    AE +Y  L +R+Y+D  G I D    + IV EP  +F++I+  HL N
Sbjct: 104 TLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMN 163

Query: 180 GHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLER 239
            H     +   L   Y+N TRD    AL +C+ CNP++ I  +EK +HRNI  EL+PLER
Sbjct: 164 NHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLER 223

Query: 240 VHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLV 299
           VHIE+F PF  E              KIE KYSH+ YCRD+ +RY+W  PLKN KFK LV
Sbjct: 224 VHIEIFEPFPNE--------------KIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLV 269

Query: 300 DNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKR 359
             +A+ F++ +   PIF+E++++D  D+ +I E +A +Y L++GLG +    FHA GI++
Sbjct: 270 PTMASLFLSFIRQ-PIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQ 328

Query: 360 FKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKKLK 419
            K  L   + EC   W +CLK G+Y  N     + G     L +  + +     ++K ++
Sbjct: 329 MKAKLEAHREECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQ 388

Query: 420 YIEQSFSENIKTYPKSGGCIFIE 442
            +E + SE++       G IF+E
Sbjct: 389 ILENAVSESVLRV--DNGLIFLE 409

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  273 bits (697), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 146/386 (37%), Positives = 222/386 (57%), Gaps = 18/386 (4%)

Query: 58  NKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLT 117
           N +V P L E+   Y     + ++V+ L+RG +D  ++ E + G+LTQ  Y L+  + LT
Sbjct: 24  NDYVTPKLGESQVTY----STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLT 79

Query: 118 METVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHL 177
           +ET++   +   P+ AE KY  L +R+Y D +  +RD K D+ IV EP+ ++ LI++ HL
Sbjct: 80  LETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHL 139

Query: 178 KNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPL 237
            N HL    L + L+  Y+N TRDFVQ    YC+ CNP   +KP  K +H N  + LLPL
Sbjct: 140 LNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPL 199

Query: 238 ERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKT 297
           ER+H+E+F PF  +E              IE KYSHV YCRD+ +R+VW  PL  + F+ 
Sbjct: 200 ERIHVEIFKPFGTDE-------------LIEEKYSHVLYCRDYHSRFVWLSPLTGITFQE 246

Query: 298 LVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGI 357
           LV  +  F ++ L   PIF+E++T+DR D+ ++ E +A KY L +GLG  N + F+  GI
Sbjct: 247 LVPQLTEFLLS-LPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGI 305

Query: 358 KRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKK 417
           +R K  L   K +CA DW MCLK G+Y  N     ++   SN L    +    +  + K+
Sbjct: 306 ERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKR 365

Query: 418 LKYIEQSFSENIKTYPKSGGCIFIEH 443
            K I + F+ N+ T   +GG +++E+
Sbjct: 366 EKIIHELFAHNVVTLKDTGGMVYVEN 391

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  268 bits (686), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 213/388 (54%), Gaps = 25/388 (6%)

Query: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118
           KF MP + ET E Y  G    ++ + L RG  D  ++ E + G+LTQE + L+ ++ LT 
Sbjct: 18  KFRMPKVGETLEKYGNG----LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTA 73

Query: 119 ETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLK 178
           E +M   +       ETK+  L +RFY D +G +RD K D+ +V EP+ LF+LI+  HLK
Sbjct: 74  ENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLK 133

Query: 179 NGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLE 238
           NGH+    L   LR  YAN TR F Q  + YC+ CNP+  ++P  K RH NI   LLPLE
Sbjct: 134 NGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLE 193

Query: 239 RVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTL 298
           RVH+E+ APF K                IEG YSHV Y RD+ +R+VW  PL + +   +
Sbjct: 194 RVHVEIIAPFPK---------------LIEGLYSHVLYLRDYYSRFVWMQPLASERVSEI 238

Query: 299 VDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIK 358
                TF ++ L   PIFVE+ST+ R DL E+ E +AS+YGL +GLG +  T F   G++
Sbjct: 239 TKAFLTFLLS-LPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVE 297

Query: 359 RFKTHLHRAKSECADDWLMCLKQGTYSANRVI-ERQLGKASNILFTELMGQFERDMRKKK 417
           R +  L + +  C   W MCLK G  + N     R LG   N+L + +   + R    K+
Sbjct: 298 RLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTV-SDYGRQFELKR 356

Query: 418 LKYIEQSFSENIKTYPKSG---GCIFIE 442
            + IE+ F+ N+      G   G I++E
Sbjct: 357 EELIEKLFASNVVELRNEGRRRGMIYLE 384

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  259 bits (661), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 148/447 (33%), Positives = 249/447 (55%), Gaps = 40/447 (8%)

Query: 77  DSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETK 136
           D +++ +++ RG  ++R+  + + G+LTQE Y L+ ++ L+ + +++  +   PN  E K
Sbjct: 42  DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENK 101

Query: 137 YSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYA 196
           Y  L+KR Y  K G + D K  +  V+EPD LF++I++AHL N H+    ++Q ++ +YA
Sbjct: 102 YV-LLKRRYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYA 160

Query: 197 NCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERVHIEVFAPFEKEEGDIK 256
           N TR+       YC+ CN DR ++   + +H N++E+L+PLER H+EVFAPF+ E  +  
Sbjct: 161 NVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVE-- 218

