Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B01727g8.257ON57757731070.0
KAFR0B055608.257ON60558317770.0
NCAS0B038708.257ON59658117440.0
NDAI0J014008.257ON58857917270.0
Kpol_392.98.257ON59458817160.0
TBLA0E044008.257ON58958617020.0
SAKL0H17160g8.257ON73952917050.0
TPHA0B032408.257ON58558516800.0
KLTH0G13794g8.257ON72552016850.0
Kwal_56.236078.257ON72552016810.0
KLLA0F19041g8.257ON76351616760.0
KNAG0H032608.257ON58057716390.0
YDR109C8.257ON71551416410.0
Ecym_43138.257ON59759516240.0
Suva_2.2698.257ON72553316230.0
ZYRO0C01782g8.257ON73052216100.0
Smik_4.3558.257ON70451216050.0
Skud_4.3708.257ON71451316050.0
TDEL0F038408.257ON72654815830.0
AGR092W8.257ON59658715540.0
Skud_14.891.111ON5695915759e-66
Suva_14.931.111ON5435915616e-64
YNL249C (MPA43)1.111ON5425945582e-63
Smik_14.861.111ON5435915213e-58
Kwal_33.135301.111ON5345934969e-55
ZYRO0F16016g1.111ON5425914872e-53
KLTH0F03080g1.111ON5335844564e-49
TDEL0C059001.111ON5435894531e-48
KNAG0F006601.111ON5355994292e-45
SAKL0C03432g1.111ON5475934241e-44
KLLA0C02937g1.111ON5164933525e-35
NCAS0A007801.111ON5495132081e-16
NDAI0H002204.9ON8101391039e-04
TPHA0K022804.9ON6671431020.001
NCAS0C059004.9ON703140980.003
KAFR0I015104.9ON705152960.005
TDEL0G018204.9ON698149940.009
Smik_8.94.9ON708136930.014
Skud_8.124.9ON710136860.078
Suva_8.194.9ON732136850.10
YHL032C (GUT1)4.9ON709130830.21
Ecym_84154.9ON651145810.29
Kpol_1070.24.9ON662150810.30
CAGL0E03916g4.9ON672152790.50
KLLA0E00595g4.9ON661101751.8
KAFR0F029902.390ON608128733.3
SAKL0H25938g4.9ON685103723.7
SAKL0F00462g3.581ON48462724.1
KLLA0A03399gna 1ON845109706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B01727g
         (577 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...  1201   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   689   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    676   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   669   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   665   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   660   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   661   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   651   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   653   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   652   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   650   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   635   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   636   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   630   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   629   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   624   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   622   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   622   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   614   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   603   0.0  
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   226   9e-66
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   220   6e-64
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   219   2e-63
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   205   3e-58
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   195   9e-55
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   192   2e-53
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   180   4e-49
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   179   1e-48
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   169   2e-45
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   167   1e-44
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   140   5e-35
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    85   1e-16
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    44   9e-04
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    44   0.001
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    42   0.003
KAFR0I01510 Chr9 (318409..320526) [2118 bp, 705 aa] {ON} Anc_4.9...    42   0.005
TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9...    41   0.009
Smik_8.9 Chr8 complement(20054..22180) [2127 bp, 708 aa] {ON} YH...    40   0.014
Skud_8.12 Chr8 complement(24374..26506) [2133 bp, 710 aa] {ON} Y...    38   0.078
Suva_8.19 Chr8 complement(37989..40187) [2199 bp, 732 aa] {ON} Y...    37   0.10 
YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}  GU...    37   0.21 
Ecym_8415 Chr8 (868289..870244) [1956 bp, 651 aa] {ON} similar t...    36   0.29 
Kpol_1070.2 s1070 complement(3357..5345) [1989 bp, 662 aa] {ON} ...    36   0.30 
CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} simila...    35   0.50 
KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON...    33   1.8  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...    33   3.3  
SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} simi...    32   3.7  
SAKL0F00462g Chr6 (41362..42816) [1455 bp, 484 aa] {ON} highly s...    32   4.1  
KLLA0A03399g Chr1 (305616..308153) [2538 bp, 845 aa] {ON} weakly...    32   6.3  

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score = 1201 bits (3107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/577 (100%), Positives = 577/577 (100%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
           AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
           EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGNQL 240
           SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGNQL
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGNQL 240

Query: 241 STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLAAV 300
           STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLAAV
Sbjct: 241 STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLAAV 300

Query: 301 AGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANELS 360
           AGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANELS
Sbjct: 301 AGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANELS 360

Query: 361 NLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAII 420
           NLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAII
Sbjct: 361 NLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAII 420

Query: 421 GQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLIA 480
           GQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLIA
Sbjct: 421 GQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLIA 480

Query: 481 NCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSNMTPDGTTVFP 540
           NCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSNMTPDGTTVFP
Sbjct: 481 NCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSNMTPDGTTVFP 540

Query: 541 ATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAIR 577
           ATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAIR
Sbjct: 541 ATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAIR 577

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/583 (56%), Positives = 426/583 (73%), Gaps = 9/583 (1%)

Query: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62
           ++IGVDVG+GSVRACV+D +G +L++  + IS+EE  PG +TQSS EIWD++C+CV+  I
Sbjct: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79

Query: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122
            ++ +    ++GIGFDATCSL V++KD+ E +A GP F  N+QNIIMWMDHRA +ET EI
Sbjct: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139

Query: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182
           N   D  LKYVGG+MS+EME+PKIKWLKNHM  E F+K VF DLPDYLTF A+G+  RS 
Sbjct: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199

Query: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241
           CSAVCKQG LP GVEGS++GWS  FL+  GL E+ ++ F  +GGP N S NF  AG  +S
Sbjct: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVS 259

Query: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVV---DIEECAGRLA 298
           T+S+S  +   +   C+VGSG+IDAYAG IGT+A+   E    ++     D++   GRLA
Sbjct: 260 TLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGRLA 319

Query: 299 AVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANE 358
           AVAGTSTCHI LS   IFV GVWGPY+D+L  DYWCAEGGQS TG LL H+++ HP+  E
Sbjct: 320 AVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEE 379

Query: 359 LSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAA 418
           L     +  +D F  LN  I +L+ +    T L LTK  FLYGDYHGNRSPIADP MRA+
Sbjct: 380 LKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRAS 439

Query: 419 IIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQL 478
           IIGQSMDT+++ LA  YLAACEFIAHQT+HII  +  AGH+I++IYMSGGQCRNNILM+L
Sbjct: 440 IIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILMEL 499

Query: 479 IANCTGLPLIIPKYIDSAVVFGSAILGAMA---YSSSKNNSDK--GGADLLWSTMSNMTP 533
           +A+ TGLP++IPKYID+AVVFG+A++GA A   ++  + N D+       LW+ M  MT 
Sbjct: 500 LADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAMVKMTG 559

Query: 534 DGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAI 576
           +GTT+ P       + L+N K+KI++DMAKTQ+ YR L+++++
Sbjct: 560 NGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDDSL 602

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/581 (55%), Positives = 427/581 (73%), Gaps = 10/581 (1%)

Query: 2   GYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSA 61
           GYY+G+DVG+GSVRACVVD  G MLS+  + I++EE  P  +TQS+ EIW A C+CVK+A
Sbjct: 15  GYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTA 74

Query: 62  IGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKE 121
           I    V+   +LGIGFDATCSLV + K + + V  GPNF+N + N+I+WMDHRA++E  E
Sbjct: 75  IEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANE 134

Query: 122 INRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRS 181
           IN + D CLKYVGG MSVEM+IPKIKWLKN+M P  FKK  F +L DYLTF A+G  TRS
Sbjct: 135 INATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRS 194

Query: 182 YCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP---NESGNFTYAGN 238
           +CS VCKQGFLP GVEGSS+GWS EFL+ IGLE+++ +++++LGG    +   NF  +G 
Sbjct: 195 FCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGK 254

Query: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST--IEVPNNKEVVDIEECAGR 296
            L  +S   +    ++  C+VG+GIIDAYAG IGT+A+++       N   + ++   GR
Sbjct: 255 CLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQNAIGR 314

Query: 297 LAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSA 356
           LA+VAGTSTCH++LSK  +FVPGVWGPYRDV+   YWCAEGGQ+ TG LL+++LSIHP+ 
Sbjct: 315 LASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAF 374

Query: 357 NELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMR 416
            EL N      +DKF +LNN + EL+ K+ + + L L K  F YGDY GNRSP ADP M 
Sbjct: 375 KELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMS 434

Query: 417 AAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILM 476
           AAIIGQSM+ ++++LA TYLAACEFIA QT+ I++T+  AG  +  IYMSGGQCRN +LM
Sbjct: 435 AAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLM 494

Query: 477 QLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKN---NSDKGGADLLWSTMSNMTP 533
           +L+++CTGLP+++PKY+D+AVVFG+AILGA A +S K+     D G   +LW TM  MTP
Sbjct: 495 KLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDFGF--MLWETMDRMTP 552

Query: 534 DGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVEN 574
            GT + P   +  +RKL++VK++IFLDMA+TQ+ YRQ+V++
Sbjct: 553 HGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDD 593

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/579 (54%), Positives = 419/579 (72%), Gaps = 9/579 (1%)

Query: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62
           YYIGVDVG+GSVRAC++DD G + S A   I ++E     +TQSS EIW AVC+CVK  +
Sbjct: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66

Query: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122
                    + GIGFDATCSLVV++K +   VA GP+F+++NQ+II+WMDHRA++ETKEI
Sbjct: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126

Query: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182
           N + D CLKYVGGQMS+EME+PKIKWLK HM+ + F +  F DL DYLTF A+G  TRS+
Sbjct: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186

Query: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP---NESGNFTYAGNQ 239
           CS VCKQG +P GVEGS  GWS +FL  I LEE++ +++  LGG    +   NF  AG  
Sbjct: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246

Query: 240 LSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLAA 299
           ++ +++  I+   ++  CIVGSGIIDAYAGW+GTV S T+++     V  +    GRLAA
Sbjct: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRV-GMANAIGRLAA 305

Query: 300 VAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANEL 359
           VAGTSTCHIVLSK  IFVPGVWGPY+D +   YWC EGGQS TGALL H+L  HPS  EL
Sbjct: 306 VAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKEL 365

Query: 360 SNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAI 419
             + ++  ++KF +LN  + E+++++N  + L L K  F YGD HGNRSP+ADP+M+ AI
Sbjct: 366 EEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAI 425

Query: 420 IGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLI 479
           +G SMDTS+D+LA+TYLAACEFIA Q + II+ + +AGH I AIYMSGGQCRN++LM+L+
Sbjct: 426 VGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLL 485

Query: 480 ANCTGLPLIIPKYIDSAVVFGSAILGAMA---YSSSKNNSDK--GGADLLWSTMSNMTPD 534
           A+C+GL +IIP+YIDSAVVFG+AILGA A   Y  + + SD      ++LWSTM+ MT  
Sbjct: 486 ADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMTKV 545

Query: 535 GTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573
           G+ + P  +D  +R L++ K+KIFLDMA  Q+ YR +V+
Sbjct: 546 GSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVD 584

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/588 (55%), Positives = 421/588 (71%), Gaps = 17/588 (2%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           M +YIGVDVG+GSVRACV++D+G +LS+ ++DI+KEE  P ++TQSS EIW  +C CV  
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
            +  S +    +LGIGFDATCSLVV++K++ + V  GPNF+++N+NII+WMDHRA++ET 
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
           EIN +GD CLKYVGG+MSVEME+PKIKWLKN++A   F    F DL DYLT+ A+  + R
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNES----GNFTYA 236
           S+ S VCKQG LP GVEGS  GWS EF TKI L+E+S  NF+A+GG   S     N    
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240

Query: 237 GNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVP--NNKEVVD--IEE 292
           G  +  +SE   K   +   CIVGSGIIDAYAGW+GTVA+   E+   NN +     ++ 
Sbjct: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS 300

Query: 293 CAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSI 352
             G LA +AGTSTCHI LS   IFV G+WGPYRDVL  ++WCAEGGQS TGALL HIL+ 
Sbjct: 301 SIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTT 360

Query: 353 HPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIAD 412
           HP+  EL    ++ +V  F FLNN + EL ++N+  + + L K FFLYGDYHGNRSPI+D
Sbjct: 361 HPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISD 420

Query: 413 PNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRN 472
            +MRAAIIGQSMDTS+D LA  YL+ACEFI+ Q++ II  L+ AGHTIK IYMSGGQ RN
Sbjct: 421 ESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARN 480

Query: 473 NILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS-------SKNNSDKGGADLLW 525
            +LM+L+A+CTGLP++IP+YID++V+FGSAILGA+A  +          N D G    LW
Sbjct: 481 QLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKT--LW 538

Query: 526 STMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573
           + M  +TP GT + P   +  +R L+N K+KIFLDMA+TQ+ YR+ ++
Sbjct: 539 NKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQID 586

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/586 (55%), Positives = 422/586 (72%), Gaps = 14/586 (2%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           M YYIGVDVG+GS RAC++D  G +LS+    I ++E  PG++TQS+N+IW+ +C C+++
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 61  AIGNSNVNN--GDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEE 118
            +  SNV++    I GIGFDATCSLVVLN  + + VA GPNF++N+QN+I+WMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 119 TKEINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVN 178
           T EIN +   CLKYVGGQMSVEMEIPKIKWLKN+M P  +K   F+DLPD+LT+ A+G +
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 179 TRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGN-----F 233
            RS+CSAVCKQG LP GVEGS+KGW+ EFL  IGLE++ + NF  LGGP +  +     F
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 234 TYAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST---IEVPNN-KEVVD 289
           + AG  +  +S+   K   I+  C V SGIIDAYAGWIGT+A+ST   IE  NN ++ ++
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 290 IEECA-GRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAH 348
              C+ GRLA VAGTSTCHI L+   IFVPGVWGPYRDVL  ++WCAEGGQS TGALL H
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 349 ILSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRS 408
           +L  HP+  EL  + KQ+++  F  LNN I EL+ + +L   + L K+ F YGD+HGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 409 PIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGG 468
           P+AD  MR  IIG SMD+S++DL R YL ACEFIA QT+HI+D +  +G+ + ++YMSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 469 QCRNNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSD--KGGADLLWS 526
           QCRN +LMQLI+NC GLP++IPK ID+AVVFGSA++GA A   SK++SD  K    +LW 
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKPDQILWD 540

Query: 527 TMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLV 572
            M  MT  G  V P    S   KL+ VK++I+LDM  TQ+ YR +V
Sbjct: 541 VMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMV 586

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/529 (59%), Positives = 393/529 (74%), Gaps = 10/529 (1%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           M YY+GVDVG+GS RAC++D+ G +LS+A R I ++E  P ++TQSS EIW A+CYCVKS
Sbjct: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
            + +S V    I GIGFDATCSLVV+  DS + VA GP+F N  QNII+WMDHRAI+ETK
Sbjct: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
           EIN + D CLKYVGGQMSVEMEIPKIKWLKN++  E+F+K  F DL DYLTF A+G+ TR
Sbjct: 152 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETR 211

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNES-----GNFTY 235
           SYCS VCKQG LP GVE S +GWS EFLT IGLE++ Q +F  LGG  +S       F  
Sbjct: 212 SYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGGSTFLS 271

Query: 236 AGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVPN----NKEVVDI 290
           AG  + ++  S  +   +   C+VGSG+IDAYAGW+GTVA+ T +++P     + E   I
Sbjct: 272 AGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGI 331

Query: 291 EECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHIL 350
           +   GRLAAVAGTSTCHI +SK  IFV GVWGPYRDV+ P +WCAEGGQS TGALLAH+L
Sbjct: 332 DHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVL 391

Query: 351 SIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPI 410
           +IHP+  ELS+L    +V KF +LN+ +  L+++    + + L K  F YGDYHGNRSPI
Sbjct: 392 TIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPI 451

Query: 411 ADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQC 470
           ADP+MRAA+IGQSMD S+DDLA  YL ACEFIA QT+ I++ +  +GH I AI+MSGGQC
Sbjct: 452 ADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQC 511

Query: 471 RNNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKG 519
           RN +LM+L+A+CTGLP++IP+YID+AVVFGSA+LGA+A  S   N   G
Sbjct: 512 RNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHKSG 560

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 5/88 (5%)

Query: 490 PKYIDSAVVFGSAILGA---MAYSSSKNNSDKGGADLLWSTMSNMTPDGTTVFPATEDSI 546
           P+  ++A+ FGS    A   +A    K+ S KG  D LW  M NMT  G  V P+++D  
Sbjct: 641 PEEANAALSFGSKKATAQEQLALEKEKSASGKG--DALWDVMYNMTGGGKVVQPSSDDHP 698

Query: 547 ERKLINVKHKIFLDMAKTQQTYRQLVEN 574
           +R L++ K+KIFLDMA+TQ+ YR+ V+ 
Sbjct: 699 DRVLLDAKYKIFLDMAETQRRYREAVDK 726

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/585 (54%), Positives = 413/585 (70%), Gaps = 8/585 (1%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           M  YIGVDVG+GS RAC+ +  G +L++  +DISK+E   G +TQSSNEIWDA+   +K 
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
            I  SNV+   I GI FDATCSLVV +K+S EP+A GPNFD++NQNII+WMDHRA  ET 
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
            IN + D  LKYVGG+MSVE E+PKIKWLK+H++PE F + VF+DL D+LT+ A+G    
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP--NESGNFTYAGN 238
           S+ SAVCKQG LP GVEGS  GWS EFL KIGLEE+S +NF  LGG    + GNF   G+
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD 240

Query: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST---IEVPNNKEVVDIEECAG 295
            +  V + F    N+   C+VG+G+IDAY+GW+GTVAS     +   + +E+  IE   G
Sbjct: 241 LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLG 300

Query: 296 RLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPS 355
           R+A V+GTSTCHIVLSK  +F+ GVWGPYRDVL  + W  EGGQSFTGALL +I+  HP+
Sbjct: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360

Query: 356 ANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNM 415
             EL  +  ++N + F +L+  + EL     L++   LTK+ F+YGDY+GNRSP+ADP M
Sbjct: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420

Query: 416 RAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNIL 475
              IIGQ+MD+S++DLA  YLAACEFIA QT+HIIDTL+  GH I AIYMSGG C+N +L
Sbjct: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480

Query: 476 MQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAY---SSSKNNSDKGGADLLWSTMSNMT 532
           M+LI+NC  LPL++ KYIDS+VVFG+AILG++A    S  +N  +    D+LWS M  MT
Sbjct: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLWSQMKLMT 540

Query: 533 PDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAIR 577
           P GT + P +E S+ RK +  K++++LDM  T   YR+ +E   +
Sbjct: 541 PKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/520 (58%), Positives = 388/520 (74%), Gaps = 9/520 (1%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           M YY+GVDVG+GS RAC++D  G +LS+A R I +E+     +TQSS EIW AVC+CVKS
Sbjct: 32  MLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKS 91

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
            + +S V    I GIGFDATCSLVV+ + + + VA GP+F N +QNII+WMDHRAIEET+
Sbjct: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQ 151

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
            IN +GD CLKYVGGQMSVEMEIPKIKWLKNH+   +F +  F DL DYLTF ASG  TR
Sbjct: 152 LINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETR 211

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGG----PNESGNFTYA 236
           S+CS VCKQG LP GVEGS++GWS EFLT+IGLEE+ + +F  +GG     ++  NF  A
Sbjct: 212 SFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSA 271

Query: 237 GNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVP----NNKEVVDIE 291
           G  +  +  +  +   ++  C+VGSG+IDAYAGW+GTVA+ T + +P     ++E V ++
Sbjct: 272 GEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMD 331

Query: 292 ECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILS 351
              GRLAAVAGTSTCHI +S+  IFV GVWGPYRD L  ++WCAEGGQS TGALLAH+L+
Sbjct: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLT 391

Query: 352 IHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIA 411
            HP+  ELS L    +V KF +LN+ +  L+++    + + L K  F YGDYHGNRSPIA
Sbjct: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIA 451

Query: 412 DPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCR 471
           DP+MRAAIIGQSMD S+DDLA  YL ACEFIA QT+ I+D +  +GH + AI+MSGGQCR
Sbjct: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCR 511

Query: 472 NNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS 511
           N +LM+L+A+CTGLP++IP+YID+AVVFGSA+LGA+A  S
Sbjct: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 551

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 514 NNSDKGGADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573
            +SD G  D +W+ M NMT  G  V PA E++ +R L+N K+KIFLDMA+TQ+ YR +V+
Sbjct: 663 RSSDNG--DAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720

Query: 574 NAIR 577
           +A+R
Sbjct: 721 DAVR 724

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/520 (58%), Positives = 389/520 (74%), Gaps = 9/520 (1%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           M YYIGVDVG+GS RAC++D  G +LS+A R I +E+  P  +TQSS EIW AVC+CVKS
Sbjct: 32  MLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKS 91

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
            + +S V +  I GIGFDATCSLVV+ + S + VA GP+F N NQNII+WMDHRAIEET+
Sbjct: 92  VVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETE 151

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
           +IN +GD CLKYVGGQMSVEMEIPKIKWLKNH+   +F +  F DL DYLTF ASG  TR
Sbjct: 152 QINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETR 211

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGG----PNESGNFTYA 236
           S+CS VCKQG LP GVEGS +GWS EFLT+IGLE+  + +F  +GG     ++  NF  A
Sbjct: 212 SFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSA 271

Query: 237 GNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVPN----NKEVVDIE 291
           G  +  +  +  +   ++  C+VGSG+IDAYAGW+GTVA+ T + +P     ++E V ++
Sbjct: 272 GEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMD 331

Query: 292 ECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILS 351
              GRLAAVAGTSTCHI +S+  IFV GVWGPYRD L  ++WCAEGGQS TGALLAH+++
Sbjct: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMT 391

Query: 352 IHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIA 411
            HP+  ELS L    +V KF +LN+ +  L+++    + + L +  F YGDYHGNRSPIA
Sbjct: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIA 451

Query: 412 DPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCR 471
           DP+MRAAIIGQSMD S+DDLA  YL ACEFIA QT+ I++ +  +GH + AI+MSGGQCR
Sbjct: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCR 511

Query: 472 NNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS 511
           N +LM+L+A+CTGLP++IP+YID+AVVFGSA+LGA+A  S
Sbjct: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 551

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 2/59 (3%)

Query: 514 NNSDKGGADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLV 572
            +SD G  D +W+ M NMT  G  V P  ED+ +RKL++VK+KIFLDMA+TQ+ YR LV
Sbjct: 663 RSSDNG--DAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLV 719

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/516 (59%), Positives = 388/516 (75%), Gaps = 6/516 (1%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           M YY+GVDVG+GS RACV+D+ G +LS+A R I + E  P ++TQSS EIW+A+CYCVK+
Sbjct: 34  MVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKN 93

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
            + +S V+   I GIGFDATCSLVV++ ++ E V  GP+F +N QNII+WMDHRAIEET+
Sbjct: 94  VVRDSGVDPRTIHGIGFDATCSLVVVDNNN-EDVGVGPDFTDNLQNIILWMDHRAIEETE 152

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
           EIN +GD CLKYVGGQMSVEMEIPKIKWLKN++  ++F +  F DL DYLTF A+G   R
Sbjct: 153 EINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIR 212