Query: 257 QEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIF 316
                    KI+GKYSH  YCRD+ +R++W  PL+ + F+ L+  +A    T++   PIF
Sbjct: 219 ---------KIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIR-VPIF 268

Query: 317 VESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWL 376
           +E++T+DR D+ +I E++A +Y  K+GLG  + T+F   GIKR K  L   K EC DDW 
Sbjct: 269 LETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWN 328

Query: 377 MCLKQGTYSANRV-IERQLGKASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKS 435
           MCL+      N+   +R  G  S++L  E+        ++K+ K I+Q ++ ++  + ++
Sbjct: 329 MCLRLVLSRVNQTYADRVRGIPSDLLCNEI-PNISMKFKQKQKKIIDQLYAHHVVHFKEA 387

Query: 436 GGCIFIEHVQDYEKTMESIDRTGTYKSGRKADQLPAED-TPTSHEPVANTTAINNRSTKA 494
           GG I++E   D E      D              P +D TP   EP   + +I N +T  
Sbjct: 388 GGMIYLE---DEESAFVMDD--------------PDDDCTPVPEEPPVASDSIQNSATIL 430

Query: 495 NKLNGPNLRKRTKEITEIPMSDSDDDE 521
             +        + +ITE  ++  D D+
Sbjct: 431 TPIT-------STQITENEVARQDPDQ 450

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  256 bits (655), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 143/404 (35%), Positives = 238/404 (58%), Gaps = 24/404 (5%)

Query: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118
           +F++P +++ +   L      ++++ L++G ++  +F   +AG+LTQ+ Y L+ ++ L++
Sbjct: 37  EFIVPPMNQKFVSCL---QLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSI 93

Query: 119 ETVMKAMNIWPPNAAETKYSNLIKRFYKDKE-GNIRDAKVDNNIVLEPDKLFNLILTAHL 177
             + +    W   ++E +Y  L  R++  +E G + D K D+ IV EP  +F+L++ +HL
Sbjct: 94  ANLERCHK-WKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHL 152

Query: 178 KNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPL 237
           +N H+ +  + + L + YAN TRD++ TA+ YC++CNPD   KP +K RH+N+  ELLPL
Sbjct: 153 QNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPL 212

Query: 238 ERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKT 297
           ERVHIEVF PF+ E              KI+G++SH+ Y RD+ +RYVW  PL+N K K 
Sbjct: 213 ERVHIEVFEPFDGE--------------KIQGRFSHLLYFRDYFSRYVWILPLQNDKRKH 258

Query: 298 LVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGI 357
           ++  +++F +  L   PIF+ES+TIDR+ L ++   +A  Y LKLGLG  N  +FH  GI
Sbjct: 259 MIRAMSSFLLG-LPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGI 317

Query: 358 KRFKTHLHRAKSECADDWLMCLKQGTYSANRVIE-RQLGKASNILFTELMGQFERDMRKK 416
           K  K  L   K EC  DW +CLK G +  N+ I     G+  ++LFT +     R   KK
Sbjct: 318 KDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSV-PDCNRKFVKK 376

Query: 417 KLKYIEQSFSENIKTYPKSGGCIFIEHVQDYEKTMESIDRTGTY 460
           +   I  + S+ +    +  G +F+E+ ++  KT+E++    T+
Sbjct: 377 RNDVILDTPSQQVVHLGE--GVLFLENNKEEHKTVEAVKENITH 418

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  254 bits (649), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 143/412 (34%), Positives = 233/412 (56%), Gaps = 21/412 (5%)

Query: 37  RATKRRPAGTSNMSSTELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFA 96
           R ++RR A TS   S E       ++P++ E+Y +Y+   DS ++++ L+RGE++   F 
Sbjct: 24  RKSQRRKA-TSPGESRESSKDRLLILPSMGESYTEYV---DSYLNLELLERGERETPIFL 79

Query: 97  EGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAK 156
           E L  +LTQ+ Y L+   +LT +T+ +  + +    AE K   L +++Y D EGN+RD +
Sbjct: 80  ESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGR 139

Query: 157 VDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPD 216
            ++ I  EP  ++++++  HL N HL+   L   L   +AN +   +     +C++CN  
Sbjct: 140 NNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKK 199

Query: 217 RYIKPIEKVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFY 276
             IKP+++ +  ++ ++LLP+ER+HIEVF PF  E               IEGKYS+V  
Sbjct: 200 GKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGE--------------AIEGKYSYVLL 245

Query: 277 CRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLAS 336
           CRD+R+ ++W  PLK+ KFK L+  +++ F+T     PIFV SST+D+DDL +I E +AS
Sbjct: 246 CRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLT-FARVPIFVTSSTLDKDDLYDICEEIAS 304

Query: 337 KYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGTYS-ANRVIERQLG 395
           KYGL++GLG  +  +FH  GI   +  L+  K EC  DW  CL+ G Y    R  +R   
Sbjct: 305 KYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRNKRTKR 364

Query: 396 KASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIEHVQDY 447
           K   +L +E+ G   +    K+ + IE ++S N+       G I++E V  +
Sbjct: 365 KPVQVLLSEVPGHNAK-FETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTF 415

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  254 bits (649), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 145/430 (33%), Positives = 240/430 (55%), Gaps = 33/430 (7%)