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGNQL 240
           SYCS VCKQG LP GVEGS  GWS EFL +IGLEE+   +F  LGG      F  AG  +
Sbjct: 213 SYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTETTFLSAGECI 272

Query: 241 STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVP---NNKEVVD-IEECAG 295
            T++E       ++  C+VGSG+IDAYAGW+GTVA+ T +E+P    + EV   I+   G
Sbjct: 273 GTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATG 332

Query: 296 RLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPS 355
           RLAAVAGTSTCHI +SK  IFV GVWGPYRDV+ P +W AEGGQS TGALLAH+L+ HP+
Sbjct: 333 RLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPA 392

Query: 356 ANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNM 415
             ELS L    NV KF +LN+ +  L+++    + + L K  F YGDYHGNRSPIADP+M
Sbjct: 393 YAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSM 452

Query: 416 RAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNIL 475
           RAAIIGQSMD S+DDL+  YL ACEFIA QT+ I++ + N+GH + AI+MSGGQCRN +L
Sbjct: 453 RAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLL 512

Query: 476 MQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS 511
           M+L+A+CTGLP++IP+YID+AVVFGSA+LGA+A  S
Sbjct: 513 MRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 548

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 37/52 (71%)

Query: 522 DLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573
           D LW  M NMT  G  V+P  ED+ +R L+N K+KIFLDMA TQQ YR+LV+
Sbjct: 709 DKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVD 760

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/577 (52%), Positives = 395/577 (68%), Gaps = 5/577 (0%)

Query: 2   GYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSA 61
           GYYIGVDVG+GS RA ++   GA L++    I ++E     +TQSS+EIW AVC+CV+  
Sbjct: 5   GYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGV 64

Query: 62  IGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKE 121
           +  S VN   + GIGFDATCSLV ++  + + V  GPNFD++ QNII+WMDHRA  ET  
Sbjct: 65  VTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDA 124

Query: 122 INRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRS 181
           IN +GD CLKYVGGQMSVEME+PKIKWLK HM   +F K  F DLPDYLTFMA+  + RS
Sbjct: 125 INATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRS 184

Query: 182 YCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESG-NFTYAGNQL 240
           +CSAVCKQG LP GV+GS   WS EFL  +GL E+  +NF  LGG +ES   F  AG  +
Sbjct: 185 FCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQPV 244

Query: 241 STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLAAV 300
             ++    +   ++  CIV SG+IDAYAGWIG+V +   +   + +   ++    RLA +
Sbjct: 245 GQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGA---KFDQSHKSSGLDVAITRLALI 301

Query: 301 AGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANELS 360
           AGTSTCHI+LSK   FVPGVWGPYRDVL+P YWCAEGGQS TGALLAHIL  HP+  EL 
Sbjct: 302 AGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEELV 361

Query: 361 NLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAII 420
            L  ++ V  F +L   +  L  K  +   L L++ FFLYGD+HGNRSP+ADP+MRA +I
Sbjct: 362 RLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATVI 421

Query: 421 GQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLIA 480
           GQSMD S++ LA  YLAACEFIA QT+ I++T++  GH ++ +YMSGGQCRN++LMQLIA
Sbjct: 422 GQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLIA 481

Query: 481 NCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSNMTPDGTTVFP 540
           +  G+P+++PKY D  VVFG+A+L   A S   +  +   +  LW  M+ MTP GT V P
Sbjct: 482 DSVGVPVVLPKYTDCCVVFGAALLACCA-SKGCDGIEADQSTRLWDIMTAMTPMGTRVLP 540

Query: 541 ATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAIR 577
             + S ERK ++ K+ IFLDM + Q+ YR  ++   R
Sbjct: 541 NDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFR 577

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/514 (58%), Positives = 378/514 (73%), Gaps = 10/514 (1%)

Query: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62
           +Y+GVDVG+GS RACV+D  G MLS+A + I +E+ +   +TQSS EIW+AVCYCV++ +
Sbjct: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98

Query: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122
             S V+   + GIGFDATCSLVV++  +FE +A GP+F NN+QNII+WMDHRA++ET+EI
Sbjct: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158

Query: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182
           N SGD CLKYVGGQMSVEMEIPKIKWLKN++    F+   F DLPDYLTF A+G   RS+
Sbjct: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241
           CSAVCKQGFLP GVEGS  GWS EFL  IGL E+++++F  LGG   E  NF  AG  +S
Sbjct: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECIS 278

Query: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASS-------TIEVPNNKEVVDIEECA 294
            + +       +   C+V SGIIDAYAGW+GTVA+          E  N K+  D     
Sbjct: 279 PLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKK--DFNGAI 336

Query: 295 GRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHP 354
           GRLAAVAGTSTCHI+LSK  IFV GVWGPYRDVL   +W AEGGQS TG LL H+++ HP
Sbjct: 337 GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHP 396

Query: 355 SANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPN 414
           +  ELS++     V KF +LN  +  L  K  + + + L K  F YGDYHGNRSPIADPN
Sbjct: 397 AFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPN 456

Query: 415 MRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNI 474
           MRA IIGQSMD S++DLA  YL+ACEFI+ QT+ II+ ++ +GH I AI+MSGGQCRN++
Sbjct: 457 MRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSL 516

Query: 475 LMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMA 508
           LM+L+A+CTGLP++IP+Y+D+AVVFGSA+LGA A
Sbjct: 517 LMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAA 550

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 9/80 (11%)

Query: 494 DSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSNMTPDGTTVFPATEDSIERKLINV 553
           D+++  G   LG   Y+         G   LW  M  +T +   V P  +   +R L++ 
Sbjct: 637 DASLTVGQESLGEGRYN---------GTSFLWKVMQELTGNARIVNPNEKTHPDRILLDT 687

Query: 554 KHKIFLDMAKTQQTYRQLVE 573
           K++IFLDM +TQ+ YR++V+
Sbjct: 688 KYQIFLDMIETQRKYRRMVD 707

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/595 (51%), Positives = 405/595 (68%), Gaps = 23/595 (3%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           + +YIGVDVG+ SVRACVVD  G +LS+A++ IS++E  P ++TQSSNEIW A+C+C++ 
Sbjct: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
            I +S V    I+GIGFDATCSLVVL + + + VA GPNFD+  Q+II+WMDHRAI+E  
Sbjct: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
           EIN +G  CLKYVGG+MS+EM+IPKIKWLKN++   +F K  F DLPD+LT+ A+G   R
Sbjct: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGG--PNESGNFTYAGN 238
           S+CS VCK G LP GV+GS+KGW  +    IGL E+ +  F+ LGG   + + NF  AG+
Sbjct: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGD 241

Query: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLA 298
            +  +S+       +   CIV SG+IDAYAGW+GT+A+      + +E    E  + RLA
Sbjct: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQES---ELASSRLA 298

Query: 299 AVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANE 358
            VAGTSTCHI +SK   F+ GVWGPYRD L+P YW  EGGQS TGALLAH+L  HP+ + 
Sbjct: 299 TVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDT 358

Query: 359 LSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAA 418
           L  L K + + KF F+NN + EL  +   ++   L K  F YGDYHGNRSPIADPNMRA 
Sbjct: 359 LCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRAT 418

Query: 419 IIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQL 478
           IIGQSMD S+DDLA   L ACEFIA QT+ I++ +  +GH I +IYMSGGQCRN +L++L
Sbjct: 419 IIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKL 478

Query: 479 IANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNN-SD-----------------KGG 520
           +ANCT LP+++PKYID+AVVFGSA+LG  A     +  SD                 K  
Sbjct: 479 LANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKPK 538

Query: 521 ADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENA 575
             +LW+ M+N+T  G  + P+     E +L++ K++IFLDM +TQ+ YR LV  A
Sbjct: 539 QSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRA 593

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/533 (57%), Positives = 386/533 (72%), Gaps = 6/533 (1%)

Query: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62
           +++GVDVG+GS RAC++D  G +LS+A + I +EE     +TQSS EIWDAVC+CVK+ +
Sbjct: 43  FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVL 102

Query: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122
             S V+   + GIGFDATCSLVV++    + +A GP+F NN+QNII+WMDHRA++ET+EI
Sbjct: 103 QESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEI 162

Query: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182
           N +GD CLKYVGGQMSVEM+IPKIKWLKN++  E FK   F +LPDYLTF A+G   RS+
Sbjct: 163 NSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSF 222

Query: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241
            SAVCKQGFLP GVE S  GWS EFL  IGL E++ ++F  LGG   +  NF  AG  + 
Sbjct: 223 ASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECVG 282

Query: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASS-TIEVP----NNKEVVDIEECAGR 296
            +  +      +   CIVGSGIIDAYAGW+GTVA+  +  +P    N  E  DI    GR
Sbjct: 283 FLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGR 342

Query: 297 LAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSA 356
           LAAVAGTSTCHI+LSK  IFV GVWGPYRDVL  ++W AEGGQS TGALLAH++  HP+ 
Sbjct: 343 LAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAF 402

Query: 357 NELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMR 416
            ELS L    ++  F +LN+ +  L +K N  + + L K FF YGDYHGNRSPIADPNMR
Sbjct: 403 TELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMR 462

Query: 417 AAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILM 476
           A IIGQSMD S++DLA TYL ACEFI+ QT+ II+ ++  GH I AI+MSGGQCRN +LM
Sbjct: 463 ACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLM 522

Query: 477 QLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMS 529
           +L+A+CTGLP++IP+YID+AVVFGSA+LGA A  +S   ++K       S++S
Sbjct: 523 RLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDLANEKTICQTRRSSLS 575

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%)

Query: 522 DLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573
           DLLW  M  +T +   V P  +   +R L++ K++IFLDMA+ Q+ YR +V+
Sbjct: 663 DLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVD 714

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/522 (56%), Positives = 376/522 (72%), Gaps = 11/522 (2%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           M YYIGVDVG+GS RAC++D  G ++S+A + I +EE  P ++TQSS EIW A+CYCVK+
Sbjct: 31  MIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKT 90

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
            + +S V+   I GIGFDATCSLV +N      V  GP+F+N +QNII+WMDHRA++ET 
Sbjct: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETA 150

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
           EIN +  P LKYVGGQMS+EMEIPKIKWLKNHM  E+F   VF DL D+LT+ A+G+ TR
Sbjct: 151 EINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTR 210

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP------NESGNFT 234
           S+ S+VCKQG LP GVEGS+ GWS EFL  I L E+  ++F  LGG       +   NF 
Sbjct: 211 SFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFL 270

Query: 235 YAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVPN----NKEVVD 289
            AG  +  +S        +   C+VGSG+IDAYAGW+GTVA+ T  E+P      K  + 
Sbjct: 271 SAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLG 330

Query: 290 IEECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHI 349
           +++  GRLAAVAGTSTCH+ LS+  IFVPGVWGPYRDV+ P +WCAEGGQS TGALLAH+
Sbjct: 331 VDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHV 390

Query: 350 LSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSP 409
           LS HP+  +L +L +   + KF +LN+ +  L       + + L K  F YGDYHGNRSP
Sbjct: 391 LSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSP 450

Query: 410 IADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQ 469
           IAD  MRAAIIGQSMD S+DDLA  YL ACEFIA QT+ I++ +  +GH I +I+MSGGQ
Sbjct: 451 IADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQ 510

Query: 470 CRNNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS 511
           CRN +LM+L+A+CTGLP+IIP+YID+AVVFGSA+LGA+A  S
Sbjct: 511 CRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASES 552

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 511 SSKNNSDKGGADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQ 570
           + K +++  G +L W  M +MT  G  V P  + + +R L+N K+KIFLDMA TQ+ YR 
Sbjct: 657 AEKTDTNSNGEEL-WKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRS 715

Query: 571 LVEN 574
            ++ 
Sbjct: 716 AIDR 719

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/512 (57%), Positives = 372/512 (72%), Gaps = 6/512 (1%)

Query: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62
           +Y+GVDVG+GS RAC++D  G +LS+A + I +EE L   +TQSS EIW+AVCYCV+  I
Sbjct: 30  FYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVI 89

Query: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122
             + V+   I GIGFDATCSLVV++   F+ +A GP+F NN+QNII+WMDHRA++ET+EI
Sbjct: 90  QEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEI 149

Query: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182
           N SG+ CLKYVGGQMSVEMEIPKIKWLKN++    F+   F DLPDYLTF A+G   RS+
Sbjct: 150 NFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSF 209

Query: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241
            S VCKQGFLP+GVEGS+ GWS +FL  IGL E++ ++F  LGG      NF  AG  + 
Sbjct: 210 SSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFLSAGECIG 269

Query: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVAS---STIE--VPNNKEVVDIEECAGR 296
            +     +   +   C+V SGIIDAYAGW+GTVA+   S I+    N     D     GR
Sbjct: 270 PLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAIGR 329

Query: 297 LAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSA 356
           LAAVAGTSTCHI+LSK+SIFV G+WGPYRDVL   +W AEGGQS TG LL H+++ HP+ 
Sbjct: 330 LAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHPAF 389

Query: 357 NELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMR 416
           ++LS L    NV KF +LN+ +  L  K    + + L K  F YGDY GNRSPIADPNMR
Sbjct: 390 SKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPNMR 449

Query: 417 AAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILM 476
           A IIGQSMD S+DDLA  YL ACEFI+ QT+ II+ ++ +GH I A++MSGGQCRN +LM
Sbjct: 450 ACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGLLM 509

Query: 477 QLIANCTGLPLIIPKYIDSAVVFGSAILGAMA 508
           +L+A+CTGLP++IP+YID AVVFGSA+LGA A
Sbjct: 510 RLLADCTGLPIVIPRYIDGAVVFGSALLGAAA 541

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 35/52 (67%)

Query: 522 DLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573
           ++LW  M  +T +   + P T+   +R L++ K++IFLDM +TQ+ YR++V+
Sbjct: 645 NILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVD 696

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/513 (57%), Positives = 371/513 (72%), Gaps = 8/513 (1%)

Query: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62
           +Y+GVDVG+GS RAC++D  G MLS+A + I +EE  P  +TQSS EIWDAVC+CVK+ I
Sbjct: 39  FYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVI 98

Query: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122
             S V+   + G+GFDATCSLVV++    + VA GP+F  N+QNII+WMDHRA++ET+EI
Sbjct: 99  QESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEI 158

Query: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182
           N S D CLKYVGGQMSVEMEIPKIKWLKN++  E F+   F DLPDYLTF A+G   RS+
Sbjct: 159 NSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241
            SAVCKQGFLP GVEGS+ GWS EFL  IGL E+ +S+F  LGG      NF  AG  + 
Sbjct: 219 SSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIG 278

Query: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVP------NNKEVVDIEECAG 295
           ++     +   +   C+V SG+IDAYAGW+GTVA+   E P      N     +     G
Sbjct: 279 SLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKP-ESPIRGLAENEDNTYNYNGAIG 337

Query: 296 RLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPS 355
           RLAAVAGTSTCHI+LSK  IFV G+WGPYRDVL   +W AEGGQS TG LL H++ IHP+
Sbjct: 338 RLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPA 397

Query: 356 ANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNM 415
             ELS L     V KF +LN+ +  + +K N  + + L +  F YGDYHGNRSPIAD NM
Sbjct: 398 YTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNM 457

Query: 416 RAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNIL 475
           RA IIGQSMD S++DLA TYL+ACEFI+ QT+ I++ ++ +GH I AI+MSGGQCRN++L
Sbjct: 458 RACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLL 517

Query: 476 MQLIANCTGLPLIIPKYIDSAVVFGSAILGAMA 508
            +L+A+C+GLP++IP+YID AVVFGSA+LGA A
Sbjct: 518 TRLLADCSGLPIVIPRYIDGAVVFGSALLGAAA 550

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 520 GADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVEN 574
           G  +LW  M  +T D   V P      +R L++ K++IFLDMA+TQ+ YR +V+N
Sbjct: 653 GTGILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDN 707

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/548 (54%), Positives = 391/548 (71%), Gaps = 18/548 (3%)

Query: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           M YY+GVDVG+GS RAC++D+ G +LS+A + I +EE  P ++TQSS EIW ++C+CVKS
Sbjct: 32  MIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKS 91

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120
            + +S V    I GIGFDATCSLVV++ +  E V  GP F NN+QNI++WMDHRAI ET 
Sbjct: 92  VVRDSGVPVERIHGIGFDATCSLVVVDDEDKE-VGVGPVFANNDQNIVLWMDHRAIAETN 150

Query: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180
           EIN + D CLKYVGGQMSVEMEIPKIKWLKN++  E+F K  F DL DYLTF A+  +TR
Sbjct: 151 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTR 210

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESG-------NF 233
           S+CS VCKQG +P GVEGS +GWS +FL  I L E+ ++ F     P  +        +F
Sbjct: 211 SFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSF 270

Query: 234 TYAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVPN----NKEVV 288
             AG  +  + E   +   +   C+VGSG+IDAYAGW+GTVA+ T +E+P+    ++   
Sbjct: 271 LSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKK 330

Query: 289 DIEECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAH 348
            I+   GRLAAVAGTSTCHI LS+  +FV GVWGPYRDV+   +W AEGGQS TGALLAH
Sbjct: 331 GIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAH 390

Query: 349 ILSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRS 408
           ++S HP+  ELS+L    N+ KF +LN+ +  L ++    + + L K  + YGDYHGNRS
Sbjct: 391 VMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRS 450

Query: 409 PIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGG 468
           PIADP+MRAAIIGQSMD S+DDLA  YL ACEFIA QT+ I++ + +AGH I  I+MSGG
Sbjct: 451 PIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGG 510

Query: 469 QCRNNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLW--- 525
           QCRN +LM+L+A+CTGLP+IIP+YID+AVVFGSA+LGA+A  S   NS    +++     
Sbjct: 511 QCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVA--SESFNSHHAKSEITRRRK 568

Query: 526 STMSNMTP 533
           S+++N+ P
Sbjct: 569 SSLTNLDP 576

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 8/78 (10%)

Query: 505 GAMAYSSSKNNSDKGGA--------DLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHK 556
           G +++  ++  S +G A        D LW  M  MT  G  V P+ ED  +R L+N K+K
Sbjct: 642 GPVSFKPTRATSQEGLATRNPPNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYK 701

Query: 557 IFLDMAKTQQTYRQLVEN 574
           IFLDMA +Q+ YR+ ++ 
Sbjct: 702 IFLDMADSQRRYREAIDK 719

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/587 (49%), Positives = 394/587 (67%), Gaps = 19/587 (3%)

Query: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62
           YY+GVDVG+   RAC++D  GA+L+     IS+ +    H+TQSS+EIW AVC  V++A+
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122
             S V   ++ GI FDATCSLVVL++DS   VA GP+F +N QN+I+WMDHRA+ E  EI
Sbjct: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128

Query: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182
           N +G   L+YVGG+MSVEM++PKIKWL+ HM   EF K  F DLPD+LT+ A+G+ +RS+
Sbjct: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188

Query: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGN-FTYAGNQL 240
           CS VCK G +P GV+ S+ GWS EFL +IGLEE+ +  F  LGG  +E G+ F  AG  +
Sbjct: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEPV 248

Query: 241 STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNN-KEVVDIEECAGRLAA 299
             +SE+   S  + P C+VGSG+IDAYAGW+GTV +S    P+  +E   +EE AGRLAA
Sbjct: 249 GLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGAS----PDGARESGGVEELAGRLAA 304

Query: 300 VAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANEL 359
           VAGTSTC I+LS+T  FV GVWGPYRDVL   YWC EGGQS TGALLAH L  HP+  EL
Sbjct: 305 VAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTEL 364

Query: 360 SNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAI 419
               +QR +  F ++N  + +L  +    +   L K  FLYGDYHGNRSP+ADP+MRAA+
Sbjct: 365 HQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAM 424

Query: 420 IGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLI 479
           +G SMD S DDLA   L A EFIA Q +HI+D +  AG  +  +Y+SGGQ RN +L QL+
Sbjct: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484

Query: 480 ANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADL------------LWST 527
           A+    P++ P+++ +AVVFGSA+L A A  +   N++   + +            LW  
Sbjct: 485 ADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQI 544

Query: 528 MSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVEN 574
           MS +T  G  V P+ +   + +L+  K+K+FL+MA+ Q+ YR+LV++
Sbjct: 545 MSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDD 591

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  226 bits (575), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 180/591 (30%), Positives = 276/591 (46%), Gaps = 79/591 (13%)

Query: 5   IGVDVGSGSVRACVVD-DQGAMLSMATRDI---SKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           IG+DVGS S R  + + +  A+L MA   +       +      Q S EI  A+  C++ 
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSSRTSWKFWQRSTEIIKALQKCLQK 93

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFE-PVAAGPNFDNNNQNIIMWMDHRAIEET 119
                 +   ++   G  ATCSL +  KD     +   PN DN    +I WMD  AI+E 
Sbjct: 94  L----KITEYNVKSCGVSATCSLAIFEKDKRNGSLIPYPNEDN----VIFWMDSSAIDEC 145

Query: 120 KEIN-RSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVN 178
           K++N       L ++GG    EM IPK+K+  N  +  + K+    DL  Y+ +  S + 
Sbjct: 146 KQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLY 205

Query: 179 TRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGN 238
             +    + ++     GV+G + GWS  F      E I     N + G N +        
Sbjct: 206 QWNNEVLLKRENNKMVGVDGEASGWSPSFY-----ENIMHLPSNVIIGSNGA-------- 252

Query: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLA 298
                +   I S+ I   CI      D+YA W   V+S  +E                L 
Sbjct: 253 -----TCKKIASSAIVRSCI------DSYASWFA-VSSPHLETS--------------LF 286

Query: 299 AVAGTSTCHIVLSK-TSIFVPGVWGPYRDVLVPD--YWCAEGGQSFTGALLAHILSIHPS 355
            +AGTSTC++  +  T I +PGVWGP+  +L  +  +     GQS TG L+ H+   HP 
Sbjct: 287 MIAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGKLIEHLFVTHPC 346

Query: 356 ANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNM 415
           A E    + +R  D +  L   I ++ ++N  ++  + TKD F YGDY GNR+P ADP M
Sbjct: 347 AKE----ILKRGADIYQVLERTIHDIEKQNG-QSVHVFTKDIFFYGDYEGNRTPFADPRM 401

Query: 416 RAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTL--MNAGHTIKAIYMSGGQCRNN 473
           + + IG++ DTS+ +L   Y+   EF++ QT+ IIDT    N G  I+ + +SG Q +N 
Sbjct: 402 KGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQELRISGSQAKNK 461

Query: 474 ILMQLIANC-TGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSNMT 532
            L+ LI+    G+ +  PK  D+  + G  + GA   + S N     G  ++       T
Sbjct: 462 RLLSLISLVNNGITINKPK--DNVDLMG--VRGAYLLAKSANE----GKQIIDVIRERDT 513

Query: 533 PDGTTVF-PATE------DSIERKLINVKHKIFLDMAKTQQTYRQLVENAI 576
            D    F P  E       S+ R+L+  K++I LDMAK QQ Y +L++   
Sbjct: 514 SDDNEKFEPLPEYQLLNDSSLLRRLLWAKYRIHLDMAKQQQRYHKLIDEVF 564

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  220 bits (561), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 182/591 (30%), Positives = 283/591 (47%), Gaps = 79/591 (13%)