Query: 23  NLPSERPKFDIDGFRATKRRPA----GTSNMSSTELELYNKFVMPALDETYEDYLVGEDS 78
           +LPSE          AT++ P+     TS+  S +       ++P++ E+Y +Y+   DS
Sbjct: 16  SLPSES---------ATRKAPSQGRKATSSRESRDSSKDRLLILPSMGESYTEYV---DS 63

Query: 79  TIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYS 138
            ++++ L+RGE++   F E L  +LTQ+ Y L+   +LT +T+ +  + +    AE K  
Sbjct: 64  YLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLL 123

Query: 139 NLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANC 198
            L +++Y D EGN+RD + ++ I  EP+ ++++++  HL N HL+   L   L   +AN 
Sbjct: 124 FLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANI 183

Query: 199 TRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQE 258
           +   +     +C++CN    IKP+++ +  ++ ++LLP+ER+HIEVF PF  E       
Sbjct: 184 SHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGE------- 236

Query: 259 DSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVE 318
                   IEGKYS+V  CRD+R+ ++W  PLK+ KFK L+  I++ F++     PIFV 
Sbjct: 237 -------TIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLS-FARVPIFVT 288

Query: 319 SSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMC 378
           SST+D+DDL +I E +ASKYGL++GLG  +  +FH  GI      L+  K EC  DW  C
Sbjct: 289 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKC 348

Query: 379 LKQGTYS-ANRVIERQLGKASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGG 437
           L+ G Y    R  +R   K + +L +E+ G   +    K+ + IE ++S N+       G
Sbjct: 349 LRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAK-FETKRERVIENTYSRNMFKTAGGKG 407

Query: 438 CIFIEHVQDY 447
            I++E V  +
Sbjct: 408 LIYLEDVNTF 417

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  253 bits (645), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 144/428 (33%), Positives = 240/428 (56%), Gaps = 25/428 (5%)

Query: 21  GTNLPSERPKFDIDGFRATKRRPAGTSNMSSTELELYNKFVMPALDETYEDYLVGEDSTI 80
           G +LPSE  K      +++ +R   TS   S E       ++P + E+Y +Y+   DS +
Sbjct: 65  GDSLPSESAKS-----KSSPQRRKTTSPRESRESLKDRLLILPLMGESYTEYV---DSYL 116

Query: 81  DVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSNL 140
           +++ L+RGE++   F E L  +LTQ+ Y L+   +LT ET+ +  + +   AAE K   L
Sbjct: 117 NLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFL 176

Query: 141 IKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCTR 200
            +++Y D EGN+RD + ++ I  EP  ++++++  HL N HL+   L   L   +AN + 
Sbjct: 177 ERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSH 236

Query: 201 DFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDS 260
             +     +C++CN    IKP+++ +  ++ ++LLP+ER+HIEVF P+  +         
Sbjct: 237 AIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGK--------- 287

Query: 261 QNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESS 320
                 IEGKY +V  CRD+R+ ++W  PLK+ KFK L+  +++ F++     PIFV SS
Sbjct: 288 -----AIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLS-FARIPIFVTSS 341

Query: 321 TIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCLK 380
           T+D+DDL +I E +ASKYGL++GLG  +  +FH  GI   +  L+  K EC  DW  CL+
Sbjct: 342 TLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLR 401

Query: 381 QGTYS-ANRVIERQLGKASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCI 439
            G Y    R  +R   K + +L +E+ G   +    K+ + IE +++ N+ T     G I
Sbjct: 402 YGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAK-FETKRERVIENTYARNMFTMAGGKGLI 460

Query: 440 FIEHVQDY 447
           ++E V  +
Sbjct: 461 YLEDVNTF 468

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  252 bits (644), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 145/393 (36%), Positives = 215/393 (54%), Gaps = 37/393 (9%)

Query: 57  YNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNL 116
           Y  +++P + E+Y DY+   D  +DVD LKRGE     F   + G+L +  Y L+   +L
Sbjct: 88  YGSYLIPNVGESYMDYV---DPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSL 144

Query: 117 TMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAH 176
           T ET+  A N +P   A T+ +   +R+  D EG +RD    N IV +P  L+ +++T H
Sbjct: 145 TEETL--AAN-FPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCH 201

Query: 177 LKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLP 236
           L N H +       L  +YAN TRDF+  A+ +C+ CNP + + P+ K +H N  + +LP
Sbjct: 202 LMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLP 261

Query: 237 LERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFK 296
           LERVHIE+F PF  +              KIEGKYSHV YCRD+R+RY+   PLKN KFK
Sbjct: 262 LERVHIEIFEPFNGK--------------KIEGKYSHVIYCRDYRSRYIMLEPLKNTKFK 307

Query: 297 TLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQG 356
            LV  IA      L   PIF+E+ +++  D  +IFE +  KY + +GLG     +FH +G
Sbjct: 308 NLVSAIAKLLFN-LPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRG 366

Query: 357 IKRFKTHLHRAKSECADDWLMCLKQGTYSAN-RVIERQLGKASNILFTELMGQFERDMRK 415
           +K+ K  L   + EC +DW MCLK G ++ N +  +R  G   ++L   +     +D+  
Sbjct: 367 VKQMKILLEGHRKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNV-----KDVTH 421