Query: 5   IGVDVGSGSVRACVVDD-QGAMLSMATRDI---SKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           IG+D+GS S R  + D     +L+MA   +       K      Q S EI  A+  C + 
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVPYYHDSSKKSWKFWQKSTEIIKALQNCFQE 68

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKD-SFEPVAAGPNFDNNNQNIIMWMDHRAIEET 119
                 +   ++   G  ATCSL +  KD +   +   PN DN    +I WMD  A++E 
Sbjct: 69  L----KITQYNVRSCGVSATCSLAIFQKDLTNGNLIPYPNEDN----VIFWMDSSAVDEC 120

Query: 120 KEIN-RSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVN 178
           + +N +     L Y+GG+   EM IPK+K+  N  +  + K+    DL  Y+ +    + 
Sbjct: 121 EWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELGRLY 180

Query: 179 TRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGN 238
             +      ++     G +G + GWS+ F   I            +  P+   N T    
Sbjct: 181 RWNTDELSARENINGIGNDGEASGWSSSFYNDI------------MKLPS---NVTIG-- 223

Query: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLA 298
            L+ ++ +   ST     CI      D+YA W   V+S  +E                L 
Sbjct: 224 -LTGLNSNNSSSTTTVCSCI------DSYASWFA-VSSPNLEAS--------------LF 261

Query: 299 AVAGTSTCHIVLSK-TSIFVPGVWGPYRDVLVPD--YWCAEGGQSFTGALLAHILSIHPS 355
            +AGTSTC++  S  T+  +PGVWGP+  +L  +  Y     GQS TG L+ H+   HP+
Sbjct: 262 MIAGTSTCYMYGSPVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTGKLIEHLFKSHPA 321

Query: 356 ANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNM 415
           A +    +++   D +  L N I ++ +KN  ++  +L K  F YGDY GNR+P AD  M
Sbjct: 322 ARK----IQRSGEDIYEVLENSIQDIEKKNR-KSIHILAKHMFFYGDYEGNRTPFADSQM 376

Query: 416 RAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTL--MNAGHTIKAIYMSGGQCRNN 473
           R + IG+S DTS+ +L   Y++  EF++ QTK IIDT    N+G  I+ + +SG Q +N 
Sbjct: 377 RGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEELRVSGSQAKNG 436

Query: 474 ILMQLIANCT-GLPLIIP-KYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSN- 530
            L+ LI+    G+ +  P + ID   V G+ +LG  A      N  K   D++    +N 
Sbjct: 437 RLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSA------NEKKQIIDIIRERDANA 490

Query: 531 ----MTPDGTTVFPATEDSI-ERKLINVKHKIFLDMAKTQQTYRQLVENAI 576
                 P GT  +    D I  ++L++VK++I LDMAK QQ Y +LV+ A+
Sbjct: 491 DSEEFEPFGT--YQLGNDCILLKRLLSVKYRIHLDMAKQQQQYHRLVDEAL 539

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  219 bits (558), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 185/594 (31%), Positives = 274/594 (46%), Gaps = 83/594 (13%)

Query: 5   IGVDVGSGSVRACVVDD-QGAMLSMATRDI---SKEEKLPGHVTQSSNEIWDAVCYCVKS 60
           IG+DVGS S R  V +    A+L MA   +       K      Q S EI  A+  C++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKD-SFEPVAAGPNFDNNNQNIIMWMDHRAIEET 119
                N+   ++   G  ATCSL +  +D +   +   PN DN    +I WMD  A+ E 
Sbjct: 69  L----NIREYEVKSCGVSATCSLAIFERDRTSNMLIPYPNEDN----VIFWMDSSAVNEC 120

Query: 120 KEIN-RSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVN 178
           + +N +     L Y+GG+   EM +PK+K+  +  +    K     DL  Y+ +  S + 
Sbjct: 121 QWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLY 180

Query: 179 TRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGN 238
             +    + ++     G +G   GWS+ F   I                N   N +    
Sbjct: 181 EWNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI---------------INLPSNVSIGTT 225

Query: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLA 298
            L  V+   I ST +   CI      D+YA W   VAS  +E                L 
Sbjct: 226 SL--VANKHI-STTVVRSCI------DSYASWFA-VASPHLETS--------------LF 261

Query: 299 AVAGTSTCHI---VLSKTSIFVPGVWGPYRDVL--VPDYWCAEGGQSFTGALLAHILSIH 353
            +AGTS+C++    +S T I  PGVWGP+  +L    D+     GQS TG L+ H+   H
Sbjct: 262 MIAGTSSCYMYGTTISDTRI--PGVWGPFDTILDNRGDFSVYAAGQSCTGKLIEHLFESH 319

Query: 354 PSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADP 413
           P A +    + +   D +  L   I ++ + N L   +L TKD F YGDY GNR+P ADP
Sbjct: 320 PCARK----ILKDGADIYQVLEQTIRDIEKNNGLSIHIL-TKDMFFYGDYEGNRTPFADP 374

Query: 414 NMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHT--IKAIYMSGGQCR 471
            ++ + IG+S DTSM +L   Y+   EF++ QTK IIDT  N      IK + +SG Q +
Sbjct: 375 RIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRISGSQAK 434

Query: 472 NNILMQLIANC-TGLPLIIPKY-IDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMS 529
           N  L+ LI+    G+ +I PK  +D   + G+ +L   A         K  AD++  T  
Sbjct: 435 NERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSA------KEKKQLADVI--TER 486

Query: 530 NMTPDGTTVFPATE-----DSI-ERKLINVKHKIFLDMAKTQQTYRQLVENAIR 577
           +++ D        E     DSI  RKL+ VK+ I LDMAK Q+ Y +LV+   +
Sbjct: 487 DISNDSEKFESLAEYRLGNDSILLRKLLCVKYHIHLDMAKQQKRYHKLVDEVFQ 540

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  205 bits (521), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 172/591 (29%), Positives = 272/591 (46%), Gaps = 79/591 (13%)

Query: 5   IGVDVGSGSVRACVVDD-QGAMLSMATRDISKEE---KLPGHVTQSSNEIWDAVCYCVKS 60
           IG+D+GS S R  +      A+L MA   +   +   K      Q S EI +A+  C + 
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNK-DSFEPVAAGPNFDNNNQNIIMWMDHRAIEET 119
                 +   ++   G  ATCSL +  +  + E +   PN      N+I WMD  A +E 
Sbjct: 69  L----KITEYNVKSCGVSATCSLAIFERVHTSEALIPYPN----ENNVIFWMDSSATDEC 120

Query: 120 KEIN-RSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVN 178
           + +N       L Y+GG+   EM IPK+K+  N  +  + K+    DL  Y+ +    + 
Sbjct: 121 EWLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLY 180

Query: 179 TRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGN 238
             +    +  +     G +G + GWS+ F      + I     N + GP           
Sbjct: 181 QWNIDGLLRGENINGIGNDGEASGWSSSFY-----KNIMNIPSNVIIGP----------- 224

Query: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLA 298
            +  VS+  I ST +   CI      D+YA W   V+   +E                L 
Sbjct: 225 -VGLVSKKVI-STTVVRSCI------DSYASWFA-VSPPFLE--------------RSLF 261

Query: 299 AVAGTSTCHIVLSKTS-IFVPGVWGPYRDVL--VPDYWCAEGGQSFTGALLAHILSIHPS 355
            +AGTS+C++  +  S   +PGVWGP+ ++L    D+     GQS TG L+ H+   HP 
Sbjct: 262 MIAGTSSCYMYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGKLIEHLFESHPC 321

Query: 356 ANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNM 415
           A +    + +   D +  L   I  + +K  L   +L  KD F YGDY GNR+P ADP M
Sbjct: 322 ARK----ILKSGADIYQVLEQTIHGIEKKKGLSIHIL-AKDMFFYGDYEGNRTPFADPRM 376

Query: 416 RAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMN--AGHTIKAIYMSGGQCRNN 473
           + + IG++ DTS+ +L   Y++  EF++ QTK IIDT  +  A   I+ + +SG Q RN 
Sbjct: 377 KGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQELRISGSQARNE 436

Query: 474 ILMQLIANC-TGLPLIIPK-YIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSNM 531
            L+ LI+    G+ +  P+  +D   + G+ IL   A      N  K   D++     ++
Sbjct: 437 RLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSA------NEKKQLVDVI--RERDV 488

Query: 532 TPDGTTVFPATE------DSIERKLINVKHKIFLDMAKTQQTYRQLVENAI 576
             D     P +E       ++ + L+ VK++I LDMAK Q+ Y +LV+  I
Sbjct: 489 GDDNEKFQPLSEYCLGNDSTLLKNLLCVKYRIHLDMAKQQKYYYKLVDEVI 539

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  195 bits (496), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 174/593 (29%), Positives = 262/593 (44%), Gaps = 88/593 (14%)

Query: 5   IGVDVGSGSVRACVVD-DQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAIG 63
           +G+D+GS  VR    + +    +++ +R ++  E+  G  TQSS EI  A+  C +S   
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESL-- 65

Query: 64  NSNVNNGDILGIGFDATCSLVVLNKDS---FEPVAAGPNFDN-NNQNIIMWMDHRAIEET 119
             N++   +   G  ATCSL V  ++S    +P     +    N+QN++ WMD  AIEE 
Sbjct: 66  --NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 120 KEINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNT 179
             IN        Y GG    EM +PK+       +       VF    D  T++A  +  
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNNSDFEVF----DLHTYVAYDLAN 179

Query: 180 RSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGNQ 239
           R                     GW   FL       I++ N N +G     G      ++
Sbjct: 180 RY--------------------GWDASFL-------INRPNHNGIG---HDGEIKGWKDE 209

Query: 240 LSTVSESFIKSTNINPGCIVG-------SGIIDAYAGWIGTVASSTIEVPNNKEVVDIEE 292
               +     +  I P CI         +  ID Y+ W  ++ SST E            
Sbjct: 210 FYEKTLKLPPNVRIGPLCINRRFSPVKVASCIDCYSSWF-SMFSSTPE------------ 256

Query: 293 CAGRLAAVAGTSTCHIVLS-KTSIFVPGVWGPYRDVL----VPDYWCAEGGQSFTGALLA 347
               L   AGTSTC++  + K S  +PG+WGP+ D+L     P +   E GQS TG L+ 
Sbjct: 257 --RSLFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTGKLIE 314

Query: 348 HILSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNR 407
           H+   HP+A      ++ RNV  F+ L   I  L  + + E+    TK  F YG+  GNR
Sbjct: 315 HLFESHPAAKPY---LEDRNV-LFNRLETEI-NLIEQQSAESVHFKTKHMFNYGELQGNR 369

Query: 408 SPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSG 467
           +P  DP M    IG+S DTS  DL   Y+   EF+A Q +HI + L   G  I  I ++G
Sbjct: 370 TPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPINDIRVAG 426

Query: 468 GQCRNNILMQLIANCT-GLPLIIP-KYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLW 525
            Q +NN L+ LI+    G  + IP    D   V G+ +LG   +            +L+ 
Sbjct: 427 SQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLGKAKHLG------LNVVELIT 480

Query: 526 STMSNMTP--DGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAI 576
                 +P  D        E++  R L  +K+KI+L+MA+TQ+ YR++V  A+
Sbjct: 481 QENGGESPMKDIEVRIEKNEENKLRALFEIKYKIYLNMAQTQRQYREMVNAAL 533

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  192 bits (487), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 168/591 (28%), Positives = 273/591 (46%), Gaps = 84/591 (14%)

Query: 5   IGVDVGSGSVRACVVDDQG-AMLSMATRDIS---KEEKLPGHVTQSSNEIWDAVCYCVKS 60
           IG+D+GS SVR  + + Q   +++   + +      E      TQSS EI  A+  C + 
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQE 69