Query: 416 KKLKYIEQSFSENIKTYPK------SGGCIFIE 442
           K ++  EQ     I+T PK        G I++E
Sbjct: 422 KSIEKYEQI----IRTLPKDNIVQIGNGSIYLE 450

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  248 bits (633), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 141/390 (36%), Positives = 214/390 (54%), Gaps = 29/390 (7%)

Query: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118
           +F MPA+ E  E Y  G    ++++ L+RG  D  ++ E + G+LTQ+ + L+ + +LT 
Sbjct: 18  EFDMPAVGEPIEKYHNG----LNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTE 73

Query: 119 ETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLK 178
           + +M   +       ETK+  L +R+Y D +G +RD K  + +V EP+ +F+LI+  HLK
Sbjct: 74  DNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLK 133

Query: 179 NGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLE 238
           NGHL    L   LR  YAN TR F Q  + YC++CNP+  ++P +K RH NI   LLPLE
Sbjct: 134 NGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLE 193

Query: 239 RVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTL 298
           RVH+E+ +PF +                IEG YSHV + RD+ +R+VW  PLK    + +
Sbjct: 194 RVHVEIISPFSE---------------AIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDI 238

Query: 299 VDNIATFFMTVLYDP--PIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQG 356
              +    + +   P  PIF+E+STIDR DL E  E +A +Y L +GLG +  + F   G
Sbjct: 239 TKGLLATLLLL---PRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNG 295

Query: 357 IKRFKTHLHRAKSECADDWLMCLKQGTYSAN-RVIERQLGKASNILFTELMGQFERDMRK 415
           ++R +  L R + +C   W MCLK G  + N     R LG   N+L + +   + R    
Sbjct: 296 VERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVC-DYGRQFEL 354

Query: 416 KKLKYIEQSFSENIKTYPKSG---GCIFIE 442
           K+   IE+ F+ N+     SG   G I++E
Sbjct: 355 KREDLIEKLFARNVVEIKVSGRRRGIIYLE 384

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  247 bits (631), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 136/434 (31%), Positives = 237/434 (54%), Gaps = 22/434 (5%)

Query: 80  IDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSN 139
           +D D+L  G  ++ +    + G+LTQ+ Y L+ +N L+ +T+++  +       E K+  
Sbjct: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFV- 109

Query: 140 LIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCT 199
           L+KR Y   +GN+ D K ++  V+EPD +F++I+ AHL NGHL    + Q L+ +YAN T
Sbjct: 110 LLKRRYSILQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVT 169

Query: 200 RDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQED 259
           RDF      YC+ CN DR +K   + +H N+ ++++PLER H+E+FAPF+ +  +     
Sbjct: 170 RDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNE----- 224

Query: 260 SQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVES 319
                 KIE KYSHV YCRD+ +R+VW  PL+ + F+ LV  +     +++   PIF+E+
Sbjct: 225 ------KIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIR-LPIFLET 277

Query: 320 STIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCL 379
           +T+DR D+ ++ E +A KY LK+GLG  + T F   G+ R K      K +C  +W MCL
Sbjct: 278 ATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCL 337

Query: 380 KQGTYSANR-VIERQLGKASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGC 438
           +      N+   +R  G  S++L  E+        + K+ K I++ ++ ++  + ++GG 
Sbjct: 338 RLVLTRVNQNYSDRVRGIPSDLLCNEI-SNIAHKFKLKQRKIIDELYAHHVVQFREAGGM 396

Query: 439 IFIEHVQDYEKTMESIDRTGTYKSGRKADQLPAEDTPTSHEPVANTTAINNRSTKANKLN 498
           I++E     + +   +D     + G + D +P  ++P+     ++    +N     N  +
Sbjct: 397 IYLED----DNSAFVVDED---EHGPENDNVPVTESPSKESMKSSNNIADNLLEPNNNSS 449

Query: 499 GPNLRKRTKEITEI 512
            P+ R    E + I
Sbjct: 450 IPSKRVLPSEKSSI 463

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  245 bits (625), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 133/389 (34%), Positives = 220/389 (56%), Gaps = 20/389 (5%)

Query: 60  FVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTME 119
            ++P++ E+Y  Y+   DS ++++ L+RGE++   F E L  +LTQ+ Y L+   +LT +
Sbjct: 49  LILPSMGESYTAYV---DSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTAD 105

Query: 120 TVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKN 179
           T+ +  + +    AE K   L +++Y D EGN+RD + ++ I  EP  ++++++  HL N
Sbjct: 106 TLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMN 165

Query: 180 GHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLER 239
            HL+   L   L   +AN +   +     +C++CN    IKP+++ +  ++ ++LLP+ER
Sbjct: 166 KHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMER 225

Query: 240 VHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLV 299
           +HIEVF PF                  IEGKY +V  CRD+R+ ++W  PLK+ KFK L+
Sbjct: 226 IHIEVFEPFTGG--------------AIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLI 271

Query: 300 DNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKR 359
             I++ F++     PIFV SST+D+DDL +I E +ASKYGL +GLG  +  +FH  GI  
Sbjct: 272 PVISSLFLS-FARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILC 330

Query: 360 FKTHLHRAKSECADDWLMCLKQGTYS-ANRVIERQLGKASNILFTELMGQFERDMRKKKL 418
            +  L+  K EC  DW  CL+ G Y    R  +R   K + +L +E+ G   +    K+ 
Sbjct: 331 IQYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAK-FETKRE 389

Query: 419 KYIEQSFSENIKTYPKSGGCIFIEHVQDY 447
           + IE ++S N+       G I++E V  +
Sbjct: 390 RVIENTYSRNMFKMAGGKGLIYLEDVNTF 418

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  236 bits (603), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 208/386 (53%), Gaps = 20/386 (5%)

Query: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118
           + V+P +     D L+ E S ++ +   RG +D+ +F   + G L+Q  Y L++ + LT 
Sbjct: 59  ELVLPEIKNL--DELISE-SGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTP 115

Query: 119 ETVMKAMNIWPPNAAETKYSNLIKRFY-KDKEGNIRDAKVDNNIVLEPDKLFNLILTAHL 177
           + V +    W  N +  KY  L  R+Y  DK   +RD + D+ I+  P+K+  ++L  HL
Sbjct: 116 KKVSREKVKWA-NKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHL 174

Query: 178 KNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPL 237
            N H     + + L + YAN +R   + +L YC+ CNP  ++KP++K +   + E LLP 
Sbjct: 175 INEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPF 234

Query: 238 ERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKT 297
           ER+HIE+F PF    GD K          IEG YSH+ Y RD+ +RYVW +PLK   FK 
Sbjct: 235 ERIHIEIFKPF----GDEKL---------IEGTYSHILYIRDYYSRYVWLYPLKKTAFKE 281

Query: 298 LVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGI 357
           L   + T+F T+    PI++ESSTI+R+DL  + + +A KY L++G+G  N + FH  G+
Sbjct: 282 LTQTLVTYFFTIT-KTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGL 340

Query: 358 KRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQ-LGKASNILFTELMGQFERDMRKK 416
           +  K  L   + EC  DW MCLK G    N +  R+ LG   N+L    + +     + K
Sbjct: 341 ETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSK 400

Query: 417 KLKYIEQSFSENIKTYPKSGGCIFIE 442
           K   I+++F  N+         I++E
Sbjct: 401 KNTVIDETFPHNMIVLDNGKSEIYLE 426

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  225 bits (574), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/356 (34%), Positives = 198/356 (55%), Gaps = 22/356 (6%)

Query: 53  ELELYNKFVM--PALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTL 110
           E+  Y K V   P +  T  +Y+   DS+  V FL+ G    + + + + G L+Q  Y L
Sbjct: 34  EVNRYGKVVFDYPKVGATLYEYI---DSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYEL 90

Query: 111 LMNNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFN 170
           + ++ L ++T+ +    W    A  K   L +R+   K+G + D   +N IV EPD  ++
Sbjct: 91  IRDDLLDVDTLSEKTR-WSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYD 149

Query: 171 LILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNI 230
            I++ H+ N HL    + + L+ +Y+N +RD+++  L +C+ CNPD+ I  +EK  H NI
Sbjct: 150 YIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNI 209

Query: 231 NEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPL 290
            E+ LPLERV +++F PFE E              KI+ +YSH+ Y RD+R+R+VW +PL
Sbjct: 210 YEKYLPLERVQLDIFEPFENE--------------KIQNRYSHIIYIRDYRSRFVWIYPL 255

Query: 291 KNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFT 350
           KN KFKTL   I    +  L   PI+++++TI+R D+  I + +A KY + LG+G    +
Sbjct: 256 KNTKFKTLASEIGMLLLD-LPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPS 314

Query: 351 KFHAQGIKRFKTHLHRAKSECADDWLMCLKQGTYSAN-RVIERQLGKASNILFTEL 405
            F++ G+ R K  L+  K +C  DW MCLK G+Y  N + I    G  S +   E+
Sbjct: 315 SFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEM 370

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  224 bits (571), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/388 (34%), Positives = 211/388 (54%), Gaps = 30/388 (7%)

Query: 60  FVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTME 119
           +++P + E Y+DY+   D  +D+ F++RGE++   F + + G+L + TY L+  N+LT E
Sbjct: 82  YLIPNIGEKYKDYV---DEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQE 138

Query: 120 TVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKN 179
           T+           A ++   L +R+  D++GN+RD    N +V EP  ++++I+T HL N
Sbjct: 139 TLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLIN 198

Query: 180 GHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLER 239
            H +     Q L  +Y+N TR FV+    +C+ CNP +   P +K +H N  + LLPLER
Sbjct: 199 DHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLER 258

Query: 240 VHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLV 299
           V +EVF PF              P  K+ GKY  + Y RD+R+R++W  PL+N KF  LV
Sbjct: 259 VQVEVFEPF--------------PGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLV 304

Query: 300 DNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKR 359
           D I+    +++   PIF E++TI+  D  +IFE +  KY + +GLG     K    G+ +
Sbjct: 305 DLISKMIFSMIR-IPIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQ 363

Query: 360 FKTHLHRAKSECADDWLMCLKQGTYS-ANRVIERQLGKASNILFTELMGQFERDMRKKKL 418
            +  L   K EC  DW+MCLK G ++  N++ +R  G   ++L  ++      D+  K  
Sbjct: 364 IRKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDI-----PDLYTKSY 418