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLN-KDSFEPVAAGP-NFDNNNQNIIMWMDHRAIEE 118
                N++  +I   G  ATCSL +   KD+    A  P N D+ ++N++ WMD  AI+E
Sbjct: 70  L----NIDKHEIKSCGVGATCSLAIFQTKDN----ALIPWNLDDPDKNVVFWMDSIAIKE 121

Query: 119 TKEINRSGDPCLK-YVGGQMSVEMEIPKIKW----LKNHMAPEEFKKLVFMDLPDYLTFM 173
           T+E+N+   P ++ ++GG    EM +PK++     LKN      F+    +DL  Y+   
Sbjct: 122 TQEVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE---IIDLHRYIAMS 178

Query: 174 ASGVNTRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNF 233
            +  N   Y +          G +G   GWS+ F      E + Q   N + GP +    
Sbjct: 179 LAQQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFY-----ENVLQLPPNIVIGPTKHSQH 233

Query: 234 TYAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEEC 293
           +         S+  +K           S  ID Y+ W   + S+                
Sbjct: 234 S---------SKQGLKV----------SSCIDCYSNWFALLPSN---------------L 259

Query: 294 AGRLAAVAGTSTCHIVLS-KTSIFVPGVWGPYRDVL--VPDYWCAEGGQSFTGALLAHIL 350
              L  V GTSTC++  S + S  +PGVWGP+ ++      +   E GQS TG L+ H+ 
Sbjct: 260 QNSLFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTGKLIEHLF 319

Query: 351 SIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPI 410
             HP++   S++  +     FS +N++I E   +N  ++  + TK  F YGD  GNR+P 
Sbjct: 320 KTHPAS---SHIDTRDWPHLFSQINDFI-EKVEQNTQDSIHMQTKHMFFYGDLDGNRTPY 375

Query: 411 ADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTL--MNAGHTIKAIYMSGG 468
           ADP+M    IG++ DTS  +L   Y++  EFIA Q KH++     +N    I  +   G 
Sbjct: 376 ADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDISNLQFCGS 435

Query: 469 QCRNNILMQLIANCTGLPLIIPKYIDSAVV--FGSAILGAMAYSSSKNNSDKGGADLLWS 526
             +N  L+ L+A       I    +D A++  +GS ++G  +       SDK   ++  +
Sbjct: 436 LAKNKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKAS------TSDKSIVEVAHN 489

Query: 527 TMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAIR 577
              +  P      P   D +  +L+ VK++I+ +MA+ Q+ YR+ V N I 
Sbjct: 490 QTYSYRP------PEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNVIE 534

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  180 bits (456), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 161/584 (27%), Positives = 261/584 (44%), Gaps = 76/584 (13%)

Query: 5   IGVDVGSGSVRACVVD-DQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAIG 63
           +G+D+GS +VR  + D     ++ +  + +         VTQSS +I  A+  C++    
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQ---- 66

Query: 64  NSNVNNGDILGIGFDATCSLVVLNKD--SFEPVAAGPNFDNNNQNIIMWMDHRAIEETKE 121
           + N +   +L  G  ATCSL V  +D    +P+           N++ WMD  A  E + 
Sbjct: 67  DLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 122 INRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPE-EFKKLVFMDLPDYLTFMASGVNTR 180
           +N++     +++GG    EM IPK+  +     PE E  KL   DL  Y+ +  +     
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASI--FKKPEAEGHKLEVFDLHSYIAYELAIKYGW 184

Query: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGNQL 240
                + K      G +G  KGW   F       ++ +   N   GP  + N        
Sbjct: 185 DTSRIINKPNENRIGHDGELKGWDAGFYN-----DVLKLPANVKIGPIHALN-------- 231

Query: 241 STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLAAV 300
              +ES ++           +  ID Y+ W    +SS    PNN            L   
Sbjct: 232 ---TESPVRV----------ASCIDCYSNWFSMCSSS----PNNS-----------LFMA 263

Query: 301 AGTSTCHIVL-SKTSIFVPGVWGPYRDVL----VPDYWCAEGGQSFTGALLAHILSIHPS 355
           AGTSTC++   ++    +PGVWGP+ ++L      ++   E GQS TG L+ H+   HP+
Sbjct: 264 AGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLFETHPA 323

Query: 356 ANELSNLVKQRNVDK---FSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIAD 412
           A   S       +DK   FS + + I +L +    E+    +K  F YG+  GNR+P  D
Sbjct: 324 ARAYS-------MDKSKLFSAIESAIEKLEQDFG-ESVHFRSKHMFTYGELQGNRTPYCD 375

Query: 413 PNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRN 472
            +M    IG++ DTS  DL   Y+   EF+A Q KHI +        IK I ++G Q +N
Sbjct: 376 SSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKAE---IKDIRIAGSQAKN 432

Query: 473 NILMQLIANCTG-LPLIIP-KYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSN 530
             L+ L +     + + IP +  D   V G+ +LG  A+ +          D L S +  
Sbjct: 433 TRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNINIIDLIDKRDRLQSHILE 492

Query: 531 MTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVEN 574
           + P    +     ++  ++L+  K+KI+LDMA+TQ  YR +V++
Sbjct: 493 LGP----MKLGNHNTKLKQLLEAKYKIYLDMAQTQMRYRAMVDS 532

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  179 bits (453), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 168/589 (28%), Positives = 267/589 (45%), Gaps = 81/589 (13%)

Query: 5   IGVDVGSGSVRACVVD-DQGAMLSMATRDIS---KEEKLPGHVTQSSNEIWDAVCYCVKS 60
           IG+D+GS SVR  +   +   M+    + IS     +      TQS++EI   +  C+  
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMVQCVKQKISYYYHGDSALWEYTQSTDEIMKVIERCLH- 64

Query: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDS--FEPVAAGPNFDNNNQNIIMWMDHRAIEE 118
              +  ++  +I   G  ATCS+ +  K+    EP        ++ QN+I WMD+ +  E
Sbjct: 65  ---DLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISG--SHRQNVIFWMDNSSKTE 119

Query: 119 TKEINRSGDPCLK-YVGGQMSVEMEIPKIKWLKNHM-APEEFKKL--VFMDLPDYLTFMA 174
            K +N   +  L+ ++GG+   EM IPKI  L N++ + ++ + L  V MDL  YL +  
Sbjct: 120 CKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAYEI 179

Query: 175 SGVNTRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFT 234
           +     ++   +    F   G +G   GWS++F   I   +I  SN      P    +F 
Sbjct: 180 AKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFY--IDTLKIP-SNITIGPEPPLEDDFE 236

Query: 235 YAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECA 294
           Y                      IV S  ID Y+ W+   + +  E              
Sbjct: 237 YCKG-------------------IVAS-CIDCYSSWLSLCSPTPEE-------------- 262

Query: 295 GRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVL--VPDYWCAEGGQSFTGALLAHILSI 352
             L  V GTSTC++  +     +PGVWGP+ D+L     Y   EGGQS TG L+ H+L  
Sbjct: 263 -SLFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSCTGKLIEHLLQT 321

Query: 353 HPSANELSNLVKQRNVDKFSFLNNYI-LELS--RKNNLETPLLLTKDFFLYGDYHGNRSP 409
           HP+++ ++        D +  L   I  E+S   +    +    TK  F YGD+ GNR+P
Sbjct: 322 HPASSSIAK-------DDWPLLLEKIEQEISAIEEQTGRSIHFKTKHMFFYGDFQGNRTP 374

Query: 410 IADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNA--GHTIKAIYMSG 467
            ADP M    IG++ D S ++L   Y+   EF+A Q K++I     A     I  I + G
Sbjct: 375 YADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQGQDKITEIRICG 434

Query: 468 GQCRNNILMQLIANC-TGLPLIIPKY-IDSAVVFGSAILGAMAYSSSKNNSDKGGADLLW 525
            Q +N  L+ LI+    G  + +PK  ++ + V G+ +LG  A        +K   DL+ 
Sbjct: 435 SQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSAL------LNKSPLDLIQ 488

Query: 526 STMSNMTPDGTTVF--PATEDSIERKLINVKHKIFLDMAKTQQTYRQLV 572
                   D   +F  P++ +     L+  K++I LDMAK Q  YR+++
Sbjct: 489 EKDDQKQVD---IFETPSSINQPLSMLLEAKYEIHLDMAKQQLIYREMI 534

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  169 bits (429), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 169/599 (28%), Positives = 262/599 (43%), Gaps = 99/599 (16%)

Query: 5   IGVDVGSGSVRACVV---DDQGAMLSMATRDI-----SKEEKLPGHVTQSSNEIWDAVCY 56
           IG+D+GS SVR  +    DD  ++L + ++ +     S    L    TQ S EI  A+  
Sbjct: 8   IGIDLGSSSVRVGIYSLHDD--SLLGVFSKPVPYYYESNRTSL-WEYTQDSAEILTAIKE 64

Query: 57  CVKSAIGNSNVNNGDILGIGFDATCSLVVLNK---DSFEPVAAGPNFDNNNQNIIMWMDH 113
           C   A    ++   D+   G  ATCSLV+  +   D+F+      + + +++N++ WMD 
Sbjct: 65  CFDMA----DLQKYDVKSCGVAATCSLVLCERSGDDTFQ------HCEGDSRNVVFWMDS 114

Query: 114 RAIEETKEIN-RSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVF--MDLPDYL 170
            A EET  +N R     L ++GG    EM IPK+      ++ E    + +   DL  Y+
Sbjct: 115 MAKEETNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYV 174

Query: 171 TFMASGVNTRSYCSAVCKQGFLPK----GVEGSSKGWSTEFLTKIGLEEISQSNFNALGG 226
            +  +    + YC    +    P     G +G   GWS  F  KI    +       +G 
Sbjct: 175 AYKLA----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKI----VRLPPNVTIGC 226

Query: 227 PNESGNFTYAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKE 286
           P                     K+       ++    ID Y+ W   + S       NK 
Sbjct: 227 P---------------------KTIENEDSLVIVDSCIDCYSSWFSPLQSL------NKN 259

Query: 287 VVDIEECAGRLAAVAGTSTCHIV---LSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTG 343
                     L  VAGTSTC+I      KT   V G+WGP+ D+L  +    E G S +G
Sbjct: 260 T---------LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGSSCSG 310

Query: 344 ALLAHILSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDY 403
            L+ H+ + HPSA  L NL   + + K     N    +    N  +      + FLYGD 
Sbjct: 311 KLIEHLFTSHPSAISL-NLSTGQLISKLEEEIN----IWETQNATSIHFEACNNFLYGDL 365

Query: 404 HGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAI 463
            GNR+P  DP MR   IG+S DTS  DL   Y+   E +A QTK ++D      ++I  +
Sbjct: 366 DGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEKL-NSINEL 424

Query: 464 YMSGGQCRNNILMQLIA--NCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGA 521
           ++ G Q +N  L++LI+  N   L L+  +  D   V G+ +LG   Y  +         
Sbjct: 425 FICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAGYLGT-------SV 477

Query: 522 DLLWSTMSNMTPDGTTVFPATEDSIER----KLINVKHKIFLDMAKTQQTYRQLVENAI 576
           DL+   +S      +  +    D I++    KL+  K+ I L+MA+ QQ +R++V  A+
Sbjct: 478 DLV--PVSEPREYISVKYTNDSDKIQQTKLYKLLLTKYIIHLEMAEQQQRFRKMVSKAL 534

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  167 bits (424), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 162/593 (27%), Positives = 259/593 (43%), Gaps = 81/593 (13%)

Query: 5   IGVDVGSGSVRACVVD-DQGAMLSMATRDISKEE-KLPGHVTQSSNEIWDAVCYCVKSAI 62
           +GVD+GS SVR  +   +  ++L +  R +        G  TQS+ EI  A+  C+    
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL- 71

Query: 63  GNSNVNNGDILGIGFDATCSLVVLNKD----SFEPVAAGPNFDNNNQNIIMWMDHRAIEE 118
                    I+  G  ATCS+ V   +    S  P+       ++++N++ WMD  A E 
Sbjct: 72  -GLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVASEA 130

Query: 119 TKEINRSGDPCLKY-VGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGV 177
              +++     +K  + G    EM +PK+  L         + L   DL  Y+ +  +  
Sbjct: 131 CDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPG---RSLEVFDLHKYIAYDLA-- 185

Query: 178 NTRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNF--TY 235
             R Y                   GW    L        ++ N N +G   E G +   +
Sbjct: 186 --RRY-------------------GWDMAALA-------NRPNSNGIGHDGEVGGWPQEF 217

Query: 236 AGNQLSTVSESFIKSTNINPGCIVG-SGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECA 294
             N L   +   +   +   G  VG +  ID YA W G  ++     P            
Sbjct: 218 YRNVLKLPATVAVGPASTFKGQRVGVASCIDCYASWFGVCSTQ----PEQS--------- 264

Query: 295 GRLAAVAGTSTCHIVLSKTS-IFVPGVWGPYRDVLVPD--YWCA-EGGQSFTGALLAHIL 350
             L  VAGTSTC++  S  S   +PG+WGP+ ++L  +   W   E GQS TG LL H+ 
Sbjct: 265 --LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTTGRLLEHLF 322

Query: 351 SIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPI 410
             HP+A + +    +     F  L + I ++   +      L  +  FLYG+  GNR+P 
Sbjct: 323 ETHPAARDYAGDTGR----LFKDLEDRIADMEADSGCSIHHL-ARHMFLYGELQGNRTPY 377

Query: 411 ADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMN-AGHTIKAIYMSGGQ 469
           ADP M    +G++ DTS  +LA  Y+   EF+A QT+ I++     A   I  + ++G Q
Sbjct: 378 ADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIGELRVAGSQ 437

Query: 470 CRNNILMQLIANCTG-LPLIIP-KYIDSAVVFGSAILGAMAY--SSSKNNSDKGGADLLW 525
            RN  L+ L++   G +P+ +P +    A V G+ +LG   Y   S  +   K GA    
Sbjct: 438 ARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLGKARYLDVSLLDVVRKPGA---- 493

Query: 526 STMSNMTPDGTTVFPATEDSIE--RKLINVKHKIFLDMAKTQQTYRQLVENAI 576
            T+  +    ++ +PA   + E  R+L+  K+ I LDMA+ QQ YR  ++  I
Sbjct: 494 -TIPTVEVTESSNYPACGATKENLRRLLEAKYAIHLDMAQVQQRYRSEIDAVI 545

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  140 bits (352), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 134/493 (27%), Positives = 212/493 (43%), Gaps = 81/493 (16%)

Query: 5   IGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLP------GHVTQSSNEIWDAVCYCV 58
           IGVD+GS   R  + D     L   T+     EK+P      G +TQ +++I  AV    
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETK-----EKVPYFRHGNGIITQCTSDILTAV---- 56

Query: 59  KSAIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQ--NIIMWMDHRAI 116
           + A     +   +I  +G  ATCS+VV  +     +      D N +  +II WM   AI
Sbjct: 57  EKAFNTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAI 116

Query: 117 EETKEINRSGDP-CLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMAS 175
           EET+ +N   D   L + GG+   EM IPK+  L N +  ++   L  +DL  +L +  S
Sbjct: 117 EETEYLNNITDESILCHFGGKFFPEMAIPKLLHL-NKLYKDD--GLTVLDLHIWLLWKIS 173

Query: 176 GVNTRSYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTY 235
                     V +      G +G   GWS EF   + L +I   N NA+   NE      
Sbjct: 174 LKLGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIFIGN-NAVIKKNEQ----- 227

Query: 236 AGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAG 295
                                   G   ID YA W    +++ +                
Sbjct: 228 -----------------------FGDSCIDCYASWFQCWSTAMLN--------------R 250

Query: 296 RLAAVAGTSTCHIVLSKT-SIFVPGVWGPYRDVLV--------PDYWCAEGGQSFTGALL 346
            L  VAGTSTC +  S     F+PG+WGP++D+LV         +Y   E G S TG LL
Sbjct: 251 TLFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGISRTGVLL 310

Query: 347 AHILSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGN 406
             +LS HP+       VK  +V+    + + I +L  +++ ++  L+ K+ F + DY   
Sbjct: 311 EKLLSTHPA-------VKDSDVNFLETVEHKI-DLIEQSDTQSIHLMIKNTFFHEDYEEF 362

Query: 407 RSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMS 466
            S     +   +I+ +  + ++ DLA  Y+   E +A Q   +I+       TI  + ++
Sbjct: 363 ESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHITISKLLIT 422

Query: 467 GGQCRNNILMQLI 479
           G Q +N+ L+Q++
Sbjct: 423 GSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 122/513 (23%), Positives = 208/513 (40%), Gaps = 92/513 (17%)

Query: 5   IGVDVGSGSVRACVV--DDQGAMLSMATRDISKEE---KLPGHVTQSSNEIWDAVCYCVK 59
           IG+DVGS SVR  +   +D   + ++    + K E   KL  H TQ++  + D++     
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKL-WHYTQNAFVMRDSIF---- 59

Query: 60  SAIGNSNVNNGDILGIGFDATCSLVVLNKDS----FEPVAAGPNFDNNNQNIIMWMDHRA 115
           +A+   +VN+  +   G  ATCS+V L +DS      P+       NN  +II W DH A
Sbjct: 60  TALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTA 119

Query: 116 IEETKEINR---------SG--DPCLKYVGGQMSV--EMEIPKIKWLKNHMAPEEFKKLV 162
             E + +N          SG  +  L  +G +     EM IPK+  L N +    ++   
Sbjct: 120 QPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETPH 179

Query: 163 FMDLPDYLTFMASGVNTRSYCSAVCKQGFLPK----GVEGSSKGWSTEFLTKIGLEEISQ 218
            +++ D   ++A  +  +   + V  Q   P     G++G  +GW   F     +  + +
Sbjct: 180 ILEVYDLHVYIAQTLAQKYDWNTVHLQN-KPNVNGIGIDGELQGWDLSFY----VWALPE 234

Query: 219 SNFNALGGPNESGNFTYAGNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST 278
           ++F    GP++  N                +++ + P        ID YA W  T A + 
Sbjct: 235 TSFPICIGPSKVIN----------------ETSIVRP-----KSCIDCYASWFSTDACTK 273

Query: 279 IEVPNNKEVVDIEECAGRLAAVAGTSTCHI-VLSKTSIFVPG--------VWGPYRDVLV 329
            +                L   AGTSTC +  + ++++   G         WGP+ +VL 
Sbjct: 274 DDT---------------LFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFWGPFTNVLD 318

Query: 330 PDYWCA-EGGQSFTGALLAHILSIHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLE 388
            D   + E G S TG LL  + + H      S        +  +++ N I    RK +  
Sbjct: 319 KDKKSSFEIGFSETGILLEKLFNKHQITASWSV------AESINYVENQIAIYERKKS-- 370

Query: 389 TPLLLTKDFFLYGDYHGNRSPIA--DPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQT 446
             + L  + +L+  Y     P     P+         +  S   L   Y+A  E++A+Q 
Sbjct: 371 HSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAILEYLAYQV 430

Query: 447 KHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLI 479
            ++I         I  + +SG Q +N  L+ LI
Sbjct: 431 SNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 70/139 (50%), Gaps = 24/139 (17%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTL----MNAGH 458
           ++G  +P  DP+ RA I+G S  T+   +AR   AA E +  Q + I+  +    +  G+
Sbjct: 616 FNGLFAPYWDPDTRATIMGISQSTTASHIAR---AAIEGVCFQVRAILKAMSGDKIEDGY 672

Query: 459 ---TIKAIYMSGGQCRNNILMQLIANCTGLPLIIPKYIDSAVV----FGSAILGAMAYSS 511
              T+  + + GG  +++ +MQ+ A+  G P I  K   S +V     G+AI   MAY  
Sbjct: 673 EKGTVVTLSVDGGMSKSDEVMQIQADILG-PCI--KLRRSPIVECTALGAAIAANMAY-- 727

Query: 512 SKNNSDKGGADLLWSTMSN 530
            KN  D+    +LW  +++
Sbjct: 728 -KNVEDR----VLWKDLND 741

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 65/143 (45%), Gaps = 24/143 (16%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHII-----DTLMNAG 457
           + G  +P  DPN RA+I+G S  T+   +AR   AA E +  Q + I+     D L  +G
Sbjct: 472 FSGLFAPYWDPNARASIMGMSQYTTAAHIAR---AAVEGVCFQARAILKAMSSDVLQESG 528

Query: 458 --------HTIKAIYMSGGQCRNNILMQLIANCTGLPLIIPKYIDS-AVVFGSAILGAMA 508
                     +  + + GG  R++ +MQ+ AN  G  + + +   S     G+AI   M 
Sbjct: 529 DFEDTYEKSALSTLAVDGGMSRSDEVMQIQANILGPCVKVRRSPTSECTALGAAIAANMG 588

Query: 509 YSSSKNNSDKGGADLLWSTMSNM 531
           +   KN  D+     LW  + ++
Sbjct: 589 F---KNPDDR----TLWRELPDV 604

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 22/140 (15%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMN------- 455
           ++G  +P  DP+ RA I+G S  T+   +AR   AA E +  Q + I+  + +       
Sbjct: 509 FNGLFAPYWDPDTRATIMGISQSTTASHIAR---AAIEGVCFQVRAILKAMGSDEVYGDS 565

Query: 456 --AGHTIKAIYMSGGQCRNNILMQLIANCTGLPLIIPKY--IDSAVVFGSAILGAMAYSS 511
                 +  + + GG  ++N +MQ+ A+  G P I  +   I      G+AI   MAY  
Sbjct: 566 AYEKKNLATLAVDGGMSKSNEVMQIQADILG-PCIKLRRSPIVECTALGAAIAANMAYK- 623

Query: 512 SKNNSDKGGADLLWSTMSNM 531
                 K    +LW  ++++
Sbjct: 624 ------KEAERILWKDLNDV 637

>KAFR0I01510 Chr9 (318409..320526) [2118 bp, 705 aa] {ON} Anc_4.9
           YHL032C
          Length = 705

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 68/152 (44%), Gaps = 33/152 (21%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTL--------- 453
           + G  +P  D + RA I+G S  T+   +AR   AA E +  Q + I+  +         
Sbjct: 489 FSGLFAPYWDADARATIMGMSQYTTASHIAR---AAVEGVCFQARAILKAMSSDAYEGEI 545

Query: 454 ---------MNAGHTIKAIY----MSGGQCRNNILMQLIANCTGLPLIIPKY-IDSAVVF 499
                     N+G+  +A +    + GG  R+N +MQ+ A+  G  + + +  +  +   
Sbjct: 546 NDDIDLLEESNSGNYERAAFSVLAVDGGMSRSNEVMQIQADILGPCIKVRRSPVAESTAL 605

Query: 500 GSAILGAMAYSSSKNNSDKGGADLLWSTMSNM 531
           G+AI   MAY   KN  D+    +LW  + ++
Sbjct: 606 GAAIAANMAY---KNEEDR----ILWKDLHDV 630

>TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9
           YHL032C
          Length = 698

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 30/149 (20%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTL--------- 453
           + G  +P  DP  RA I+G S  T+   +AR   AA E +  Q + I+  +         
Sbjct: 489 FSGLFAPYWDPEARATIMGMSQFTTASHIAR---AAVEGVCFQARAILKAMSSDALGTKD 545