Query: 419 KYIEQSF----SENIKTYPKSGGCIFIE 442
             IEQ      +ENI    +  GCI++E
Sbjct: 419 DKIEQILQDLPTENIVKIGR--GCIYLE 444

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  219 bits (557), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 140/464 (30%), Positives = 227/464 (48%), Gaps = 31/464 (6%)

Query: 43  PAGTSNMSSTELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGK 102
           PA  S   STE +   KFV+P        +  GE   +D D L  G   + +    + G+
Sbjct: 43  PASAST-ESTEPDF--KFVLPVKGFDLGSF-CGE---LDQDMLIEGRLQLEKEINTVKGQ 95

Query: 103 LTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIV 162
           LTQ  Y LL ++ LT E +++A +    +  E K+  L+KR Y  +E  + D K  + +V
Sbjct: 96  LTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFV-LLKRRYYVQENLLHDVKRKDLVV 154

Query: 163 LEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPI 222
            EP++LF+LI++ H+ N H+ +  ++  L   YAN T+ F +    +C++CN        
Sbjct: 155 YEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISY 214

Query: 223 EKVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRT 282
           +K +H NI+  L+PL R H+E+FAPF+       Q +     +KIEGKY  V YCRD+ +
Sbjct: 215 KKFKHENIHANLIPLGRCHVEIFAPFDSA----YQGNDNTDELKIEGKYPFVLYCRDYYS 270

Query: 283 RYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKL 342
           RYVW  PLK++    L+  + T  +  +   PIF+++ T+DR D+ ++ E +A  Y +K+
Sbjct: 271 RYVWLEPLKSVTLSDLLP-VMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKI 329

Query: 343 GLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILF 402
           GLG  + T F   GIKR K+   + K EC  DW MCLK      N+    ++    + L 
Sbjct: 330 GLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLL 389

Query: 403 TELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIE-------------HVQDYEK 449
                   +  R  +   I +    ++  + ++GG I++E             + ++ E 
Sbjct: 390 CSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENSPNLLLSGDDNSEESEH 449

Query: 450 TMESIDRTGTYKSGRKADQLPAEDTPTSHEPVANTTAINNRSTK 493
             E  D   + + G      P  + P+ H    N   IN  S K
Sbjct: 450 DSEIFDELASSRDGT-----PISEQPSPHRTNMNYDGINQESEK 488

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  211 bits (538), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/412 (32%), Positives = 214/412 (51%), Gaps = 25/412 (6%)

Query: 33  IDGFRAT-KRRPAGTSNMSSTELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKD 91
           I GF    +R P     + S+     N  ++P + + + +Y    D  +D++F KRGE+D
Sbjct: 6   IRGFTEEFERNPYDVDRIESSFSTETNPKLVPVIGDKWSNYA---DEKLDIEFCKRGERD 62

Query: 92  MRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGN 151
           +  +A    G+++QE Y L  N+++T E + +            K   + +R+YKD  G 
Sbjct: 63  ITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANGM 122

Query: 152 IRDAKVDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCN 211
           IRDA ++N IV +P   F++I++ HL N HL +  +++CLRE YAN     ++  L YC+
Sbjct: 123 IRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCS 182

Query: 212 RCNPDRYIKPIEKVRHRN-INEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGK 270
            CNP   + P  KV+ +  + E+ LPLER+ IE+  PF  E              K+EGK
Sbjct: 183 VCNPSLKLTP--KVQPKPYLFEKALPLERITIEIIEPFPNE--------------KVEGK 226

Query: 271 YSHVFYCRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEI 330
           YS++   +DF  R+ W  PLKN KFK +V  +A   ++     PI+VES+T+D  DL +I
Sbjct: 227 YSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILS-FPRVPIWVESNTLDWSDLFDI 285

Query: 331 FELLASKYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGTYSANRVI 390
           FE++ +KYG+K+GLG    +   AQ   R    L+    EC  D+  CLK G    N++ 
Sbjct: 286 FEMIVTKYGIKIGLGCTTRSS-AAQATARINRDLNDHHDECLFDFNNCLKYGPTKYNQIK 344

Query: 391 ERQLGKASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIE 442
                K+   + +    Q +   R K+   ++ S S  +    +  G +++E
Sbjct: 345 YLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMN--RGMGTLYLE 394

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  201 bits (512), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 215/401 (53%), Gaps = 27/401 (6%)

Query: 53  ELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLM 112
           +LE+   +    L  +Y DYL  ++S ++++ L++G KDM+R+    A  LTQE   +L 
Sbjct: 23  KLEMLKIYNPKDLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLN 82

Query: 113 NNNLTMETVMKA-MNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNL 171
              L+ E ++K    +   + A  KY+   +R+Y +++ NI D +    I+ EP  ++++
Sbjct: 83  TGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDI 142

Query: 172 ILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDR--YIK------PIE 223
           ++  HLK  H   AV  + L++ ++N  R ++     YC++C PD   ++K        +
Sbjct: 143 VIAYHLK-LHSSYAVS-ERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFK 200

Query: 224 KVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTR 283
            +R+  I+  L P+ER+HIE+F PF+               +KIE KY  + Y RD+ TR
Sbjct: 201 NIRNNIIDRPLFPMERIHIEIFNPFDD--------------LKIENKYQRILYIRDYSTR 246

Query: 284 YVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLG 343
           Y+W F LK +K K + + +  FF+++  + PIF++SSTID  DL +I E ++ +Y + LG
Sbjct: 247 YIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLG 306

Query: 344 LGFAN-FTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGT-YSANRVIERQLGKASNIL 401
           LG  N    FH  GI+ FK  ++  KS+C   W   L  G+    N+   R L K  +I+
Sbjct: 307 LGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDII 366

Query: 402 FTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIE 442
               + Q ++  R ++L+ I+Q+ ++N          IFIE
Sbjct: 367 NCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIE 407

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  166 bits (419), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/377 (28%), Positives = 184/377 (48%), Gaps = 32/377 (8%)

Query: 62  MPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETV 121
           +P LD  Y+   +   S ID++ +  G  D  +     +  LTQ+ YTL+   N   ET 
Sbjct: 24  IPELDILYK---IELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETF 80

Query: 122 MKAMNIWPPNA------AETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTA 175
            +AM     ++      A  K+  +  R+  ++ G I D + D  +++ P+++++LI+  
Sbjct: 81  EEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHC 140

Query: 176 HLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELL 235
           H  N HL +  +   LRE Y+N +R  V+ +L  C+ CNP    K IE  RH + ++   
Sbjct: 141 HFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKN-F 199

Query: 236 PLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKF 295
             E++H+E+F PFE  +                 K+SHV Y RD+ TRYVW +PL+ +  
Sbjct: 200 AFEKIHVEIFQPFEDVDT-------------FANKFSHVIYIRDYFTRYVWLYPLEKISV 246

Query: 296 KTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQ 355
           K L + +AT  +  L   PI++ES T+D  +L +I + ++    L LG+G     +F A 
Sbjct: 247 KELANTLATHLLLSL-RIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQAS 305

Query: 356 GIKRFKTHLHRAKSECADDW----LMCLKQGTYSANRVIERQLGKASNILFTELMGQFER 411
           GI   K    + +  C ++W    + C      + N+ I    G   N++  E +    +
Sbjct: 306 GINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWI---YGIPLNLMAQETLAD-NK 361

Query: 412 DMRKKKLKYIEQSFSEN 428
             +KK+ + I  + S+N
Sbjct: 362 TYKKKRQRTILLTLSKN 378

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  162 bits (411), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 97/326 (29%), Positives = 177/326 (54%), Gaps = 31/326 (9%)

Query: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118
           K+++P + + Y+  +      +D   L++GE  +   A      L++E Y L+ N++LT 
Sbjct: 30  KYIIPRIGQKYDSLIT---PLLDKQLLQKGEIAV---ANSKTNYLSKELYDLVKNDDLTR 83

Query: 119 ETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLK 178
           + V  A+N+   NA  T+   L  R+Y+D +  + D    N IV++P   F +++T HL 
Sbjct: 84  KNVAVALNLDEKNAI-TRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLL 142

Query: 179 NGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINE--ELLP 236
           N HL    +++ L + +AN +  F++T++ YC+ CN ++  K I + +   ++   ++L 
Sbjct: 143 NDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK--KNIRRKKEPQLSNSPDILF 200

Query: 237 LERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFK 296
            ER+ ++V APF  +              KI+ +Y+H+    DF T+++W FPLKN+K +
Sbjct: 201 YERLILDVVAPFGAK--------------KIQKRYTHILTITDFHTKFMWSFPLKNLKLR 246

Query: 297 TLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQG 356
           T++  + T F+  L   P+F+ S T+  +D+ E+   LA +Y + +GLG  N  K +++ 
Sbjct: 247 TIISKV-TEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN 305

Query: 357 --IKRFKTHLHRAKSECADDWLMCLK 380
             + R    L+  K+EC   W MCLK
Sbjct: 306 PYVTRI---LNSHKTECLKSWFMCLK 328

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  144 bits (363), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 113/393 (28%), Positives = 179/393 (45%), Gaps = 33/393 (8%)

Query: 60  FVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTME 119
           F  P + +  E Y    DS ID D LKRGEK+   F   L   +T + Y  + + +L  +
Sbjct: 28  FFCPPIGDDDEIYY---DSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLED 84

Query: 120 TVMKAMNIWP-PNAAETKYSN---LIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTA 175
                    P P + + K S    L  R+ K+ +G++ + K  N ++ EP  ++ L + A
Sbjct: 85  DA-------PIPASLKIKTSKKMYLQIRYSKNSDGDLIETKT-NKLLCEPKYIYKLTMKA 136

Query: 176 HLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEK-VRHRNINEEL 234
           H  N H+++  L++ L   Y N     V   L YC+ CN    I+ I      RN   + 
Sbjct: 137 HFMNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDY 196

Query: 235 LPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMK 294
           LPLER+ I++  PF   +            IKI  KYSH+   RD+ +RY W FPLK+  
Sbjct: 197 LPLERLQIDITKPFNDSD------------IKIANKYSHILLIRDYHSRYSWIFPLKSPN 244

Query: 295 FKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFE--LLASKYGLKLGLGFANFTKF 352
            K +   +  F +T L   PIF+ S  I    L +I    LL  K  +++G+G      F
Sbjct: 245 IKNISTELGKFLVT-LPRTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMF 303