Query: 454 ------MNAGHTIKAIY----MSGGQCRNNILMQLIANCTGLPLIIPKY-IDSAVVFGSA 502
                 ++AG   K++     + GG  R++ +MQ+ AN  G  + + +         G+A
Sbjct: 546 RDFLEEVSAGTYEKSLLSTLAVDGGMSRSDEVMQIQANILGPCVKVRRSPTHECTALGAA 605

Query: 503 ILGAMAYSSSKNNSDKGGADLLWSTMSNM 531
           I   MA+   K+        L+W  + ++
Sbjct: 606 IAAEMAFKDPKDR-------LMWKDLKDV 627

>Smik_8.9 Chr8 complement(20054..22180) [2127 bp, 708 aa] {ON}
           YHL032C (REAL)
          Length = 708

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 61/136 (44%), Gaps = 27/136 (19%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMN------- 455
           + G  +P  DP+ RA I+G S  T+   +AR   AA E +  Q + I+  + +       
Sbjct: 501 FSGLFAPYWDPDARATIMGMSQFTTASHIAR---AAVEGVCFQARAILKAMSSDAFGEGS 557

Query: 456 ---------AGHT-----IKAIYMSGGQCRNNILMQLIANCTGLPLIIPKYIDSA--VVF 499
                    +G T     +  + + GG  R+N +MQ+ A+  G P +  +   +A     
Sbjct: 558 KDVDFLEEISGVTYEKSPLSVLAVDGGMSRSNEVMQIQADILG-PCVKVRRSPTAECTAL 616

Query: 500 GSAILGAMAYSSSKNN 515
           G+AI   MA+  SK+ 
Sbjct: 617 GAAIAANMAFKDSKSR 632

>Skud_8.12 Chr8 complement(24374..26506) [2133 bp, 710 aa] {ON}
           YHL032C (REAL)
          Length = 710

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 57/136 (41%), Gaps = 27/136 (19%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGH---- 458
           + G  +P  DP+ RA I+G S  T+   +AR   AA E +  Q + I+  + +       
Sbjct: 501 FSGLFAPYWDPDARATIMGMSQFTTASHIAR---AAVEGVCFQARAILKAMSSDAFGEGS 557

Query: 459 -----------------TIKAIYMSGGQCRNNILMQLIANCTGLPLIIPKYIDSA--VVF 499
                             +  + + GG  R+N +MQ+ A+  G P +  +   +A     
Sbjct: 558 KDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILG-PCVKVRRSPTAECTAL 616

Query: 500 GSAILGAMAYSSSKNN 515
           G+AI   MA+   K+ 
Sbjct: 617 GAAIAANMAFKDPKSR 632

>Suva_8.19 Chr8 complement(37989..40187) [2199 bp, 732 aa] {ON}
           YHL032C (REAL)
          Length = 732

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 57/136 (41%), Gaps = 27/136 (19%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGH---- 458
           + G  +P  DP+ RA I+G S  T+   +AR   AA E +  Q + I+  + +       
Sbjct: 524 FSGLFAPYWDPDARATIMGMSQFTTASHIAR---AAVEGVCFQARAILRAMSSDAFGEGS 580

Query: 459 -----------------TIKAIYMSGGQCRNNILMQLIANCTGLPLIIPKYIDSA--VVF 499
                             +  + + GG  R+N +MQ+ A+  G P +  +   +A     
Sbjct: 581 KDRDFLEEISDVTYEKTPLSVLAVDGGMSRSNEVMQIQADILG-PCVKVRRSPTAECTAL 639

Query: 500 GSAILGAMAYSSSKNN 515
           G+AI   MA+   K+ 
Sbjct: 640 GAAIAANMAFKDPKSR 655

>YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}
           GUT1Glycerol kinase, converts glycerol to
           glycerol-3-phosphate; glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p; derepression of
           expression on non-fermentable carbon sources is mediated
           by Opi1p and Rsf1p
          Length = 709

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 27/130 (20%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGH---- 458
           + G  +P  DP+ RA I+G S  T+   +AR   AA E +  Q + I+  + +       
Sbjct: 501 FSGLFAPYWDPDARATIMGMSQFTTASHIAR---AAVEGVCFQARAILKAMSSDAFGEGS 557

Query: 459 -----------------TIKAIYMSGGQCRNNILMQLIANCTGLPLIIPKYIDSA--VVF 499
                             +  + + GG  R+N +MQ+ A+  G P +  +   +A     
Sbjct: 558 KDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILG-PCVKVRRSPTAECTAL 616

Query: 500 GSAILGAMAY 509
           G+AI   MA+
Sbjct: 617 GAAIAANMAF 626

>Ecym_8415 Chr8 (868289..870244) [1956 bp, 651 aa] {ON} similar to
           Ashbya gossypii ACL069C
          Length = 651

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (45%), Gaps = 31/145 (21%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHI------------- 449
           + G  +P  D   R  I+G S  T+   +AR   AA E +  Q + I             
Sbjct: 444 FSGLFAPYWDSEARGTIMGMSQFTTASHIAR---AAIEGVCFQARAILKAMSSDAFGEAA 500

Query: 450 -----IDTLMNAG---HT-IKAIYMSGGQCRNNILMQLIANCTGLPLIIPKYIDSA--VV 498
                ++ L++AG   H+ +  + + GG  +++ +MQ+ A+  G P +  +   SA    
Sbjct: 501 KDSDFLEELVDAGTYEHSPLSILAVDGGMSKSDEVMQIQADILG-PCVKVRRSPSAECTA 559

Query: 499 FGSAILGAMAYSSSKNNSDKGGADL 523
            G+AI  +MAY   +N +D+   DL
Sbjct: 560 LGAAIAASMAY---ENPADRMWKDL 581

>Kpol_1070.2 s1070 complement(3357..5345) [1989 bp, 662 aa] {ON}
           complement(3357..5345) [1989 nt, 663 aa]
          Length = 662

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 60/150 (40%), Gaps = 31/150 (20%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGH---- 458
           + G  +P  D + RA I+G S  T+   +AR   AA E +  Q + I+  + +       
Sbjct: 465 FSGLFAPYWDQDARATIMGMSQYTTASHIAR---AAVEGVCFQARAILKAMSSDAFGGDG 521

Query: 459 ----------------TIKAIYMSGGQCRNNILMQLIANCTGLPLIIPKY-IDSAVVFGS 501
                            +  + + GG  R++ +MQ+ A+  G  + I +         G+
Sbjct: 522 DKDFLEEVSEEAYEQSPLSTLAVDGGMSRSDEVMQIQADILGPCIKIRRSPTHECTALGA 581

Query: 502 AILGAMAYSSSKNNSDKGGADLLWSTMSNM 531
           AI   MA+   K+        LLW  + ++
Sbjct: 582 AIAANMAFKDEKDR-------LLWKDLKDV 604

>CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032c GUT1
           glycerol kinase
          Length = 672

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 60/152 (39%), Gaps = 35/152 (23%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAG----- 457
           + G  +P  DP  R  I+G S  T+   +AR   AA E +  Q + I+  + N       
Sbjct: 467 FSGLFAPYWDPEARGTIMGMSQYTTASHIAR---AAVEAVCFQARAILLAMSNDAMGEAE 523

Query: 458 -----------------HTIKAIYMSGGQCRNNILMQLIANCTGLPLIIPKYIDSA--VV 498
                              +  + + GG  R++ +MQ+ A+  G P +  +   +A    
Sbjct: 524 KDSTFKTEISEEGSYQKSLLSTLAVDGGMSRSDEVMQIQADILG-PCVKVRRSPTAECTA 582

Query: 499 FGSAILGAMAYSSSKNNSDKGGADLLWSTMSN 530
            G+A+   MAY   ++        +LW  + +
Sbjct: 583 LGAAVAANMAYERPQDR-------VLWRDLQD 607

>KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 661

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 43/101 (42%), Gaps = 22/101 (21%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGH---- 458
           + G  +P  DP+ RA I+G S  T+   +AR   AA E +  Q + I+  + +       
Sbjct: 462 FSGLFAPYWDPDARATIMGMSQYTTASHIAR---AAVEGVCFQARAILKAMSSDAFGSED 518

Query: 459 ---------------TIKAIYMSGGQCRNNILMQLIANCTG 484
                           +  + + GG  R++ +MQ+ A+  G
Sbjct: 519 KDFLEEVVDETYEKTLLSTLAVDGGMSRSDEVMQIQADILG 559

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (42%), Gaps = 9/128 (7%)

Query: 238 NQLSTV--SESFIKSTNINPGCI--VGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEE- 292
           N+  TV  +E FI+ TN  P  +  +G G ID      G V S +I  PN +EVVD  + 
Sbjct: 232 NRQDTVKETEQFIRLTNF-PVFVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADF 290

Query: 293 --CAGRLAAVAGTSTCHIVL-SKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHI 349
               G L     TS  H    SK  + +      ++  + PD +     ++    L    
Sbjct: 291 VIVIGSLLTEFSTSAFHFFYKSKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGK 350

Query: 350 LSIHPSAN 357
           +S  P+++
Sbjct: 351 ISFRPTSD 358

>SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032C GUT1
           Glycerol kinase converts glycerol to glycerol-
           3-phosphate glucose repression of expression is mediated
           by Adr1p and Ino2p-Ino4p derepression of expression on
           non- fermentable carbon sources is mediated by Opi1p and
           Rsf1p
          Length = 685

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 43/103 (41%), Gaps = 24/103 (23%)

Query: 403 YHGNRSPIADPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGH---- 458
           + G  +P  DP+ RA I+G S  T+   +AR   AA E +  Q + I+  + +       
Sbjct: 478 FSGLFAPYWDPDARATIMGMSQYTTASHIAR---AAVEGVCFQARAILKAMSSDAFGEGE 534

Query: 459 -----------------TIKAIYMSGGQCRNNILMQLIANCTG 484
                             +  + + GG  R++ +MQ+ A+  G
Sbjct: 535 KDRDFLEEIEDETYERTALSTLAVDGGMSRSDEVMQIQADILG 577

>SAKL0F00462g Chr6 (41362..42816) [1455 bp, 484 aa] {ON} highly
           similar to uniprot|P04807 Saccharomyces cerevisiae
           YGL253W HXK2 Hexokinase isoenzyme 2 catalyzes
           phosphorylation of glucose in the cytosol predominate
           hexokinase during growth on glucose functions in the
           nucleus to repress expression of HXK1 and GLK1 and to
           induce expression of its own gene
          Length = 484

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 10/62 (16%)

Query: 2   GYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEE---KLPGHV-TQSSNEIWDAVCYC 57
           G Y+ +D+G  ++R  +V   G       RD    +   KLP H+ T S++E+W  +  C
Sbjct: 80  GDYLAIDLGGTNLRVVLVKLGG------NRDFDTTQSKYKLPDHIRTSSADELWSFIADC 133

Query: 58  VK 59
           +K
Sbjct: 134 LK 135

>KLLA0A03399g Chr1 (305616..308153) [2538 bp, 845 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 845

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 49/109 (44%), Gaps = 17/109 (15%)

Query: 314 SIFVPGVWG-PYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANELSNLVKQRNVDKF- 371
           SIF+  V+  PYR  L       +  Q F  + +  IL ++PSA E  N +K++ V  F 
Sbjct: 94  SIFIKFVFQTPYRKTLNTYLGTPDSYQEFNVSSILKILKLNPSAFEKLNPLKKKKVSAFI 153

Query: 372 ----------SFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPI 410
                     S  +N  L L+  N +  P  + +D  LYG Y    SPI
Sbjct: 154 EQILAQNQPASENSNSELFLATLNTMTAPRFI-EDKCLYGQY----SPI 197

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,178,997
Number of extensions: 2874699
Number of successful extensions: 7391
Number of sequences better than 10.0: 56
Number of HSP's gapped: 7445
Number of HSP's successfully gapped: 67
Length of query: 577
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 462
Effective length of database: 40,294,809
Effective search space: 18616201758
Effective search space used: 18616201758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)