Query: 353 HAQGIKR--FKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFE 410
             +GI R  +  +L   K +C  DW  C++  T+  NR  +R  G  +N L  +   +  
Sbjct: 304 LRKGISRLVYLLNLKENKEKCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELN 363

Query: 411 RDMRKKKLKYIEQSFSENIKTYPKSGGCIFIEH 443
           +    K+   +     EN+    + G  I+ ++
Sbjct: 364 KVFENKRDALLSDLLEENVLKIGECGSIIYFDN 396

>KLLA0F19514g Chr6 complement(1804838..1807057) [2220 bp, 739 aa]
           {ON} similar to uniprot|Q12072 Saccharomyces cerevisiae
           YLR095C IOC2 Member of a complex (Isw1b) with Isw1p and
           Ioc4p
          Length = 739

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 16/137 (11%)

Query: 299 VDNIATFFMTVLYDPPIFVES-STIDRDDLKEIFELL------ASKYGLKLGLGFANFTK 351
           ++++   + T+ +D   FVE   TID  D +E F+ L      A  YG KL         
Sbjct: 320 LNDVKIDYETLAHDYRSFVEYLQTIDDIDFQEFFQGLIEYHAEAEVYGRKLYANRLKQQS 379

Query: 352 FHAQGIKRFKTHLHRA------KSECADDWLMCL---KQGTYSANRVIERQLGKASNILF 402
             A  ++R ++    A      K E    W   L   +Q     NR++ R+  K  + L+
Sbjct: 380 MQALMVRRKRSSRIVARDEGHQKKETETKWYDKLDRREQFLRHRNRILTRRTKKLKDYLW 439

Query: 403 TELMGQFERDMRKKKLK 419
           + L  +F++D R+++LK
Sbjct: 440 SLLWEKFDKDFRQERLK 456

>TPHA0F00360 Chr6 (80013..83468) [3456 bp, 1151 aa] {ON} Anc_4.39
           YLR313C
          Length = 1151

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 71  DYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMN 126
           D+   ED TID D  K  E+D+ +  E   G++ ++  +   N +LT+ T + AMN
Sbjct: 758 DFTDTEDKTIDEDLDKAVEEDLNKSVE--TGRVIRDNKSSQENADLTVNTTVNAMN 811

>TDEL0C01490 Chr3 complement(256744..259965) [3222 bp, 1073 aa] {ON}
           Anc_7.398 YBL076C
          Length = 1073

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 364 LHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNIL--FTELMGQFERDMRKKKLKYI 421
           +H A +   +D+  CLK G +     I   +G A       T+  GQ+ +D  K  +KY+
Sbjct: 324 VHNAPAFGEEDFNACLKNGIFKEGDAIPNPVGDAGEFTAEVTDFSGQYVKDADKAIIKYL 383

Query: 422 EQS 424
             S
Sbjct: 384 TAS 386

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 365 HRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILFTELMGQFERDMRKKKLKYIEQS 424
            R+  EC+  W +  +  +Y  + +   ++ K+S +LF  L+G  +  M + K+  ++ +
Sbjct: 518 QRSDVECS--WKIQSESLSYLKHHMKSDRILKSSMLLFKFLLGHPQTTMDEIKMSNVDPN 575

Query: 425 FSENIKTYPKSGGCIFIEHVQD 446
           F+   +    S GCIF++  +D
Sbjct: 576 FA---RAETLSSGCIFVDVSRD 594

>Suva_2.31 Chr2 complement(57816..59222) [1407 bp, 468 aa] {ON}
           YBL086C (REAL)
          Length = 468

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 113 NNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGN 151
           N N    T  KA N WPPN+ +  YS++ KR Y +K+ N
Sbjct: 369 NPNYGKNTATKASN-WPPNSNDDGYSSMDKREYLEKKQN 406

>NDAI0J03010 Chr10 (748394..753361) [4968 bp, 1655 aa] {ON}
           Anc_4.375 YJR140C
          Length = 1655

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 52/138 (37%), Gaps = 10/138 (7%)

Query: 188 FQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERVHIEVFAP 247
           F C++       + F     F     N D Y+   +K RH+ +    + ++R+  +V   
Sbjct: 756 FYCIQSDEELIIQTFFHILKFLIGTLNSDDYMATTDKARHQLLLTVFVNIDRLTAQVTEI 815

Query: 248 FEKEEGDIKQEDSQNPYIKIEGKYSHVFY---------CRDFRTRYVWCFPLKN-MKFKT 297
             K E    Q   +N Y+ I      +FY           D     ++   +K+  K K 
Sbjct: 816 LSKNEWSEIQLPPKNDYLNILKDTFLLFYPILCFESLASIDLALTSIFQKAIKSTTKMKN 875

Query: 298 LVDNIATFFMTVLYDPPI 315
           L+ NI T F+      PI
Sbjct: 876 LIVNIVTLFIYFYCIKPI 893

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,844,474
Number of extensions: 2744824
Number of successful extensions: 9613
Number of sequences better than 10.0: 55
Number of HSP's gapped: 9895
Number of HSP's successfully gapped: 55
Length of query: 536
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 422
Effective length of database: 40,409,475
Effective search space: 17052798450
Effective search space used: 17052798450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)